Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C042101.318ON101873576e-45
KLTH0H10714g1.318ON106791614e-15
AEL167C1.318ON101781605e-15
KLLA0F01683g1.318ON98791562e-14
TBLA0F013201.318ON111771562e-14
NDAI0B047701.318ON113811512e-13
SAKL0D06952g1.318ON107771502e-13
Kwal_14.25861.318ON106771493e-13
NCAS0B074401.318ON110771493e-13
CAGL0I09372g1.318ON103881466e-13
Ecym_62891.318ON103791441e-12
TDEL0D018701.318ON100871423e-12
KNAG0C017701.318ON101771423e-12
Smik_2.4111.318ON105801423e-12
YBR268W (MRPL37)1.318ON105801414e-12
TPHA0O014701.318ON100851389e-12
Skud_2.4001.318ON105831381e-11
Suva_4.5291.318ON105811372e-11
Kpol_1035.251.318ON106771353e-11
ZYRO0G20702g1.318ON140771365e-11
YDL180W7.291ON54732690.38
TPHA0I029007.486ON25929604.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C04210
         (101 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...   142   6e-45
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...    67   4e-15
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...    66   5e-15
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...    65   2e-14
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    65   2e-14
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    63   2e-13
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...    62   2e-13
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...    62   3e-13
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    62   3e-13
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...    61   6e-13
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...    60   1e-12
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...    59   3e-12
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    59   3e-12
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    59   3e-12
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...    59   4e-12
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...    58   9e-12
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    58   1e-11
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    57   2e-11
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...    57   3e-11
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...    57   5e-11
YDL180W Chr4 (135896..137539) [1644 bp, 547 aa] {ON} Putative pr...    31   0.38 
TPHA0I02900 Chr9 (636781..637560) [780 bp, 259 aa] {ON} Anc_7.48...    28   4.4  

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score =  142 bits (357), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 72/87 (82%), Positives = 72/87 (82%)

Query: 15  VLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPI 74
           VLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPI
Sbjct: 15  VLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPI 74

Query: 75  XXXXXXXXXXXXXXXDKIKQKNFLSEL 101
                          DKIKQKNFLSEL
Sbjct: 75  QELELRRKQLRKLNRDKIKQKNFLSEL 101

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score = 66.6 bits (161), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 23  LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXX 82
           +VSSCP GTPL L ++K  K P+AL+D EYP WLW+VL+  +   + +  P+        
Sbjct: 31  VVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDPL---KLRKK 87

Query: 83  XXXXXXXDKIKQKNFLSEL 101
                  +KIKQ NFLSE+
Sbjct: 88  QLRSANRNKIKQNNFLSEI 106

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score = 66.2 bits (160), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 24  VSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXX 83
           VSSCP GTPL L ++KG K PLAL+D +YP WLW VL+ E+   +    PI         
Sbjct: 27  VSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPI---KARKKA 83

Query: 84  XXXXXXDKIKQKNFLSEL 101
                 + IKQ+NFL+++
Sbjct: 84  LRRMNREHIKQQNFLAKM 101

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score = 64.7 bits (156), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 23  LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXX 82
           +VSSCP GTPL L ++K  K P+AL+D EYP WLW+VL+   AN Q E            
Sbjct: 23  IVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLD---ANVQAEKLAADPIKLRKK 79

Query: 83  XXXXXXXDKIKQKNFLSEL 101
                    IKQ NFL+++
Sbjct: 80  QLRIANRANIKQNNFLAKI 98

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 64.7 bits (156), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSCP GT L+L V K  K P+AL+DE+YP WLWS+L   + +  K  SP+          
Sbjct: 37  SSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSIL---TPSNNKNPSPMEAIAQRKKVL 93

Query: 85  XXXXXDKIKQKNFLSEL 101
                D+IKQ NFL +L
Sbjct: 94  RKNNRDRIKQNNFLKQL 110

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 62.8 bits (151), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 46/81 (56%), Gaps = 4/81 (4%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQ----KELSPIXXXXXX 80
           SSC  GTPL L ++K  K P+AL+D+EYP WLW+VL+ ++AN +    K  S        
Sbjct: 33  SSCLAGTPLNLNIKKTGKEPIALEDKEYPEWLWTVLDTKTANGRAKSGKGTSVEESLLAR 92

