Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C020203.499ON25825813500.0
NDAI0G008903.499ON25425511921e-167
Skud_7.4463.499ON25825811901e-167
YGR135W (PRE9)3.499ON25824711851e-166
CAGL0I10406g3.499ON25725611841e-166
Smik_6.2313.499ON25824711831e-166
Kpol_480.103.499ON25924711801e-165
Suva_7.4233.499ON25824711761e-164
NCAS0E007603.499ON25924711691e-163
SAKL0F02530g3.499ON25225211631e-163
ZYRO0D09746g3.499ON25325511601e-162
TPHA0A057003.499ON25625611601e-162
KNAG0B007603.499ON25925811521e-161
TDEL0D056703.499ON25525211431e-159
Ecym_12303.499ON25124811301e-158
Kwal_47.188983.499ON25125211251e-157
KLTH0G02376g3.499ON25125211221e-156
AFR318W3.499ON25125311061e-154
KLLA0E03917g3.499ON24925010981e-153
TBLA0D029203.499ON25825810831e-150
TPHA0H011905.64ON2602574199e-50
NDAI0C034005.64ON2632584191e-49
Kpol_1062.25.64ON2602524162e-49
Kwal_56.247805.64ON2622574162e-49
NCAS0D013405.64ON2612584128e-49
Ecym_81518.871ON2502484092e-48
ADL354W8.871ON2502224092e-48
KLTH0E16324g8.871ON2502134092e-48
SAKL0H02068g5.64ON2612394084e-48
TDEL0G008805.64ON2602574074e-48
KLLA0A05093g5.64ON2622034074e-48
KLTH0H00528g5.64ON2612574067e-48
Ecym_51005.64ON2612574067e-48
AER296W5.64ON2602394051e-47
CAGL0H07007g8.871ON2502194022e-47
CAGL0I02442g5.64ON2602034013e-47
ZYRO0C11770g5.64ON2602574014e-47
KAFR0B044405.64ON2602574005e-47
KLLA0D10373g8.871ON2502133987e-47
TBLA0C066205.64ON2622273971e-46
NDAI0E001608.871ON2502133952e-46
KLLA0B11836g7.120ON2542023952e-46
YGR253C (PUP2)5.64ON2602573953e-46
Suva_7.5495.64ON2602573953e-46
KNAG0J001808.871ON2502223944e-46
Smik_16.545.64ON2602573935e-46
KAFR0L020808.871ON2501943925e-46
KNAG0K004505.64ON2672193911e-45
Smik_13.438.871ON2502133883e-45
Skud_7.5865.64ON2602573883e-45
NDAI0H015207.120ON2522023874e-45
Suva_13.568.871ON2502133874e-45
SAKL0F04224g7.120ON2522023874e-45
Kwal_YGOB_Anc_7.1207.120ON2542023865e-45
Smik_15.1297.120ON2542023866e-45
Kpol_455.58.871ON2492143857e-45
TPHA0C049308.871ON2502143857e-45
KAFR0G030307.120ON2542023858e-45
TBLA0J019807.120ON2542023858e-45
Skud_13.518.871ON2502133849e-45
YML092C (PRE8)8.871ON2502133849e-45
KLTH0F13574g7.120ON2542023841e-44
CAGL0F01199g7.120ON2542053841e-44
NCAS0F010307.120ON2532023831e-44
YOL038W (PRE6)7.120ON2542023832e-44
Suva_15.1317.120ON2542023832e-44
Skud_15.1197.120ON2542023822e-44
SAKL0D00440g8.871ON2502203813e-44
NCAS0B001508.871ON2502133813e-44
AAR012C7.120ON2512023795e-44
ZYRO0G04136g7.120ON2542513796e-44
TDEL0B004008.871ON2502133771e-43
TPHA0I020707.120ON2562023771e-43
Kpol_1023.1087.120ON2542023743e-43
TBLA0C063408.871ON2562283744e-43
ZYRO0A00616g8.871ON2502133718e-43
Ecym_12727.120ON2512023711e-42
TDEL0H033007.120ON2562183701e-42
KNAG0L010207.120ON2661813562e-40
TBLA0E006907.20ON2781953215e-35
NCAS0I002507.20ON2922203191e-34
ZYRO0C00792g7.20ON2901953182e-34
ADR401C7.20ON2791953154e-34
CAGL0H06105g7.20ON2901943147e-34
Smik_15.5467.20ON2881723121e-33
NDAI0A087707.20ON2921953112e-33
KAFR0C050007.20ON2811723093e-33
Skud_15.5307.20ON2881953103e-33
YOR362C (PRE10)7.20ON2881953076e-33
KLTH0D00902g7.20ON2771823068e-33
AGL089W4.110ON2462023048e-33
Kpol_538.407.20ON2741723051e-32
Ecym_72334.110ON2462063021e-32
TDEL0H043107.20ON2741723023e-32
KLLA0A03487g7.20ON2751723006e-32
KLLA0A05027g4.110ON2462052986e-32
Suva_8.4197.20ON2921722991e-31
KNAG0E002307.20ON2792052972e-31
TPHA0N002407.20ON2772202953e-31
ZYRO0G10164g4.110ON2532462916e-31
Kwal_47.174934.110ON2462472907e-31
Ecym_50197.20ON2851722921e-30
TBLA0C040804.110ON2532042901e-30
SAKL0D14476g7.20ON2811722911e-30
Kpol_1061.454.110ON2561792848e-30
KLTH0E07788g4.110ON2462472838e-30
Kwal_27.97208.871ON1731392779e-30
TPHA0F006704.110ON2572042812e-29
KLTH0B09504g5.1ON2332232792e-29
CAGL0M14003g5.1ON2332212793e-29
YGL011C (SCL1)4.110ON2521972793e-29
KNAG0E011805.1ON2332202774e-29
NCAS0A016404.110ON2532452786e-29
Kwal_26.94835.1ON2332352766e-29
Suva_7.2704.110ON2521972777e-29
CAGL0A00407g4.110ON2542432769e-29
SAKL0H21956g4.110ON2482212751e-28
Smik_7.2794.110ON2521772752e-28
Skud_7.2764.110ON2521772724e-28
TDEL0F023604.110ON2532002682e-27
Kpol_1060.15.1ON2332352662e-27
TPHA0A056705.1ON2332212662e-27
NCAS0D023105.1ON2332192627e-27
NDAI0I026405.1ON2332192628e-27
KNAG0D035404.110ON2522352621e-26
YMR314W (PRE5)5.1ON2342222601e-26
ZYRO0C01144g5.1ON2332232602e-26
AGL336W5.1ON3062212615e-26
KLLA0A10153g5.1ON2332242566e-26
Skud_13.4885.1ON2342202567e-26
Smik_13.5315.1ON2342202559e-26
Ecym_56505.1ON2332192532e-25
KAFR0I027205.1ON2352252523e-25
KAFR0F034304.110ON2522002533e-25
Suva_13.5075.1ON2342202513e-25
SAKL0H00946g5.1ON2332232487e-25
TBLA0C071905.1ON2332242443e-24
TDEL0G002405.1ON2382242295e-22
Kwal_26.68197.20ON1961421671e-13
NDAI0D035604.110ON1721031555e-12
Smik_15.3375.507ON2611611322e-08
Suva_8.2085.507ON2611611322e-08
NDAI0C011705.507ON2631651322e-08
AGL324W7.480ON2432091313e-08
Skud_15.3215.507ON2611611286e-08
KAFR0C053005.507ON2611861261e-07
YOR157C (PUP1)5.507ON2611611242e-07
TPHA0E020505.507ON2611721242e-07
NCAS0A148807.480ON2412381233e-07
SAKL0G04290g5.507ON2612231233e-07
ZYRO0D12034g5.507ON2611641233e-07
Ecym_54585.507ON2581641224e-07
TBLA0D017505.507ON2591901224e-07
NDAI0J006007.480ON2412381215e-07
KNAG0B038005.507ON2611611215e-07
Kpol_534.575.216ON2152121206e-07
Kpol_2002.1095.216ON2152121196e-07
Ecym_71717.480ON2422091206e-07
TDEL0A037105.507ON2611831191e-06
Kwal_47.187485.507ON2631711181e-06
KLLA0F12936g5.216ON2152131162e-06
KNAG0F035907.480ON2482301162e-06
KAFR0B006507.480ON2412291153e-06
Kpol_218.15.507ON2612011153e-06
Kpol_1028.927.480ON2422291144e-06
CAGL0L04312g5.507ON2611611144e-06
KLLA0E05633g7.480ON2401591135e-06
KLTH0E01826g7.480ON2422251136e-06
NCAS0H024805.507ON2641881127e-06
TDEL0C034407.480ON2412341111e-05
SAKL0F15092g7.480ON2611831111e-05
KLLA0A02233g5.507ON2621611111e-05
TBLA0F026807.480ON2412061101e-05
Suva_2.777.480ON2412111101e-05
Kwal_55.198827.480ON2422251101e-05
TPHA0E004207.480ON2412291082e-05
NDAI0A048603.417ON2871731083e-05
TPHA0M017503.417ON2861731073e-05
Skud_2.617.480ON2412111064e-05
NCAS0A114403.417ON2871731074e-05
TDEL0C055403.417ON2871771074e-05
ZYRO0G17842g7.480ON2442151065e-05
SAKL0G12584g5.216ON2152121055e-05
KLTH0G03168g5.507ON2631711065e-05
TBLA0F017603.417ON2871771058e-05
TDEL0E041305.216ON2191721038e-05
CAGL0F04477g7.480ON2422101031e-04
TPHA0E029905.216ON2162131021e-04
Suva_16.4293.417ON2871731031e-04
Skud_16.3883.417ON2871731031e-04
Smik_16.3433.417ON2871731031e-04
TPHA0N007405.216ON2162131012e-04
KLTH0D03058g3.417ON2871771022e-04
YBL041W (PRE7)7.480ON2412151012e-04
ZYRO0B10142g5.216ON2151711002e-04
Skud_10.2225.216ON2152121002e-04
Smik_2.737.480ON2412111012e-04
YPR103W (PRE2)3.417ON2871731012e-04
AEL326C3.417ON2851731012e-04
Kpol_1018.1443.417ON2881731003e-04
SAKL0B09262g3.417ON2871731003e-04
Kwal_26.72733.417ON2871731003e-04
AAR119W5.507ON259172994e-04
KNAG0A075203.417ON287173994e-04
CAGL0G01804g3.417ON286173978e-04
Smik_10.2785.216ON216212950.001
KAFR0D042103.417ON287173960.001
KLLA0F08228g3.417ON285173960.001
TBLA0C062005.216ON216211940.001
Ecym_82765.216ON215209940.001
Ecym_26143.417ON285173950.001
YJL001W (PRE3)5.216ON215212930.002
NDAI0C024205.216ON216212930.002
Suva_12.805.216ON215212920.003
ZYRO0C17688g3.417ON287177920.003
Kwal_33.151935.216ON193205880.007
KAFR0C063505.216ON216210880.007
KLTH0B03102g5.216ON215209860.013
KNAG0H024505.216ON216210820.040
CAGL0D03058g5.216ON215208800.069
AAL172C5.216ON21573780.14
NCAS0A014805.216ON216211780.15
KLTH0C07348g3.269ON316127760.34
KLTH0G00550g3.574ON265128740.46
Smik_7.1736.159ON34942750.50
ZYRO0B03146g7.383ON205115711.1
Kwal_55.210287.162ON195160673.4
ADL116C7.222ON43580683.7
KLLA0B11660g7.162ON195161664.7
TDEL0B071102.618ON88891674.9
Kwal_23.29492.191ON161767675.2
ZYRO0G06600g5.702ON182057675.3
TDEL0C016407.383ON20579656.4
TBLA0I004807.383ON205115647.6
NCAS0A143507.383ON20579647.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C02020
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   524   0.0  
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   463   e-167
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   462   e-167
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   461   e-166
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   460   e-166
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   460   e-166
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   459   e-165
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   457   e-164
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     454   e-163
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   452   e-163
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   451   e-162
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   451   e-162
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   448   e-161
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   444   e-159
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   439   e-158
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   437   e-157
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   436   e-156
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   430   e-154
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   427   e-153
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   421   e-150
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   166   9e-50
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   166   1e-49
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   164   2e-49
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   164   2e-49
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      163   8e-49
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   162   2e-48
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   162   2e-48
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   162   2e-48
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   161   4e-48
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   161   4e-48
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   161   4e-48
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   160   7e-48
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   160   7e-48
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   160   1e-47
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   159   2e-47
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   159   3e-47
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   159   4e-47
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   158   5e-47
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   157   7e-47
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   157   1e-46
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   156   2e-46
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   156   2e-46
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   156   3e-46
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   156   3e-46
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   156   4e-46
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   155   5e-46
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   155   5e-46
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   155   1e-45
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   154   3e-45
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   154   3e-45
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     153   4e-45
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   153   4e-45
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   153   4e-45
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   153   5e-45
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   153   6e-45
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   152   7e-45
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   152   7e-45
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   152   8e-45
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   152   8e-45
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   152   9e-45
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   152   9e-45
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   152   1e-44
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   152   1e-44
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     152   1e-44
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   152   2e-44
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   152   2e-44
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   151   2e-44
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   151   3e-44
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   151   3e-44
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   150   5e-44
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   150   6e-44
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   149   1e-43
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   149   1e-43
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   148   3e-43
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   148   4e-43
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   147   8e-43
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   147   1e-42
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   147   1e-42
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   141   2e-40
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   128   5e-35
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   127   1e-34
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   127   2e-34
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   125   4e-34
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   125   7e-34
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   124   1e-33
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   124   2e-33
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   123   3e-33
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   124   3e-33
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   122   6e-33
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   122   8e-33
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   121   8e-33
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   122   1e-32
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   120   1e-32
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   120   3e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   120   6e-32
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   119   6e-32
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   119   1e-31
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   119   2e-31
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   118   3e-31
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   116   6e-31
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   116   7e-31
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   117   1e-30
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   116   1e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   116   1e-30
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   114   8e-30
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   113   8e-30
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   111   9e-30
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   112   2e-29
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   112   2e-29
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   112   3e-29
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   112   3e-29
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   111   4e-29
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   111   6e-29
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   110   6e-29
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   111   7e-29
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   110   9e-29
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   110   1e-28
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   110   2e-28
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   109   4e-28
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   107   2e-27
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   107   2e-27
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             107   2e-27
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   105   7e-27
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       105   8e-27
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   105   1e-26
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   104   1e-26
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   104   2e-26
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   105   5e-26
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   103   6e-26
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   103   7e-26
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   102   9e-26
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   102   2e-25
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...   101   3e-25
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   102   3e-25
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   101   3e-25
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...   100   7e-25
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    99   3e-24
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    93   5e-22
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    69   1e-13
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    64   5e-12
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    55   2e-08
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    55   2e-08
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    55   2e-08
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    55   3e-08
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    54   6e-08
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    53   1e-07
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    52   2e-07
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    52   2e-07
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    52   3e-07
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    52   3e-07
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    52   3e-07
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    52   4e-07
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    52   4e-07
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    51   5e-07
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    51   5e-07
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    51   6e-07
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    50   6e-07
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    51   6e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    50   1e-06
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    50   1e-06
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    49   2e-06
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    49   2e-06
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    49   3e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    49   3e-06
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    49   4e-06
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    49   4e-06
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    48   5e-06
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    48   6e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      48   7e-06
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    47   1e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    47   1e-05
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    47   1e-05
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    47   1e-05
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    47   1e-05
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    47   1e-05
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    46   2e-05
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    46   3e-05
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    46   3e-05
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    45   4e-05
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    46   4e-05
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    46   4e-05
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    45   5e-05
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    45   5e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    45   5e-05
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    45   8e-05
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    44   8e-05
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    44   1e-04
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    44   1e-04
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    44   1e-04
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    44   1e-04
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    44   1e-04
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    44   2e-04
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    44   2e-04
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    44   2e-04
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    43   2e-04
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    43   2e-04
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    44   2e-04
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    44   2e-04
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    44   2e-04
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    43   3e-04
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    43   3e-04
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    43   3e-04
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    43   4e-04
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    43   4e-04
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    42   8e-04
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    41   0.001
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    42   0.001
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    42   0.001
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    41   0.001
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    41   0.001
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    41   0.001
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    40   0.002
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    40   0.002
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    40   0.003
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    40   0.003
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    39   0.007
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    39   0.007
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    38   0.013
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    36   0.040
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    35   0.069
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    35   0.14 
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    35   0.15 
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    34   0.34 
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    33   0.46 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.50 
ZYRO0B03146g Chr2 complement(254858..255475) [618 bp, 205 aa] {O...    32   1.1  
Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W...    30   3.4  
ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON} S...    31   3.7  
KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa] ...    30   4.7  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    30   4.9  
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    30   5.2  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    30   5.3  
TDEL0C01640 Chr3 (287368..287985) [618 bp, 205 aa] {ON} Anc_7.38...    30   6.4  
TBLA0I00480 Chr9 (82662..83279) [618 bp, 205 aa] {ON} Anc_7.383 ...    29   7.6  
NCAS0A14350 Chr1 complement(2826776..2827393) [618 bp, 205 aa] {...    29   7.7  