Query: 81  XXXXXXXXXDKIKQKNFLSEL 101
                     KIKQ NFLS++
Sbjct: 93  KRQLRVETRKKIKQNNFLSQI 113

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score = 62.4 bits (150), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSCP GTPL L ++K  K  +AL+D EYP WLW+VL+E++ + +    P           
Sbjct: 34  SSCPAGTPLNLQIKKSGKETVALEDHEYPEWLWTVLDEKAQSAKLAQDP---AKLKKKQL 90

Query: 85  XXXXXDKIKQKNFLSEL 101
                +KIKQ NFL+++
Sbjct: 91  RKMNREKIKQNNFLTKI 107

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score = 62.0 bits (149), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSC  GTPL L ++K  K P+AL+D EYP WLWSVL++++   + +  P+          
Sbjct: 33  SSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWSVLDDKAQLKKLQEDPL---KLRKKQL 89

Query: 85  XXXXXDKIKQKNFLSEL 101
                 KIKQ NFLSE+
Sbjct: 90  RSANRQKIKQNNFLSEI 106

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 62.0 bits (149), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 40/77 (51%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSC  GT L L ++K  K P+AL+D EYP WLW VL  ++     +LS            
Sbjct: 33  SSCLAGTSLNLNIKKNGKDPIALEDNEYPAWLWKVLESKAPKEASDLSEQEVLAMRKKQL 92

Query: 85  XXXXXDKIKQKNFLSEL 101
                 KIKQ NFLS+L
Sbjct: 93  RKENRKKIKQNNFLSQL 109

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score = 60.8 bits (146), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 15  VLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNE-ESANTQKELSP 73
           VL++    + SSC  GTPL L V+K  K P+AL+D EYP WLW+VL++  +A   K    
Sbjct: 16  VLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVS 75

Query: 74  IXXXXXXXXXXXXXXXDKIKQKNFLSEL 101
                           +KIKQ+NFL++L
Sbjct: 76  EESLKARKKQIRQSNREKIKQRNFLNQL 103

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score = 60.1 bits (144), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 23  LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXX 82
           ++SSCP GTPL L ++K  K P+AL + EYP WLW VL+ +    +    P         
Sbjct: 28  IISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKLNEDPF---AARKK 84

Query: 83  XXXXXXXDKIKQKNFLSEL 101
                  +KIKQ NFLS +
Sbjct: 85  QLRKMNREKIKQNNFLSRI 103

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score = 59.3 bits (142), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 16  LQSTKCLLV-SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPI 74
           LQ T   +V SSCP GT L + V+K  K P+AL+D EYP WLW VL+ E+   +    P+
Sbjct: 17  LQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWEVLDPEARARKLAEDPM 76

Query: 75  XXXXXXXXXXXXXXXDKIKQKNFLSEL 101
                           +IKQ NFL +L
Sbjct: 77  KLRKKQIRKANRM---QIKQNNFLQQL 100

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 59.3 bits (142), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSC  GTPLKL +RK  + P+A++DEEYP WLW VL  E A      +            
Sbjct: 27  SSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVL--EPATGGDASARADPLAARRKEL 84

Query: 85  XXXXXDKIKQKNFLSEL 101
                ++IKQ N+LS+L
Sbjct: 85  RRKHRNEIKQSNYLSQL 101

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 59.3 bits (142), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 23  LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSP-IXXXXXXX 81
           +VSSCP GT L L + K  K  +AL+D+EYP WLW +LN E         P         
Sbjct: 26  VVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKDPEGEALLKRR 85