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/258 (100%), Positives = 258/258 (100%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 241 KTGISKKENEDEDTEMKL 258
           KTGISKKENEDEDTEMKL
Sbjct: 241 KTGISKKENEDEDTEMKL 258

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  463 bits (1192), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/255 (88%), Positives = 243/255 (95%), Gaps = 2/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS+EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD++ LD+A+ELALKTLSK TDSS+LTYD+LEFATIKKGK + ++YQKI+ PDEIK LL+
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 241 KTGISKKENEDEDTE 255
           KTG++KK  +D++TE
Sbjct: 241 KTGVTKK--KDDETE 253

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  462 bits (1190), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/258 (87%), Positives = 241/258 (93%), Gaps = 1/258 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI VAVAGLTADAEILINTAR+HAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+D+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           K+++ +D A++LALKTLSK TDSS LTYDRLEFATI+KG  + ++YQKIF P EIK LLV
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGISKKENEDE-DTEMK 257
           KTGISKK+ +DE D EMK
Sbjct: 241 KTGISKKDEDDEADQEMK 258

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  461 bits (1185), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 234/247 (94%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD++ +DDA+ELALKTLSK TDSS LTYDRLEFATI+KG  + ++YQKIF P EIK +LV
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 241 KTGISKK 247
           KTGI+KK
Sbjct: 241 KTGITKK 247

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  460 bits (1184), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/256 (87%), Positives = 239/256 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM  +GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND+ TVAVAGLTADAEILINTARIHAQNYLKTYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQ+GGLRP+GVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KDE+TLDDA+ELALKTLSK TDSS+LTYDRLEFAT+KK    ++  QKIF P EIK LL+
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 241 KTGISKKENEDEDTEM 256
           KTGISKK +EDED EM
Sbjct: 241 KTGISKKSDEDEDVEM 256

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  460 bits (1183), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 235/247 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI+VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD++ +DDA++LALKTLSK TDSS LTYDRLEFATI+KG  + ++YQKIF P EIK LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGISKK 247
           KTGI+KK
Sbjct: 241 KTGITKK 247

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  459 bits (1180), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 237/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EK+Y+LNDKITVAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD+I +D+A+ELALKTLSK TDSS LTYDR+EFATIKKG+ NDKIYQKIF P+EIK LL+
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGE-NDKIYQKIFKPEEIKQLLL 239

Query: 241 KTGISKK 247
           KTGI+KK
Sbjct: 240 KTGITKK 246

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  457 bits (1176), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/247 (89%), Positives = 234/247 (94%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI VAVAGLTADAEILINTAR+HAQNYLK+YNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+D+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD++ +DDA++LALKTLSK TDSS LTYDRLEFATI+KG  + ++YQKIF P EIK LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGISKK 247
           KTGI+KK
Sbjct: 241 KTGITKK 247

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  454 bits (1169), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/247 (88%), Positives = 236/247 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKITVAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD + LDDA+ELALKTLSK TDSS+LTYD+LE ATIKKG T D++YQKI+ P+E+K LL+
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 241 KTGISKK 247
           KTGI+KK
Sbjct: 241 KTGITKK 247

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  452 bits (1163), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/252 (87%), Positives = 238/252 (94%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR++AQNYL+TYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD I LD A+ELALKTLSK TDSS LT+DR+EFATIKKG +N ++YQKI+ P EI++LL 
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKG-SNGQLYQKIYKPQEIQTLLS 239

Query: 241 KTGISKKENEDE 252
           KTGI+KK++EDE
Sbjct: 240 KTGITKKDDEDE 251

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  451 bits (1160), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/255 (87%), Positives = 239/255 (93%), Gaps = 2/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD+I +D A+ELALKTLSK TDSS LTYDR+EFATIK G+ N K+YQK+F P+EI++LLV
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGE-NGKLYQKVFKPEEIQTLLV 239

Query: 241 KTGISKKENEDEDTE 255
           K GI+K   EDED E
Sbjct: 240 KNGITKA-GEDEDEE 253

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  451 bits (1160), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 219/256 (85%), Positives = 238/256 (92%), Gaps = 1/256 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDER GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD+I L+ A+ELALKTLSK TDSS LTYDR+EFATIKKG+ N+K+YQKI+ P+EIK LL 
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGE-NNKVYQKIYKPEEIKQLLS 239

Query: 241 KTGISKKENEDEDTEM 256
           K GI+KK  + EDT M
Sbjct: 240 KAGITKKSEDGEDTAM 255

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  448 bits (1152), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 212/258 (82%), Positives = 238/258 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG D+RYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KDEITL++A ELALKTLSK TDSS LTYDR+EF+TIK+GK   ++ QKI+ P EIK LLV
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 241 KTGISKKENEDEDTEMKL 258
           K+GI+KK+ ED D ++++
Sbjct: 241 KSGITKKDAEDGDADVEM 258

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  444 bits (1143), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 237/252 (94%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LNDKITVAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD++ L+ A+ELALKTLSK TDSS LT DR+EFATI+K   + K+YQKIF P+EI+SLLV
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239

Query: 241 KTGISKKENEDE 252
           K GI+KK ++DE
Sbjct: 240 KHGITKKHHDDE 251

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  439 bits (1130), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/248 (86%), Positives = 231/248 (93%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LND ITVAVAGLTADAEILINTAR+HAQNYLK YNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KDEIT ++A+ELALKTLSK TD+S+LT DRLEFATIK+  +N K+ QKI+ P EIK LL 
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQ-DSNGKLVQKIYKPSEIKELLQ 239

Query: 241 KTGISKKE 248
           K+GI K+E
Sbjct: 240 KSGIMKQE 247

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  437 bits (1125), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 234/252 (92%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +S EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYLKTYNE+IPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD+R+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD+IT+ +A ELALKTLSK TDSSTLT +R+EFATI K + N KI QKIF P EI++LL 
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLE-NGKIAQKIFKPREIETLLN 239

Query: 241 KTGISKKENEDE 252
           +TGI+KKENE+E
Sbjct: 240 ETGINKKENEEE 251

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  436 bits (1122), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/252 (84%), Positives = 234/252 (92%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +S EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD+IT+++A ELALKTLSK TDSSTLT +R+EF+TI K   N KI QKIF P EI++LL 
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239

Query: 241 KTGISKKENEDE 252
           KTG++KKEN+DE
Sbjct: 240 KTGVTKKENDDE 251

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  430 bits (1106), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/253 (83%), Positives = 232/253 (91%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LND ITVAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD++T DDA++LALKTLSK TDSS+L+++RLEFATI++   + K+ QKI+   EIK LL 
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQR-NADGKVVQKIYKLGEIKDLLE 239