Query: 82  XXXXXXXXDKIKQKNFLSEL 101
                    +IKQ NFLS+L
Sbjct: 86  KNIRKANRQRIKQNNFLSQL 105

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score = 58.9 bits (141), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 23  LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSP-IXXXXXXX 81
           +VSSCP GT L L + K  K  +AL+D+EYP WLWSVL+ +         P         
Sbjct: 26  VVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWSVLDSDHVVEHAAEDPEGQALLKRR 85

Query: 82  XXXXXXXXDKIKQKNFLSEL 101
                    +IKQ NFLS+L
Sbjct: 86  KNIRKANRQRIKQNNFLSQL 105

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score = 57.8 bits (138), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 17  QSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXX 76
           +S   +L SSC  GTPL++ V K  K P+AL+D EYP WLW+VL++ +   + E  P+  
Sbjct: 19  ESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAARLENDPLKL 78

Query: 77  XXXXXXXXXXXXXDKIKQKNFLSEL 101
                          IKQ NFL ++
Sbjct: 79  RRKELRRKNRA---NIKQNNFLKQI 100

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 57.8 bits (138), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 23  LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNE----ESANTQKELSPIXXXX 78
           +VSSCP GT L L + K  K  LAL+++EYP WLWSVL+     E A   +E   +    
Sbjct: 26  VVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQDVEHAGQDQEGEAL---L 82

Query: 79  XXXXXXXXXXXDKIKQKNFLSEL 101
                       +IKQ NFLS+L
Sbjct: 83  KRRKNIRKANRQRIKQSNFLSQL 105

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 57.4 bits (137), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 22  LLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSP-IXXXXXX 80
           ++ SSCP GT L L + K  K   AL+D EYP WLWSVL+ + A       P        
Sbjct: 25  VVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWSVLDAKQAVDHAAKDPEGEALSQR 84

Query: 81  XXXXXXXXXDKIKQKNFLSEL 101
                     +IKQ NFLS+L
Sbjct: 85  KKNIRKANRQQIKQNNFLSQL 105

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score = 56.6 bits (135), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSCP G+ L L ++K  K P+AL+D EYP WLW+VL++E+        P+          
Sbjct: 33  SSCPAGSVLTLNIKKAGKDPVALEDAEYPTWLWTVLDKEAQAEALSKDPLALRKKKLRQA 92

Query: 85  XXXXXDKIKQKNFLSEL 101
                  IKQ NFL ++
Sbjct: 93  NRK---NIKQNNFLKQI 106

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score = 57.0 bits (136), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 25  SSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIXXXXXXXXXX 84
           SSCP GT + +  +K  K P+AL+D EYP WLW VL+ E+   + +  P+          
Sbjct: 67  SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPM---KLRKKQL 123

Query: 85  XXXXXDKIKQKNFLSEL 101
                +KIKQ NFL ++
Sbjct: 124 RKDNREKIKQNNFLKQI 140

>YDL180W Chr4 (135896..137539) [1644 bp, 547 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the vacuole
          Length = 547

 Score = 31.2 bits (69), Expect = 0.38,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 6/32 (18%)

Query: 49  DEEYP------GWLWSVLNEESANTQKELSPI 74
           DEE P      G+ W+V NE + NT K  +PI
Sbjct: 298 DEEQPILKKSFGYTWAVPNENTQNTTKSFTPI 329

>TPHA0I02900 Chr9 (636781..637560) [780 bp, 259 aa] {ON} Anc_7.486
          YJR113C
          Length = 259

 Score = 27.7 bits (60), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%)

Query: 42 KPPLALKDEEYPGWL--WSVLNEESANTQ 68
          KPP+ + DE+  GWL   S L EE + T+
Sbjct: 44 KPPINMSDEDVDGWLKTLSTLKEEFSQTE 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.131    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,898,217
Number of extensions: 252951
Number of successful extensions: 371
Number of sequences better than 10.0: 22
Number of HSP's gapped: 361
Number of HSP's successfully gapped: 22
Length of query: 101
Length of database: 53,481,399
Length adjustment: 72
Effective length of query: 29
Effective length of database: 45,225,447
Effective search space: 1311537963
Effective search space used: 1311537963
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)