Query: 241 KTGISKKENEDED 253
           KTGI+K+E E ED
Sbjct: 240 KTGINKQE-EKED 251

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  427 bits (1098), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 211/250 (84%), Positives = 228/250 (91%), Gaps = 1/250 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM + GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR+ AQ+YLKTYNE+IPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240
           KD+ITLD A+ELALKTLSK TDSS LT++RLEFATI K     KIYQKI+ P EI +LL 
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISK-DAEGKIYQKIYKPTEIATLLE 239

Query: 241 KTGISKKENE 250
           KT I KK+++
Sbjct: 240 KTEIVKKDDD 249

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  421 bits (1083), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/258 (81%), Positives = 228/258 (88%), Gaps = 1/258 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+KDGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
              EKLYKL+DKIT+AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYD+  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTND-KIYQKIFTPDEIKSLL 239
           KD++ L+DAMEL LKTLSK TDSS LTYDR+E + IK  K ND KI QKI+ P EIK LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 240 VKTGISKKENEDEDTEMK 257
           +K GI+KK +EDED EMK
Sbjct: 241 IKFGINKKNDEDEDVEMK 258

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  166 bits (419), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 152/257 (59%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + ++I K +   KIY    T + +K   
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVMEEK-LDENNTQLSSITKDE-GFKIYTNERTAELVKQ-- 242

Query: 240 VKTGISKKENEDEDTEM 256
           VK   +++  E  D EM
Sbjct: 243 VKEKEAEENPEQHDVEM 259

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  166 bits (419), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 150/258 (58%), Gaps = 10/258 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   +  A++GLTADA  +I  AR+ A N+   Y+ED+ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + + I K     +IY    T + IK + 
Sbjct: 187 WHSSLTLREAEVLVLKILKQVMEEK-LDENNAQLSCITK-DNGFQIYDNAKTAEIIKEMK 244

Query: 240 VKTGISKKENEDE-DTEM 256
            K      E E+E D EM
Sbjct: 245 EKETQEHPEGEEEHDVEM 262

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  164 bits (416), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/252 (39%), Positives = 146/252 (57%), Gaps = 9/252 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++++ I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L     + ++I K +   KIY    T + IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNTQLSSITK-ENGFKIYNDDKTAELIKELK 244

Query: 240 VKTGISKKENED 251
            K      E  D
Sbjct: 245 EKEAQENPEEPD 256

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  164 bits (416), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 153/257 (59%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   +  A++GLTADA  +I  AR+ A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L L+ L +V +   L  D  + +++ K +   K+Y    T   IK L 
Sbjct: 187 WHSSLTLKEAELLVLRILKQVMEEK-LDEDNAQLSSVTK-EDGFKVYSDEKTAAIIKELK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   +++ +E +D EM
Sbjct: 245 EKE--AQESSESQDVEM 259

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  163 bits (412), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 150/258 (58%), Gaps = 13/258 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   I  A++GLTADA  +I  AR+ A N+   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L     + + + K +   +IY    T + IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNAQLSCVTK-ENGFQIYDDAKTAEIIKELK 244

Query: 240 VKTGISKKEN-EDEDTEM 256
            K     +EN E+ D EM
Sbjct: 245 EK---EVQENPEEHDVEM 259

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 142/248 (57%), Gaps = 17/248 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  S L   DT ++
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHA-QNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ K+   I    +G+  D  +LIN +R  A  +Y+KTY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYD    + LY  +PSG+Y  WKA ++G   +AA+T L+  + +E
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ------------KIFT 231
           + L+DA+ +AL TL +  +      + +E A I  G+ ND +              + FT
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIEVAVI--GEENDDLLGYKGDATARGPRFRKFT 239

Query: 232 PDEIKSLL 239
           P EI   L
Sbjct: 240 PQEINDRL 247

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 136/222 (61%), Gaps = 5/222 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  + L  +DT ++
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHA-QNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y K Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYDE  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKI 225
           + L+DA+ +AL TL +  +      + +E A +  G+ ND +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIELAVV--GEENDDM 221

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K TS+L   + S+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R  A  +Y + YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYDE  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVV 214

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  161 bits (408), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 145/239 (60%), Gaps = 9/239 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR+ A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
           +   +TL +A  L LK L +V +   L  +  + +++ + +   KIY    T + IK L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTRDE-GFKIYSDEKTAEIIKEL 243

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  161 bits (407), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 149/257 (57%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + ++  K +   KIY    T + IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSTTK-EDGFKIYDDSKTAEIIKELK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   +++  ED D EM
Sbjct: 245 EKE--AQEAPEDRDVEM 259

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  161 bits (407), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 130/203 (64%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +GIVL  E++VTSALLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  ++  AR++A  +   Y+E I VE L + + D+     +G
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ +  GYD+  G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTD 202
           +   +TL +A  L LK L +V +
Sbjct: 187 WHSSLTLKEAESLVLKILKQVME 209

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  160 bits (406), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 150/257 (58%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   +  A++GLTADA  +I  AR+ +  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L     + + + K +   K+Y    T   IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDEGNAQLSCVTK-EDGFKVYSDEKTAAIIKEL- 243

Query: 240 VKTGISKKENEDEDTEM 256
            K   +++ +E +D EM
Sbjct: 244 -KDKEAQENSETQDVEM 259

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  160 bits (406), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 154/257 (59%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  ARI +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + +++ + +    IY +  T + I+ L 
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTE-EHGFSIYPESKTAEIIEQL- 243

Query: 240 VKTGISKKENEDEDTEM 256
            K   S++   D+D EM
Sbjct: 244 -KERESQESPADQDIEM 259

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  160 bits (405), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 146/239 (61%), Gaps = 9/239 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  ARI +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
           +   +TL +A  L LK L +V +   L  +  + +++ K +   +IY +  T + IK L
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTK-EQGFRIYPESETAEIIKEL 243

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  159 bits (402), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 132/219 (60%), Gaps = 3/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYDE  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + +E
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTN 222
           + L+DA+ +AL TL +  +      D +E A I +  T+
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVIGEPNTD 220

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  159 bits (401), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 130/203 (64%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  +  A++GLTADA  ++  AR+ A  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTD 202
           +   +TL +A +L LK L +V +
Sbjct: 187 WHSSLTLKEAEQLVLKILKQVME 209

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  159 bits (401), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 152/257 (59%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G++L  E++  S LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + ++I K +   KIY    T + IK+L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSITK-EEGFKIYDDKKTAEIIKALK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   +++  ED D EM
Sbjct: 245 EKE--AEESPEDGDVEM 259

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  158 bits (400), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 150/257 (58%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI   +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  +  A++GLTADA  +I  AR+ A ++   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + + + K     KIY      + IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCVTK-SDGFKIYSDEKVAEIIKDL- 243

Query: 240 VKTGISKKENEDEDTEM 256
            K   +++  E+ D EM
Sbjct: 244 -KEQEAQENPEEHDIEM 259

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  157 bits (398), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI + +GIV+A E+K +S+L   DT V 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR  A  NY + Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + +E
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIV 214

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  157 bits (397), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 137/227 (60%), Gaps = 9/227 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIY 226
           +   +TL +A  L LK L +V +   L  + ++ + + K +   KIY
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVTK-EEGFKIY 231

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 129/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A +GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 127/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y K+E
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 ITLD--DAMELALKTLSKVTDS 203
              D  + ++L +K+L +V  +
Sbjct: 184 PPADEKECVKLTIKSLLEVVQT 205

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  156 bits (395), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 148/257 (57%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + + I K +   KIY    T + IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITK-QDGFKIYDNEKTAELIKELK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   + +  E+ D EM
Sbjct: 245 EKE--AAESPEEADVEM 259

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  156 bits (395), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 148/257 (57%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + + I K +   KIY    T + IK L 
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITK-EDGFKIYDDSKTAELIKELK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   + +  E+ D EM
Sbjct: 245 EKE--AAESPEEADVEM 259

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  156 bits (394), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 134/222 (60%), Gaps = 4/222 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDT-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKI 225
           + L+DA+ +AL TL +  +      D +E   I +   ND++
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGIIGE-PNNDQL 222

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  155 bits (393), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 148/257 (57%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   +TL +A  L LK L +V +   L  +  + + I K +   KIY    T + IK L 
Sbjct: 187 WHSSLTLKEAELLILKILKQVMEEK-LDENNAQLSCITK-QDGFKIYDDKKTAELIKELK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   + +  E+ D EM
Sbjct: 245 EKE--AAESPEEADVEM 259

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  155 bits (392), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 124/194 (63%), Gaps = 2/194 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTL 197
           + L+DA+ +AL TL
Sbjct: 183 LELEDAIHIALLTL 196

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  155 bits (391), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 129/219 (58%), Gaps = 8/219 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKK 218
           +   + + DA  L LK L +V +   L  + ++   I K
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVMEEK-LDQNNVQLCCITK 224

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 148/257 (57%), Gaps = 11/257 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S+EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLL 239
           +   ++L +A  L LK L +V +   L  +  + + I K +   KIY    T + IK L 
Sbjct: 187 WHSSLSLKEAELLILKILKQVMEEK-LDENNAQLSCITK-EDGFKIYDDNKTAELIKELK 244

Query: 240 VKTGISKKENEDEDTEM 256
            K   + +  E+ D EM
Sbjct: 245 KKE--AAESPEEADVEM 259

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  153 bits (387), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 124/202 (61%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  K+ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARI AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  E 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 184 --ITLDDAMELALKTLSKVTDS 203
               +D+ + L +++L +V  +
Sbjct: 184 PPENVDECVRLTVRSLLEVVQT 205

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  153 bits (387), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  153 bits (387), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 124/202 (61%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE- 183
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y  E 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --ITLDDAMELALKTLSKVTDS 203
              T  +A++L +K+L +V  +
Sbjct: 184 PPATEQEAVKLTVKSLLEVVQT 205

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  153 bits (386), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 122/202 (60%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  KD +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRDA 183

Query: 182 DEITLDDAMELALKTLSKVTDS 203
              T  D ++L +K L +V  +
Sbjct: 184 PPATEQDCVKLTVKALLEVVQT 205

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  153 bits (386), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DEITLDDAMELALKTLSKVTDS 203
              T++D ++L +++L +V  +
Sbjct: 184 PPATVEDCVKLTVRSLLEVVQT 205

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  152 bits (385), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 129/214 (60%), Gaps = 5/214 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSAL-LEQDTSV 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D  V
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTED--V 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  
Sbjct: 62  SKISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 EITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           E+ L+DA+ +AL TL +  +      D +E A +
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAIV 214

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  152 bits (385), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 130/214 (60%), Gaps = 5/214 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSAL-LEQDTSV 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S+L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY + Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 EITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           E+ L+DA+ +AL TL +  +      D +E A +
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAVV 214

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  152 bits (385), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 127/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y KDE
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 I--TLDDAMELALKTLSKVTDS 203
              T+++ ++L +K+L +V  +
Sbjct: 184 PPSTVEECVKLTIKSLLEVVQT 205

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  152 bits (385), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y +DE
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 I--TLDDAMELALKTLSKVTDS 203
              T ++ ++L +K+L +V  +
Sbjct: 184 PPSTAEECIKLTIKSLLEVVQT 205

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  152 bits (384), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  152 bits (384), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 123/202 (60%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  KD +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARDA 183

Query: 184 --ITLDDAMELALKTLSKVTDS 203
              T  + ++L +K L +V  +
Sbjct: 184 PPATEQECVKLTVKALLEVVQT 205

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 124/205 (60%), Gaps = 9/205 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSV-- 63
           YD   +IFSP+G ++QVEYALE++     A+G+  KD +VL  ER+ T  L  QDT V  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERRSTLKL--QDTRVIA 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+  ++  + ++ AGL AD+ IL+N AR+ AQ++  T  + + VE + R ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGYDER--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Q GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y 
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYN 181

Query: 182 DE---ITLDDAMELALKTLSKVTDS 203
            E      ++ + L +K L +V  +
Sbjct: 182 REEPPSNKEECIRLTVKALLEVVQT 206

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  152 bits (383), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 125/202 (61%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y +DE
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 I--TLDDAMELALKTLSKVTDS 203
               +++ + L +K+L +V  +
Sbjct: 184 PPKNVEECVRLTVKSLLEVVQT 205

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  152 bits (383), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DEITLDDAMELALKTLSKVTDS 203
              T+++ ++L +++L +V  +
Sbjct: 184 PPATVEECVKLTVRSLLEVVQT 205

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  152 bits (383), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DEITLDDAMELALKTLSKVTDS 203
              T+++ ++L +++L +V  +
Sbjct: 184 PPATVEECVKLTVRSLLEVVQT 205

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DEITLDDAMELALKTLSKVTDS 203
              T+++ ++L +++L +V  +
Sbjct: 184 PPATVEECVKLTVRSLLEVVQT 205

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 132/220 (60%), Gaps = 4/220 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L   + S+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYDE  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + +E
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTND 223
           + L+DA+ +AL TL +  +      D +E A + + + ND
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAIVSE-ENND 220

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL +++   T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  NY + Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AG+DE  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + DE
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ +AL TL +  +      D +E   I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGVI 214

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  150 bits (379), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 122/202 (60%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP G ++QVEYALE++      +GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++++ + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEI 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 ---TLDDAMELALKTLSKVTDS 203
              +  D ++L +K+L +V  +
Sbjct: 184 PPASEQDCVKLTVKSLLEVVQT 205

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 146/251 (58%), Gaps = 12/251 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI  KD +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-ERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y +DE
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLVK 241
              T D+ + L  ++L +V  +       +E   ++ G    KI  +I + ++I   + +
Sbjct: 184 PPATADECVRLTTRSLLEVVQTGA---KNIEITVVRPG---SKI--EILSSEQIGKYVEE 235

Query: 242 TGISKKENEDE 252
               KKE++++
Sbjct: 236 IEQEKKEHQEQ 246

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 127/213 (59%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A +G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RPFGVS + AGYDE  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  E
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+ + L TL +  +      D +E A +
Sbjct: 183 LELEDAIHIVLLTLKESVEGE-FNGDTIEIAVV 214

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  ARI AQ++  T  + + +E L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N+   +  L+ +Y KDE
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 184 I--TLDDAMELALKTLSKVTDS 203
                ++ ++L +K+L +V  +
Sbjct: 184 PPKNKEECIKLTVKSLLEVVQT 205

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 126/202 (62%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ +GL AD+ ILI  ARI AQ++  T  + I VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFG+S + AG+D      +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 182 DEITLDDAMELALKTLSKVTDS 203
              T+++ ++L +K+L +V  +
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQT 205

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 128/228 (56%), Gaps = 11/228 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A +G+VLA E+K  S+L   + S++
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    AG+  D  +L++ AR  A  NY + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDE------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D         G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKI 225
             + DE+ L+DA+ +AL  L +  +      D LE A +  G+ N+ +
Sbjct: 183 KRWHDELELEDAVHIALLALREAVEGE-FNGDTLEIAVV--GEPNNDM 227

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  147 bits (371), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 126/213 (59%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
           Q GG+RP+G S + AGYDE  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + +E
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 ITLDDAMELALKTLSKVTDSSTLTYDRLEFATI 216
           + L+DA+   L TL +  +      D +E A I
Sbjct: 183 LELEDAIHTVLLTLKESVEGE-FNGDTIEIAVI 214

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 123/202 (60%), Gaps = 4/202 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP G ++QVEYALE++      +G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK--D 182
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 183 EITLDDA-MELALKTLSKVTDS 203
             T ++A ++L +K+L +V  +
Sbjct: 184 PPTSEEACVKLTVKSLLEVVQT 205

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 130/218 (59%), Gaps = 7/218 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDE 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y +DE
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKG 219
              T ++ ++L +++L +V  +       +E   +K G
Sbjct: 184 PPATAEECVKLTVRSLLEVVQTGA---KNIEITLVKPG 218

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  141 bits (356), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 109/181 (60%), Gaps = 1/181 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ AGL+ADA +LI  AR  AQ++  T  + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEI 184
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y  E 
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNYAGES 183

Query: 185 T 185
           T
Sbjct: 184 T 184

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  128 bits (321), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 109/195 (55%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++S LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A N+ K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK---D 182
             +RPFG+S I  G DE  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 EITLDDAMELALKTL 197
            +++ DA++ A + +
Sbjct: 186 GLSVKDAIKEAARVI 200

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  127 bits (319), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 115/220 (52%), Gaps = 5/220 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ VTS LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D    +N  R  A N+ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDE 183
             +RPFGV+ I+ G DE  G  LY   PSG Y G+K  + G     A+  L+  +D   E
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELEKVIDQNSE 185

Query: 184 -ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTN 222
             +  DA++ A K +    + +      LE +   K +TN
Sbjct: 186 GFSARDAVKQAAKIIYMAHEDNKEKDFELEISWCSKSETN 225

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  127 bits (318), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 112/195 (57%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ V+S LL    +V K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  +    +GL  D   L+N  R  AQ++ KT+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G D++ G  LY   PSG + G+K  + G     A+  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELEKVIDQHPE 185

Query: 183 EITLDDAMELALKTL 197
            ++  DA++ A K +
Sbjct: 186 GLSAKDAVKEAAKVI 200

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  125 bits (315), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  KDG+V A E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG+  I+ G DE+ G  LY   PSG Y G++  + G    AA+  L+    + K 
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELEKLIGNDKS 185

Query: 183 EITLDDAMELALKTL 197
           E++  DA++ A + +
Sbjct: 186 ELSARDAVKEAARII 200

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  125 bits (314), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 108/194 (55%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TS LL  + ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I V  +GL  D   L+N AR  +QN+ K Y   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDE 183
             +RPFGV+ I+ G D + G  LY   PSG Y G+   + G     A+  L+  +D   E
Sbjct: 127 NSVRPFGVTAIFGGCD-KNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELEKLLDKTPE 185

Query: 184 ITLDDAMELALKTL 197
           ++  +A + A + +
Sbjct: 186 MSAKEAAKHAARII 199

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  124 bits (312), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVD-KNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  KDG+V A E+ +TS LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G DE+ G  LY   PSG   G+   + G     A+  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 EITLDDAMELALKTL 197
            +T  DA++ A K +
Sbjct: 186 GLTTRDAVKYAAKII 200

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  123 bits (309), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS L+  + ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G DE  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 108/195 (55%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G    +A+  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGVD-KDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 EITLDDAMELALKTL 197
            +T  +A++ A + +
Sbjct: 186 GLTAKEAVKQAARII 200

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  122 bits (307), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDE 183
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G    +A+  L+  +D+  E
Sbjct: 127 NSVRPFGVSTIFGGVD-KNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPE 185

Query: 184 -ITLDDAMELALKTL 197
            ++  +A++ A K +
Sbjct: 186 GLSAREAVKQAAKII 200

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  122 bits (306), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 103/182 (56%), Gaps = 2/182 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+  KDGIVLA E+ VTS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  +  A +GL  D   L+N  R  A ++ KTY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEIT 185
             +RPFG++ I  G D+  G  LY   PSG Y G+K  + G    +A+  L+    ++  
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 186 LD 187
           LD
Sbjct: 186 LD 187

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  121 bits (304), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 102/202 (50%), Gaps = 9/202 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  K   VL  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T V  L+ +   I +   G  ADA  +    R  A  +   Y  D+PV +L +R +++ 
Sbjct: 61  ST-VTYLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   DE  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK-------DEITLDDAMELAL 194
           +K       DE + +  +E A+
Sbjct: 180 FKKLQKDRLDEDSWEKVVEFAI 201

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++S LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  ++++ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D+  G  LY   PSG+Y G+K  + G+    A+T L+
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  120 bits (302), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 106/206 (51%), Gaps = 9/206 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  K+ +VL  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T V  ++ ++  I +   G   DA  +    +  A  +   Y  DIPV +L +RL+++ 
Sbjct: 61  AT-VSYMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   DE  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK-------DEITLDDAMELALKTLS 198
           +K        E T +  +E A+  +S
Sbjct: 180 FKKLNVDCLQEETSEKVVEFAITQMS 205

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  120 bits (302), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI  KDG+V A E+ VTS LL    +V K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G DE  G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  120 bits (300), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+VLA E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  119 bits (298), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 104/205 (50%), Gaps = 9/205 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I +K   V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T V  ++ +   I     G   DA  +    +  A  +   Y  DIP  +L +R++++ 
Sbjct: 61  KT-VSYIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +  YDE  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK-------DEITLDDAMELALKTL 197
           +K       DE + +  +E  + TL
Sbjct: 180 FKKLKDDKIDEESWEKTVEFGITTL 204

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  119 bits (299), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVD-KDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  119 bits (297), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 112/205 (54%), Gaps = 11/205 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G++ +DG+VLA E+ V S LL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYKLNDKIT-------VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDI 118
               N KI         A +GL  D   L+N AR  +Q + + Y  DIP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYD-ERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D E     LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDEITLDDAMELALKTLSKV 200
             +  +D+ +    +E A+K L+++
Sbjct: 188 KLISSRDDNSPITTLE-AVKELARI 211

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 115/220 (52%), Gaps = 5/220 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI   DG+V A E+ ++S LL    +V K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + N+ K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+    ++ +
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELEKLFNEHPE 185

Query: 183 EITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTN 222
            +T   A++ A + +    + +      LE +   + +TN
Sbjct: 186 GLTTRQALKEAARIIYVAHEDNKEKGFELELSWCSETETN 225

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  116 bits (291), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 121/246 (49%), Gaps = 21/246 (8%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  K+  V+ +++KV   LL+  T V 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPST-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++K++  I + + G   DA      A+     +   +  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   Y   DE  G  +Y S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -MDYKDEITLDDAMELALKTLSKVTDSSTLTYDR--LEFATIKKGKTNDKIYQKIFTPDE 234
             DY  E + +  +E  + TL   TDS    + +  LE          D  +    TPDE
Sbjct: 191 SQDYMQEESWEKVVEFGITTL---TDSLGTEFSKKDLEVGI----AVPDNFF--TLTPDE 241

Query: 235 IKSLLV 240
           I+  LV
Sbjct: 242 IEERLV 247

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  116 bits (290), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 122/247 (49%), Gaps = 14/247 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I   D  V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L++++  + +   G   DA      A+  A  Y   Y  D+P ++L +R++++ 
Sbjct: 61  ST-MSYLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGAN----TSAAQTL 175
           Q YTQ   +RP GV   +   DE  G  +Y  +P+G Y G+KA + G      TSA +  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 176 LQMDYKDEITLDDAMELALKTLSKVTDS--STLTYDRLEFATIKKGKTNDKIYQKIFTPD 233
            +    D +  +   ++    ++++ D+  S  T   LE     KGK          TPD
Sbjct: 180 FKKRKGDHVAGESYEKVVELGITQMIDALGSEFTNKELEIGVAVKGKFF------CLTPD 233

Query: 234 EIKSLLV 240
           +I+  LV
Sbjct: 234 QIEERLV 240

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  117 bits (292), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  KDG+V A E+ + S LL    + EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLLVPSKN-EK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G D+  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  116 bits (290), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 105/204 (51%), Gaps = 7/204 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I      V+  ++KV   LL+  T V 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPST-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  D+P ++L +R+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGA-----NTSAAQTLLQMD 179
              +RP GV   +  YDE  G  +Y ++P+G Y G+KA + G      NT       + D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 180 YKDEITLDDAMELALKTLSKVTDS 203
            K++I  D   ++    ++++ DS
Sbjct: 191 VKEKINEDAWEKVVEFAITQLIDS 214

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI  +DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+   + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDKD-GAHLYMLEPSGTYWGYTGAATGKGRQSAKAELE 177

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  114 bits (284), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I   +  V+  ++KV   LL+ +T V 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAET-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  D+PV++L +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
              +RP GV   +   DE  G  +Y S+PSG Y G+KA + G       T L+  +K +
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFKKQ 190

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  113 bits (283), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 119/247 (48%), Gaps = 14/247 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   Y  D+P ++L +R++++ 
Sbjct: 61  ST-MSYLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGAN----TSAAQTL 175
           Q YTQ   +RP GV   +   DE  G  +Y  +P+G Y G+KA + G      TSA +  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 176 LQMDYKDEITLDDAMELALKTLSKVTDSSTLTYDR--LEFATIKKGKTNDKIYQKIFTPD 233
            +    D +  D   ++    ++ + D+    + +  LE     K    DK +    TPD
Sbjct: 180 FKKRKSDCVNEDSYEKVVELGITHMIDALGTEFSKKDLEIGVALK----DKFF--CLTPD 233

Query: 234 EIKSLLV 240
           +I+  LV
Sbjct: 234 QIEERLV 240

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  111 bits (277), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 85/139 (61%), Gaps = 4/139 (2%)

Query: 80  LTADAEILINTAR--IHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIY 137
           +  D  +LI+ +R   H Q Y + YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + 
Sbjct: 1   MGPDFRVLIDKSRKVAHTQ-YKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLV 59

Query: 138 AGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           AGYDE  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + DE+ L+DA+ +AL TL
Sbjct: 60  AGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTL 119

Query: 198 SKVTDSSTLTYDRLEFATI 216
            +  +      D +E A +
Sbjct: 120 KESVEGE-FNGDTIEIAVV 137

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 101/204 (49%), Gaps = 13/204 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   D  V+  ++KV   LL+ DT V 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADT-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   DE  G  +Y S+PSG Y G+K  + G       T L+       
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFKKQK 191

Query: 178 ----MDYKDEITLDDAMELALKTL 197
                D+ DE T +  +E A+  L
Sbjct: 192 NPSKKDHYDEDTWEKVVEFAITQL 215

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  112 bits (279), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 109/223 (48%), Gaps = 7/223 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDEITLDDA---MELALKTLSKVTDSSTLTYDRLEFATIKKGK 220
           +D + LDDA   + +A++ L +      L+   L  A + + K
Sbjct: 177 QDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVVGQDK 219

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  112 bits (279), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 106/221 (47%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +KD  VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKK 218
            D + + DA EL    ++ L +     TL  D L  A + K
Sbjct: 177 DDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIAVVGK 217

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  112 bits (279), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 106/197 (53%), Gaps = 9/197 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  KD  V+ +++KV   LL+  T+V 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   DE  G  +Y ++P+G Y G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSK 190

Query: 178 MDYKDEITLDDAMELAL 194
           +D+ +E + +  +E A+
Sbjct: 191 IDHINEESWEKVVEFAI 207

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  111 bits (277), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 111/220 (50%), Gaps = 9/220 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +     L A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLK-TYNEDIPVEILVRRLSDIK 119
           +  +K+ K +D + +++AGL  DA +L N  R H  NY K  YN ++ +E +   LSD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGYD-KSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERV 175

Query: 180 YKDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATI 216
             D + ++DA EL    ++ L +     TL+   L  A +
Sbjct: 176 MDDFLPVEDATELIKQGVEALRQSLKDETLSVKNLSIAIV 215

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  111 bits (278), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 122/245 (49%), Gaps = 20/245 (8%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV   LL+  T V 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPST-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A++ A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   DE  G  +Y ++P+G Y G+KA + G       T L+       
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFKKKT 191

Query: 178 MDYKDEITLDDAMELALKTLSKVTDS--STLTYDRLEFATIKKGKTNDKIYQKIFTPDEI 235
            D+ +E + +  +E A+  L    DS  +  T + LE     K    DK +  + T D+I
Sbjct: 192 TDHLEEESWEKVVEFAIAHL---IDSLGTEFTNNDLEVGVAIK----DKFF--VLTADQI 242

Query: 236 KSLLV 240
           +  LV
Sbjct: 243 EERLV 247

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  110 bits (276), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 112/235 (47%), Gaps = 7/235 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTP 232
            + + ++D  EL   A++ L +     TL+   L  A + K K    +  +  TP
Sbjct: 177 NEYLEIEDEDELIGVAVEALKQCLKDETLSTKNLSIAIVSKDKPFTVLDDEAVTP 231

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  111 bits (277), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 106/197 (53%), Gaps = 9/197 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  K+  V+ +++KV   LL+ +T V 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNT-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +   DE  G  +Y ++P+G Y G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSK 190

Query: 178 MDYKDEITLDDAMELAL 194
           +D+ +E + +  +E A+
Sbjct: 191 IDHINEESWEKVVEFAI 207

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  110 bits (276), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 121/243 (49%), Gaps = 15/243 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+  ++KV   LL+  T V 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPST-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++K++  I +   G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK--- 181
              +RP GV   +   DE  G  +Y  +P+G Y G+KA + G       T L+  YK   
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYKKKN 191

Query: 182 --DEITLDDAMELALKTLSKVTDSSTLTYDR--LEFATIKKGKTNDKIYQKIFTPDEIKS 237
               + +++  ++    ++++ DS    + +  LE     + K        I TPDEI+ 
Sbjct: 192 VGSHLDMEEWEKVVEFGITQMIDSLGTEFSKKDLEIGVATENKF------IILTPDEIEE 245

Query: 238 LLV 240
            LV
Sbjct: 246 RLV 248

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  110 bits (275), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 114/221 (51%), Gaps = 10/221 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
           +T V  ++K++  + +   G   DA      A+  A  +   Y  D+P ++L +R++++ 
Sbjct: 61  NT-VSYIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   DE  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 Y------KDEITLDDAMELALKTLSKVTD--SSTLTYDRLE 212
           +      KD +  DD  ++    ++++ D   +  T+  LE
Sbjct: 180 FKKNNNGKDHVQEDDWRKVVEFGITQMIDVLGTEFTFKDLE 220

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  110 bits (275), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+ +++KV   LL+  T+V 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   DE  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  109 bits (272), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+ +++KV   LL+  T V 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPAT-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   DE  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  107 bits (268), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 102/200 (51%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  ++  V+  ++KV   LLE  T V 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEAST-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK--- 181
              +RP GV   +   DE  G  +Y ++P+G + G+KA + G       T L+  +K   
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNNS 191

Query: 182 ----DEITLDDAMELALKTL 197
               DE + +  +E  +  L
Sbjct: 192 LNVVDEESWEKVVEFGISHL 211

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  107 bits (266), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 111/235 (47%), Gaps = 7/235 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VLAA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTP 232
            + + L+D  EL    ++ L +     TLT + L  A +   K   +   +  TP
Sbjct: 177 DNFVDLEDPEELIKTCVEALRQSLKDETLTTENLSIAIVGVDKPFTQFDNEKVTP 231

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  107 bits (266), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 107/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K+  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKK 218
              I ++D  EL    ++ L +     TLT D L  A + K
Sbjct: 177 DKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIAIVGK 217

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  105 bits (262), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 105/219 (47%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGYD-KSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATI 216
              + ++DA EL    ++ L +     TL+ D L  A +
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIAIV 215

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  105 bits (262), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 105/219 (47%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATI 216
              I ++D  EL    +++L +     TL+ + L  A +
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIAIV 215

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  105 bits (262), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 12/235 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I  +   V+  ++KV   LL+  T V 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPST-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEI 184
              +RP GV   +   DE  G  +Y S+P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 185 T---LDDAMELALK-TLSKVTDS--STLTYDRLEFATIKKGK----TNDKIYQKI 229
           T    +DA E  ++  ++ + DS  +  T   LE     +GK    T D+I +++
Sbjct: 191 TDTLKEDAWEKVVEFAITHLIDSLGTEFTKRDLEVGVALEGKFFTLTADQIEERL 245

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  104 bits (260), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 107/222 (48%), Gaps = 8/222 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD + G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDEITL----DDAMELALKTLSKVTDSSTLTYDRLEFATIKK 218
              I +    D+ ++  ++ +S+     +LT D L  A + K
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGK 218

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  104 bits (260), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA-KDGIVLAAERKVTSALLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + K  +V+A +R       + 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNAD----DL 56

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            +  +K+ K ++ + +++AGL  DA +L N  R         YN  + VE +   L D  
Sbjct: 57  SSYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKT 175

Query: 180 YKDEITLDDAME---LALKTLSKVTDSSTLTYDRLEFATIKKG 219
            +  + ++D  E   L ++ L +     TL+   L  A + +G
Sbjct: 176 LEQFLEVEDPNELIKLGVEALRQSLKDETLSTKNLSIAVVGEG 218

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  105 bits (261), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 107/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         Y  D+ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKK 218
           ++ + ++DA  L    ++ L       TL+   L  A + K
Sbjct: 250 EEYLEIEDADALIKHGVEALKHSLKDETLSTKNLSIAIVGK 290

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  103 bits (256), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 106/224 (47%), Gaps = 9/224 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA-KDGIVLAAERKVTSALLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + K  +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            +  +K+ K +D + V++AGL  DA +L N  R         YN  + +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 180 YKDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKKGK 220
             D   ++DA EL    ++ L       TL+   L  A +   K
Sbjct: 176 LDDFREIEDADELIKHGVEALRHSLKDETLSTKNLSIAIVGHDK 219

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  103 bits (256), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 105/220 (47%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD + G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDEITL----DDAMELALKTLSKVTDSSTLTYDRLEFATI 216
              I +    D+ ++  ++ +S+     +LT D L  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAVV 216

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  102 bits (255), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 105/220 (47%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++      E  
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNAD---ELS 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDEITL----DDAMELALKTLSKVTDSSTLTYDRLEFATI 216
              I +    D+ ++  ++ +S+     +LT D L  A +
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIAIV 216

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  102 bits (253), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN ++ +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATI 216
           ++ + ++ A EL    ++ L       TL+   L  A +
Sbjct: 177 EEYLKIETADELIKHGVEALKHSLKDDTLSTKNLSIAVV 215

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score =  101 bits (252), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 112/225 (49%), Gaps = 13/225 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKD-GIVLAAERKVTSALLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ +K+   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLK-TYNEDIPVEILVRRLSDI 118
            +  +K+ K +D + +++AGL  DA +L N  R    NY K  +N D+ VE     LSD 
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDK 115

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ- 177
            Q  TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +  ++T L+ 
Sbjct: 116 AQKNTQSYGGRPYGVGLLVVGYD-KTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLER 174

Query: 178 -MDYKDEITLDDA---MELALKTLSKVTDSSTLTYDRLEFATIKK 218
            +D   E+  +D    +++ ++ + +      L  D L    + K
Sbjct: 175 VLDEFKELEDEDPESIIKVGVQAIQQSLKDEVLNTDNLSIGIVGK 219

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  102 bits (253), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 104/200 (52%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSALLEQDTSVE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  K+  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPAT-LS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A+  A  +   Y  D+P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +  +DE  G  +Y ++P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKNN 190

Query: 178 MDYKDEITLDDAMELALKTL 197
           +D+ +E + +  +E A+  L
Sbjct: 191 VDHLEEESWEKVVEFAITHL 210

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  101 bits (251), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 105/220 (47%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++      E  
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNAD---ELS 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDEITL----DDAMELALKTLSKVTDSSTLTYDRLEFATI 216
              I +    D+ ++  ++ +S+     +LT D L  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score =  100 bits (248), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 107/223 (47%), Gaps = 7/223 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +   K+ K ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKKGK 220
           ++ + ++DA EL    ++ L +     TL+   L  A + + K
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLSTKNLSIAIVGENK 219

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 98.6 bits (244), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 104/224 (46%), Gaps = 7/224 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +  + +++AGL  DA +L N  R         ++  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATIKKGKT 221
            D + +D+  EL    ++ L +      LT   L  A +   K+
Sbjct: 177 DDFLEIDNVEELIKVGVEALKQSLKDEDLTTQNLSIAFVGHDKS 220

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 92.8 bits (229), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 104/224 (46%), Gaps = 12/224 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMAKDGIVLAAERKVTSA 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ +K   VL A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRL 115
           L    +   K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+D + G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGHD-KSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDEITLDDAMEL---ALKTLSKVTDSSTLTYDRLEFATI 216
           L+      + ++D  EL    ++ L +     TL+ + L  A +
Sbjct: 177 LERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIAIV 220

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 70/142 (49%), Gaps = 3/142 (2%)

Query: 83  DAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDE 142
           D   L+N AR  A ++ KTY   I +  L  RL    Q +T +  +RPFG++ I  G DE
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDEITLDDAMELALKTLSKV 200
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K +I+  +A++ A + +   
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVVYLA 121

Query: 201 TDSSTLTYDRLEFATIKKGKTN 222
            D +      LE +     +TN
Sbjct: 122 HDDNKEKEFELEMSWCSVSETN 143

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 102 YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWK 161
           Y  D+P ++L +R++++ Q YTQ   +RP GV   +   DE  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLL-------QMDYKDEITLDDAMELALKTL 197
           A + G       T L       +  Y +E + +  +E A+  L
Sbjct: 88  ATATGPKQQEITTNLENYFKKKETSYLEEDSWEKVVEFAIAHL 130

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+      +S+G+ + AA  +L+  +K ++T D+A++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 84/161 (52%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+  K+G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+      +S+G+ + AA  +L+  +K ++T D+A++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 86/165 (52%), Gaps = 8/165 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+  +DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  GSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
             G+      +S+G+ + AA  +L+  ++ E++ ++A+ELA + +
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELASQAI 189

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 92/209 (44%), Gaps = 9/209 (4%)

Query: 32  AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           AGT +GI  +D  VLA + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTS 151
           +   + Y   +N+ + ++   R +  +  G      + P+ V  I AG DE     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMDYKDEITLDD--AMELALKTLSKVTDSSTLT 207
           +P G+Y   +  + GA  S     L  Q+++K++   D     + AL+ LS V +   L 
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSNGTKKRALRFLS-VDEVVRLV 205

Query: 208 YDRLEFATIKKGKTNDKIYQKIFTPDEIK 236
            D    AT +     D +   I T D ++
Sbjct: 206 RDAFTSATERHIHVGDGLQIMIVTKDGVR 234

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+      +S+G+ + AA  +L+  +K ++T D+A++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 89/186 (47%), Gaps = 22/186 (11%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAE----ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG 127
           +I  A AG  AD E    ++ +   +H+   L T  E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHS---LSTRRE----PRVVTTLQMLKQHLFRYQG 121

Query: 128 LRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLD 187
               G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ +I+ D
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKD 178

Query: 188 DAMELA 193
           +A+ELA
Sbjct: 179 EAIELA 184

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+      +S+G+ + AA  +L+  +K ++T ++A++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 86/172 (50%), Gaps = 9/172 (5%)

Query: 24  YALESISHAGTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTA 82
           YA    +  GT I G+  K G+V+AA+ + T   +  D +  KL+++  +I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYD 141
           D E +  T  I +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG D
Sbjct: 80  DTEAV--TQLIGSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVD 133

Query: 142 ERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
              G  L++ +  G+       ++G+ + AA  +L+  +K +++ +DA++LA
Sbjct: 134 PT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 98/238 (41%), Gaps = 31/238 (13%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           +S E R   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N LK Y+ D     + +    R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE- 183
              P+ V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++ 
Sbjct: 121 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 179

Query: 184 --------------ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
                         +T+++A++L     +  T+      D LE   + K     + ++
Sbjct: 180 EPGTDGKVKRPLKYLTIEEAIKLVRDAFTSATERHIHVGDGLEILIVTKDGVRKEFFE 237

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 106/223 (47%), Gaps = 17/223 (7%)

Query: 20  YQVEYALESISHA-------GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           YQ    L + SHA       GT I G+    G+V+AA+ + T   +  D + EKL++++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLIGSNIELHSLYTNREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAM 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K  ++ ++A+
Sbjct: 123 VGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAI 181

Query: 191 ELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPD 233
           ELA   +     +   +   ++   ++ GK + ++ +   TP+
Sbjct: 182 ELASNAIEAGIWNDLGSGSNVDICVMEVGK-DAELLRNYLTPN 223

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 80/164 (48%), Gaps = 14/164 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE----ILIN 89
           T +G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
              +H+Q     Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NLELHSQ-----YANREPR--VVSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
           +    G+      +S+G+ + AA   L+ ++K  +T D+A++LA
Sbjct: 141 SVQAHGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 86/164 (52%), Gaps = 14/164 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE----ILIN 89
           T +G+  ++G+V+AA+ + T   +  + + EKL+K++ +I  A AG  AD +    ++ +
Sbjct: 31  TIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDAVTGLIGS 90

Query: 90  TARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
              +H+   L T  E      +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NLELHS---LFTGRE----PRVVSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
           + +  G+       S+G+ + AA  +L+ ++K+ +T ++A++LA
Sbjct: 141 SVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLA 184

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 89/190 (46%), Gaps = 30/190 (15%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           YQ    L S SH          T +G+   +G+++AA+ + T   +  D +  KL+++  
Sbjct: 9   YQRNAFLASQSHNTPKATSTGTTIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAP 68

Query: 72  KITVAVAGLTADAE----ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG 127
           +I  A AG  AD E    ++ +   +H+   L T+ E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLVGSNLELHS---LYTHRE----PRVVSALQMLKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYD----ERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDE 183
               G   I AG D      +  Q + S   G Y      S+G+ + AA  +L+ ++K +
Sbjct: 122 --HIGAYLIVAGVDPTGPHLFAVQAHGSTDVGFYH-----SLGSGSLAAMAVLETNWKQD 174

Query: 184 ITLDDAMELA 193
           +T ++AM+LA
Sbjct: 175 LTKEEAMKLA 184

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 99/238 (41%), Gaps = 31/238 (13%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           +S E     +E+A    + + GT +GI  +D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N LK Y+ D     + ++   R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE- 183
              P+ V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++ 
Sbjct: 121 -FFPYYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

Query: 184 --------------ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
                         +++D+ ++L   + +  T+      D LE   + K     + Y+
Sbjct: 180 EPGTDGKVKKPLKYLSIDEVIKLVRDSFTSATERHIHVGDGLEILIVTKDGVRKEFYE 237

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 85/161 (52%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  I
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  L++  
Sbjct: 90  GSNVELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQ 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+      +S+G+ + AA  +L+ ++K++++ ++A++LA
Sbjct: 145 AHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLA 185

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYDE    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           Y+    G+         G+ ++        ++K+++T ++ +E    +LS+    D S+ 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+         T D   + IF PDE + L
Sbjct: 190 GVIRMVVL------TKDGAERLIFYPDEYEKL 215

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYDE    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           Y+    G+         G+ ++        ++K+++T ++ +E    +LS+    D S+ 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+         T D   + IF PDE + L
Sbjct: 190 GVIRMVVL------TKDGAERLIFYPDEYEKL 215

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 88/209 (42%), Gaps = 30/209 (14%)

Query: 32  AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
            GT +GI  +D  V+A + + T+       +  K++   D I ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RIHAQNYLKTY-----NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGY 146
           +    N LK Y     N+ + ++   R +  +  G      + P+ V  I AG DE    
Sbjct: 89  K----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKG 140

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------------ITLDDA 189
            +Y+ +P G+Y   +  + GA  S     L  Q+++K++               ++LD+ 
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPDSKGTKPKSIRFLSLDEV 200

Query: 190 MELALKTLSKVTDSSTLTYDRLEFATIKK 218
           +EL     +  T+      D L+   I K
Sbjct: 201 IELVRDAFTSATERHIHVGDSLQIMIITK 229

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 89/183 (48%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISHA-------GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           YQ    L S SHA       GT I G+   +G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLISSNLELHSLYASREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAM 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K ++T ++A+
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAI 181

Query: 191 ELA 193
            LA
Sbjct: 182 NLA 184

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%), Gaps = 14/171 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE- 85
           ++ S   T +G+    G+V+AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDE 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----LYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G  L++ +  G+       S+G+ + AA  +L+  +K++I  ++AM+LA
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLA 184

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 95/213 (44%), Gaps = 23/213 (10%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y E    +   I      + K   T            I AGYDE+   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDEITLDDAMELALKTLSKVT--DSST 205
           Y S P G     ++ S+  + SA        +YK+++T ++ +E    +LS+    D S+
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQAIKWDGSS 188

Query: 206 LTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
               R+         T + + + I  PDE ++L
Sbjct: 189 GGVIRMVVL------TAEGVERLIVYPDEYENL 215

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 96/230 (41%), Gaps = 17/230 (7%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKI 73
           P      +E+     S + GT +GI  +D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILINTARIHAQNYLKTY--NED---IPVEILVRRLSDIKQGYTQHGGL 128
            ++  G  AD+  L+   R    N LK Y  NE+   + +    R +  +  G       
Sbjct: 79  VISANGFAADSTALVKRFR----NSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----F 130

Query: 129 RPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDEITL 186
            P+ V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++   
Sbjct: 131 FPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVP 190

Query: 187 DDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIK 236
               +  +  LS V +   L  D    AT +     D +   I T D ++
Sbjct: 191 GTGEKRPITYLS-VEEVVKLVRDSFTSATERHIHVGDGLEILIVTKDGVR 239

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 90/229 (39%), Gaps = 38/229 (16%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           Y  E A + I H         GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N +K Y+ D     + ++   R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE- 183
              P+ V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++ 
Sbjct: 121 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 179

Query: 184 --------------ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKK 218
                         + +D+ + L     +  T+      D LE   + K
Sbjct: 180 EPGSDGKVKRPLKYLNIDEVISLVRDAFTSATERHIHVGDGLEILIVTK 228

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 97/201 (48%), Gaps = 9/201 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYSNREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVTDSSTLTYDRLE 212
             G+       S+G+ + AA  +L+ ++K ++T ++A++LA   +     +   +   ++
Sbjct: 144 AHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVD 203

Query: 213 FATIKKGKTNDKIYQKIFTPD 233
              ++ GK  D +   I TP+
Sbjct: 204 VCVMEVGKDADYLRNHI-TPN 223

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 92/229 (40%), Gaps = 31/229 (13%)

Query: 22  VEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGL 80
           +E+     S + GT +GI  +D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSF 135
            AD E L+   +    N +K Y+ D     + +    R +  +  G        P+ V  
Sbjct: 78  AADGEALVKRFK----NSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHT 129

Query: 136 IYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------- 183
           I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++          
Sbjct: 130 IIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSDGTVK 189

Query: 184 -----ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
                +++D+ + L     +  T+      D LE   + K     + Y+
Sbjct: 190 RPLKFLSIDEVIRLVRDAFTSATERHIHVGDGLEILIVTKDGVRKEFYE 238

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+    G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+       S+G+ + AA  +L+  +K ++T ++A++LA
Sbjct: 144 AHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 6/159 (3%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + + T+          K+++  D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYT 150
            +     Y   +N+ + ++   R +  +  G      + P+ V  I AG DE     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDEITLD 187
            +P G+Y   +  + G+  S     L  Q++ K++   D
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKNQYEPD 181

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 94/225 (41%), Gaps = 23/225 (10%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           +S E +   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG-LRP 130
            I ++  G  AD   L+       QN LK Y+ D   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE----- 183
           + V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++     
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDS 184

Query: 184 ----------ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKK 218
                     +T+++ ++L     S  T+      D +E   + K
Sbjct: 185 HGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 93/188 (49%), Gaps = 17/188 (9%)

Query: 20  YQVEYALESISHA--------GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLN 70
           YQ   AL + SH+        GT I G+   +G+++AA+ + T   +  + +  KL++++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLR 129
            +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ E++ + A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 MELALKTL 197
           +ELA + +
Sbjct: 182 VELASQAI 189

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 92/234 (39%), Gaps = 30/234 (12%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           Y  E A   I H         GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+  + +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE----- 183
           + V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++     
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGT 183

Query: 184 ----------ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
                     +++++ ++L     +  T+      D LE   + K     + Y+
Sbjct: 184 NGKVRRPQTYLSIEEVIKLVRDAFTSATERHIQVGDGLEILIVTKDGVRKEFYE 237

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 78/183 (42%), Gaps = 16/183 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           +S E +   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYN-----EDIPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+       QN LK Y+       + +    R +  +  G     
Sbjct: 88  NILISANGFAADGEALVK----RFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR--- 140

Query: 127 GLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDEI 184
              P+ V  I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++ 
Sbjct: 141 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 199

Query: 185 TLD 187
             D
Sbjct: 200 EPD 202

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+    G+++AA+ + T   +  D + EKL+++  +I  A AG  AD E +  T  I
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  SSNIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G+       S+G+ + AA  +L+ ++  +++ ++A++LA
Sbjct: 145 AHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLA 185

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 86/206 (41%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG-LRPFGVSFIYAGYDERYGYQLY 149
            +    N +K Y+ D   + L  + +     +  +G    P+ V  I AG DE     +Y
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------------ITLDDAMEL 192
           + +P G+Y   +  + GA  S     L  Q+++K++               +T+D+ ++L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPESNGKVKRPLKYLTIDECIKL 202

Query: 193 ALKTLSKVTDSSTLTYDRLEFATIKK 218
                +  T+      D LE   + K
Sbjct: 203 VRDAFTSATERHIQVGDGLEILIVTK 228

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 91/211 (43%), Gaps = 10/211 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD--EITLDDAMELALKTLSKVTDSST 205
           + +P G+Y   +  + GA  S     L  Q+++K+  E   D  ++  LK LS V +   
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS-VEEVIK 201

Query: 206 LTYDRLEFATIKKGKTNDKIYQKIFTPDEIK 236
           L  D    AT +  +  D +   I T D ++
Sbjct: 202 LVRDSFTSATERHIQVGDGLEILIVTKDGVR 232

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 93/225 (41%), Gaps = 19/225 (8%)

Query: 22  VEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGL 80
           +E+     S + GT +GI  +D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSF 135
            AD   L+       QN LK Y+ D     + ++   R +  +  G        P+ V  
Sbjct: 78  AADGTALVK----RFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHT 129

Query: 136 IYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDEITLDD--AME 191
           I AG DE     +Y+ +P G+Y   +  + GA  S     L  Q+++K++   D      
Sbjct: 130 IIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSKGTKR 189

Query: 192 LALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIK 236
             LK LS V +   L  D    AT +     D +   I T D ++
Sbjct: 190 KELKFLS-VEEVVQLVRDAFSSATERHIHVGDGVEILIVTKDGVR 233

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 92/229 (40%), Gaps = 31/229 (13%)

Query: 22  VEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGL 80
           +E+     S + GT +GI  +D  VLA + + T+          K++   D I ++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSF 135
            AD E L+   +    N +K Y+ D     + +    R +  +  G        P+ V  
Sbjct: 77  AADGEALVKRFK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHT 128

Query: 136 IYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------- 183
           I AG DE     +Y+ +P G+Y      + GA  S     L  Q+++K++          
Sbjct: 129 IIAGLDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPDSNGKVK 188

Query: 184 -----ITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
                +++D+ ++L     +  T+      D LE   + K     + Y+
Sbjct: 189 RPFKHLSIDEVIKLVRDAFTSATERHIHVGDGLEILIVTKEGVRKEFYE 237

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    K GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    LK  N  I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LKEKNR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T+++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +    + GI++A + + T+       +V K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T+D+A+ L  +++
Sbjct: 183 GPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 235

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 90/211 (42%), Gaps = 10/211 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD--EITLDDAMELALKTLSKVTDSST 205
           + +P G+Y   +  + GA  S     L  Q+++K+  E   D  ++  LK LS V +   
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS-VEEVIK 201

Query: 206 LTYDRLEFATIKKGKTNDKIYQKIFTPDEIK 236
           L  D    AT +  +  D +   I T D +K
Sbjct: 202 LVRDSFTSATERHIQVGDGLEILIVTKDGVK 232

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSI 236

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 80/177 (45%), Gaps = 12/177 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT 201
           G  +Y  +  G         VG+  + A  +L  +YK E+ +++A+EL  +++   T
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAAT 240

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 85/215 (39%), Gaps = 22/215 (10%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------------ITLDDAMEL 192
           + +P G+Y   +  + GA  S     L  Q+++ ++               +++D+ + L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFHNQYVPESNGRVKRPLKFLSVDEVIRL 205

Query: 193 ALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
                +  T+      D LE   + K     + Y+
Sbjct: 206 VRDAFTSATERHIQVGDGLEILIVTKDGVTKQFYE 240

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y E        +      + K   T            I AGYDE+   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           Y+    G+         G+ ++        ++K+ +T ++ ++    +LS+    D S+ 
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDFIKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+         T D + + +F PDE ++L
Sbjct: 190 GVIRMVVL------TKDGVERLVFYPDEYENL 215

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 84/171 (49%), Gaps = 14/171 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE- 85
           ++ S   T +G+    G+++AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDE 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHSM-----YASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELA 193
             G  L++ +  G+       S+G+ + AA  +L+ +++ ++  ++AM+LA
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 81/177 (45%), Gaps = 12/177 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    K GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT 201
           G  +Y  +  G         VG+  + A  +L  +YK ++T+++A+ L  +++   T
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAAT 240

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 74/172 (43%), Gaps = 20/172 (11%)

Query: 35  AIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARIH 94
           ++ +  KDG++L A+ + T+     +   +KL ++++KI    +G  AD + + +  + H
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLKTYNED-------IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQ 147
              Y   Y E        +  E+      ++  G              I AGYDE+   +
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLTAG-------------IIVAGYDEKNKGE 132

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSK 199
           +Y+    G+    K    G+ ++        ++KD++T D+ +     +LS+
Sbjct: 133 VYSIPLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQ 184

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 86/210 (40%), Gaps = 30/210 (14%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYG 145
            +    N +K Y+ D     + +    R +  +  G        P+ V  I AG D+   
Sbjct: 88  FK----NSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGK 139

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------------ITLDD 188
             +Y+ +P G+Y   +  + GA  S     L  Q+++K++               ++L++
Sbjct: 140 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLSLEE 199

Query: 189 AMELALKTLSKVTDSSTLTYDRLEFATIKK 218
            ++L     +  T+      D LE   + K
Sbjct: 200 VIKLVRDAFTSATERHIHVGDGLEILIVTK 229

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 91/213 (42%), Gaps = 22/213 (10%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+D++    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSST 205
           +Y+    G+    K    G+ ++        +YK+ +T D+ ++    +LS+    D S+
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQAIKWDGSS 189

Query: 206 LTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
               R+         T D + + IF PDE ++L
Sbjct: 190 GGVIRMVVV------TKDGVERLIFYPDEYENL 216

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK +++++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK +++++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK +++++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSI 236

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 91/213 (42%), Gaps = 22/213 (10%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+D++    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSST 205
           +Y+    G+    K    G+ ++        ++KD++T D+ +     +LS+    D S+
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQAIKWDGSS 189

Query: 206 LTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
               R+         T D + + IF PDE ++L
Sbjct: 190 GGVIRMVVL------TKDGVERLIFYPDEYENL 216

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 80/177 (45%), Gaps = 12/177 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT 201
           G  +Y  +  G         VG+  + A  +L  +YK ++++++A+ L  +++   T
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAAT 240

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/215 (20%), Positives = 88/215 (40%), Gaps = 22/215 (10%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDE---------------ITLDDAMEL 192
           + +P G+Y   +  + GA  S     L  Q+++K++               +++++ ++L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKL 202

Query: 193 ALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQ 227
              + +  T+      D LE   + K     + Y+
Sbjct: 203 VRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYE 237

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 74/171 (43%), Gaps = 13/171 (7%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T      +   +KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNED---IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + +   Y   Y E        I  +   + K   T            I AGYDE+   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSK 199
           Y+    G+    K    G+ ++        +YKD +T D+ ++    +LS+
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQ 180

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 90/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y     +    +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           YT    G+         G+ ++        ++++ ++ ++ ++    +LS+    D S+ 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+   T       D + + IF PDE + L
Sbjct: 190 GVIRMVVLTA------DGVERLIFYPDEYERL 215

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 90/211 (42%), Gaps = 10/211 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD--EITLDDAMELALKTLSKVTDSST 205
           + +P G+Y   +  + GA  S     L  Q+++K+  E   +  ++  LK LS V +   
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS-VEEVIK 201

Query: 206 LTYDRLEFATIKKGKTNDKIYQKIFTPDEIK 236
           L  D    AT +  +  D +   I T D ++
Sbjct: 202 LVRDSFTSATERHIQVGDGLEILIVTKDGVR 232

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK +++++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +Y+ +++++DA+ L  +++
Sbjct: 182 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSI 234

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    LK  +  I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LKEKSR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T+D+A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 236

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   + I V    + L ++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGTQCRLHE---LKE-KQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSI 236

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           ++H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T+++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 80/172 (46%), Gaps = 16/172 (9%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLND 71
           YQ    L S SH          T +G+  + G+V+AA+ + T   +  + + EKL+++  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TWLIGSNLELHSLYTGREPR--VVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
            G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWRE 173

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 75/173 (43%), Gaps = 4/173 (2%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT 201
           Y  +  G         VG+  + A  +L  +YK +++++DA+ L  + +   T
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAAT 240

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    LK   E I V    + L ++   Y   G      +  +  GY ++ 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++++++A+ L  +++
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSI 235

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 89/212 (41%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           YT    G+         G+ ++        +++D ++ ++ +     +LS+    D S+ 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+   T         + + +F PDE + L
Sbjct: 190 GVIRMVVLTAA------GVERLVFYPDEYEQL 215

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +    + GI++A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    LK   + I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 132 TWLGSQCRLHE---LKE-KDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T+++A+ L  +++
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +    K GI++A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY ++ 
Sbjct: 129 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 180

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +Y+ ++++++A+ +  +++
Sbjct: 181 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSI 233

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 93/211 (44%), Gaps = 18/211 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T      +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPF-GVSFIYAGYDERYGYQLYT 150
           + H + Y   Y   IP     R  + + Q        + F     I AG+D++       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLT 207
           S P G     +  ++  + SA        +YK ++T D+ +E    +LS+    D S+  
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQAIKWDGSSGG 191

Query: 208 YDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
             RL   T K G     + + IF P++ ++L
Sbjct: 192 VIRLVVLT-KSG-----VERLIFYPEDYENL 216

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 92/209 (44%), Gaps = 15/209 (7%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTS 151
           + H   Y   Y E   V       S I   Y     L       I AGYD++   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTIC--YENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLTYD 209
              G+         G+ ++        ++K+ ++ ++ +     +LS+    D S+    
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQAIKWDGSSGGVI 192

Query: 210 RLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
           R+   T K+G     + + IF P++ +SL
Sbjct: 193 RMVVLT-KEG-----VERLIFYPEDYESL 215

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +    + GIV+A + + T+       +V+K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   E I V    + L ++   Y   G      +  +  GY ++ 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK ++T+++A+ L  +++
Sbjct: 182 GPTIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSI 234

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 90/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           YT    G+         G+ ++        ++++ ++ ++ ++    +LS+    D S+ 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+   T         + + IF PDE + L
Sbjct: 190 GVIRMVVLTAA------GVERLIFYPDEYEQL 215

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 91/212 (42%), Gaps = 20/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNY---LKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGY-Q 147
           + H   Y     T +      +      + K   T            I AG+D+     +
Sbjct: 79  QYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDATNKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVTDSSTLT 207
           +Y+    G+    K    G+ ++        ++KD++T D+ +     +LS+      + 
Sbjct: 130 VYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHFIKHSLSQA-----IK 184

Query: 208 YDRLEFATIKKGK-TNDKIYQKIFTPDEIKSL 238
           +D      I+    T++ + + IF PDE ++L
Sbjct: 185 WDGSSGGVIRMVVLTSEGVERLIFYPDEYENL 216

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 90/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQL 148
           + H + Y   Y   + +    I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTL 206
           YT    G+         G+ ++        ++++ ++ ++ ++    +LS+    D S+ 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 207 TYDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
              R+         T   + + IF PDE + L
Sbjct: 190 GVIRMVVL------TEAGVERLIFYPDEYERL 215

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 80/177 (45%), Gaps = 12/177 (6%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +    + GI++A + + ++       +V+K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY 144
             L    R+H    LK   E I V    + L ++   Y  +G      +  +  GY ++ 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT 201
           G  +Y  +  G         VG+  + A  +L  +YK ++++++A+ L  +++   T
Sbjct: 184 GPTVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAAT 240

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 92/205 (44%), Gaps = 14/205 (6%)

Query: 36  IGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           + +  KDG++L A+ + T+     +   +KL +++DK+    +G  AD + + +      
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADI----V 56

Query: 96  QNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSG 155
           Q+YL+ Y             S  K    ++      G+  I AG+D++   ++Y+    G
Sbjct: 57  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGFDDKNKGEVYSIPLGG 114

Query: 156 NYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLTYDRLEF 213
           +    K    G+ ++        ++K+++T D+ +     +LS+    D S+    R+  
Sbjct: 115 SVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQAIKWDGSSGGVIRMVV 174

Query: 214 ATIKKGKTNDKIYQKIFTPDEIKSL 238
            T K+G       + IF P+E ++L
Sbjct: 175 LT-KEGAE-----RLIFYPEEYENL 193

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 92/210 (43%), Gaps = 16/210 (7%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY-GYQLYT 150
           + H + Y   Y     ++        I   Y     L       I AG+D++    ++Y+
Sbjct: 79  QYHLELYESQYGAP-SIKTAASVFKSI--CYENKDNLSA---GIIVAGFDDKNEKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLTY 208
               G+    K    G+ ++         +K+++T D+ +     +LS+    D S+   
Sbjct: 133 IPLGGSIHKQKYAIAGSGSTFIYGYCDKKFKEDMTKDETVNFIKHSLSQAIKWDGSSGGV 192

Query: 209 DRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
            R+   T K+G     + + IF PDE + L
Sbjct: 193 IRMVILT-KEG-----VERLIFYPDEYEKL 216

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 92/209 (44%), Gaps = 15/209 (7%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +   +KL ++++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTS 151
               Q+YL+ Y             S  K    ++      G+  I AGYDE+   ++Y+ 
Sbjct: 78  ---VQHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLTYD 209
              G+    K    G+ ++        +YK+ ++ D+ +     +LS+    D S+    
Sbjct: 133 PLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQAIKWDGSSGGVI 192

Query: 210 RLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
           R+         T D   + IF P++ ++L
Sbjct: 193 RMVVL------TKDGAERLIFYPEDYENL 215

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 89/210 (42%), Gaps = 16/210 (7%)

Query: 33  GTAIGIMAKDG-IVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  DG ++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGY-QLYT 150
           + H + Y   Y     +E        +   Y     L       I AGYD++    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLTY 208
               G+    K    G+ ++        +Y++ +  ++ +E    +LS+    D S+   
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQAIKWDGSSGGV 192

Query: 209 DRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
            RL         T   + + IF PDE ++L
Sbjct: 193 IRLVIL------TESGVERLIFYPDEYENL 216

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 91/208 (43%), Gaps = 13/208 (6%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGYQLYTS 151
           + +   Y   + E  P       +   K    Q+      G+  I AGYDE+   ++Y+ 
Sbjct: 79  QYYLDMYEGQFGE--PDTYTAANM--FKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVTDSSTLTYDRL 211
              G+         G+ ++        ++++ ++ D+ ++    +LS+      + +D  
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDFIKHSLSQA-----IKWDGS 187

Query: 212 EFATIKKGK-TNDKIYQKIFTPDEIKSL 238
               I+    T D   + IF P+E ++L
Sbjct: 188 SGGVIRMVVLTKDGPERLIFYPEEYENL 215

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +   +KL +++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RIHAQNYLKTYNE 104
           + + + Y   Y E
Sbjct: 79  QHYLELYTMQYGE 91

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 92/211 (43%), Gaps = 18/211 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  KDG++L A+ + T+     +   +KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDE--RYGYQLY 149
               Q YL  Y             S  K    ++      G+  I AG+D+  + G ++Y
Sbjct: 78  ---VQYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDDTKKG-EVY 131

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMELALKTLSKVT--DSSTLT 207
           +    G+    K    G+ ++        ++K+++T D+ +     +LS+    D S+  
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHFIKHSLSQAIKWDGSSGG 191

Query: 208 YDRLEFATIKKGKTNDKIYQKIFTPDEIKSL 238
             R+         T   + + IF PDE ++L
Sbjct: 192 VIRMVIL------TESGVERLIFYPDEYENL 216

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERK----VTSALLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I AKD  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  VEKLYK-----LNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSD 117
           V KL +     L  K+ V +  LT + +   + A++    Y ++  + I +E++ R   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 57/128 (44%), Gaps = 7/128 (5%)

Query: 20  YQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAG 79
           Y   +  + I    + I +  KDG+++AA+R  +   L + + VE+L+ +     V ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILINT--ARIHAQNYLKTYNED---IPVEILVRRLSDIKQGYTQHGGLRPFGVS 134
             +D + L N         NY   Y ED   +    +   L+++   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGYDE 142
            I AG ++
Sbjct: 147 LIVAGLED 154

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>ZYRO0B03146g Chr2 complement(254858..255475) [618 bp, 205 aa] {ON}
           highly similar to uniprot|P25451 Saccharomyces
           cerevisiae YER094C PUP3 Beta subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit C10
          Length = 205

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 45/115 (39%), Gaps = 5/115 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + G  + +  KD + +A + ++    L    + EK++K    + + + GL  D   L  T
Sbjct: 8   NGGVCVAMTGKDCVAIACDLRLGMQSLGVSNNFEKIFKYG-HVFLGLTGLATDVTTLSET 66

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYG 145
            R     Y     ED P+E      + +           PF V  I AG + + G
Sbjct: 67  FRYKTNLY--NLKEDRPIE--PETFTQLVSSSLYERRFGPFFVGPIVAGINSKTG 117

>Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W
           (PRE1) - 22.6 kDa proteasome subunit [contig 135] FULL
          Length = 195

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 71/160 (44%), Gaps = 5/160 (3%)

Query: 35  AIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARIH 94
            +GI  +D ++LA  + VT  +    ++ +K  +L++   +A  G   D        + +
Sbjct: 4   VLGIRVQDTVILATSKAVTRGISILKSTDDKTRQLSEHTLMAYTGEAGDTVQFAEYVQAN 63

Query: 95  AQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLR-PFGVSFIYAGYD-ERYGYQLYTSN 152
            Q Y    N ++  + +    S ++Q   +    R P+ V+ +  GYD  +   +LY  +
Sbjct: 64  MQLYTIRENYELSPQAVS---SFVRQELAKSIRSRKPYQVNVLIGGYDIHKEKPELYQID 120

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMEL 192
             G        + G +     +LL   Y+ ++TLD+ ++L
Sbjct: 121 YLGTKVELPYAAHGYSGFYTFSLLDRHYRPDMTLDEGLKL 160

>ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL042C
          Length = 435

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 8/80 (10%)

Query: 85  EILINTARIHAQNYLKT-YNEDIPVEI-LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDE 142
           EIL N+AR H +N+  + Y+ + P+E+ +VR   D++      GG  P  V       D 
Sbjct: 302 EILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVE------DR 355

Query: 143 RYGYQLYTSNPSGNYTGWKA 162
            + Y   TS      TG  A
Sbjct: 356 MFDYSYTTSEKDAKDTGMSA 375

>KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa]
           {ON} highly similar to uniprot|P22141 Saccharomyces
           cerevisiae YER012W PRE1 20S proteasome beta-type subunit
           localizes to the nucleus throughout the cell cycle
          Length = 195

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 70/161 (43%), Gaps = 9/161 (5%)

Query: 36  IGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +GI  KD ++LA+ + VT  +     S +K  +L     ++ +G   D        + + 
Sbjct: 5   LGIRVKDSVILASSKAVTRGISILKDSDDKTRQLLPHTLMSFSGEAGDTVQFAEYIQANM 64

Query: 96  QNYLKTYNEDIPVEI---LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERY-GYQLYTS 151
           Q YL   N ++        VR  +++ +        +PF V+ +  GYD +    +LY  
Sbjct: 65  QLYLIRENYELSPHAASSFVR--TELAKSLRSR---KPFQVNVLIGGYDTKNEKAELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDEITLDDAMEL 192
           +  G        + G       +LL   Y++++T+D+A+ L
Sbjct: 120 DYLGTKVELPYAAHGYAGFYTFSLLDRHYREDLTVDEALGL 160

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 12/91 (13%)

Query: 111 LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYGY-----QLYTSNPSGNYTGW--KAI 163
           L++ L D K+    HGGL     +F  AGY+ +  +       Y SNP    +GW  K  
Sbjct: 697 LIKELEDAKE--VTHGGLASINETFNQAGYNSQQEFAKINLPHYISNP---LSGWQDKLK 751

Query: 164 SVGANTSAAQTLLQMDYKDEITLDDAMELAL 194
           ++     +   L+ +   D+ + +D  EL L
Sbjct: 752 TLKGVVKSVDELVSVGSVDKRSREDLFELKL 782

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 30.4 bits (67), Expect = 5.2,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKL 66
           DS   I     RLY+ E A+  I+H     GI + D + L AER      +  + +  KL
Sbjct: 158 DSLPAILRARSRLYERETAILGINHKNKETGI-SWDKLYLRAER------VAHELTKHKL 210

Query: 67  YKLNDKI 73
           YK+ DK+
Sbjct: 211 YKM-DKV 216

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 62  SVEKLYKLNDKITV---AVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRL 115
           +V +L   N K+ V    VA L  + E+L ++ R   +NYLK   E   + I+V +L
Sbjct: 747 TVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQL 803

>TDEL0C01640 Chr3 (287368..287985) [618 bp, 205 aa] {ON} Anc_7.383
           YER094C
          Length = 205

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + G  + +  KD + +A++ ++ S  L      EK++     + + + GL  D   L  T
Sbjct: 8   NGGIVVAMAGKDCVAIASDLRLGSQSLGVSNKFEKIFHYG-HVFLGITGLATDVTTLSET 66

Query: 91  ARIHAQNYLKTYNEDIPVE 109
            R     Y     ED P+E
Sbjct: 67  FRYKTNLY--KLREDRPIE 83

>TBLA0I00480 Chr9 (82662..83279) [618 bp, 205 aa] {ON} Anc_7.383
           YER094C
          Length = 205

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 45/115 (39%), Gaps = 5/115 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + G  + +  KD + +A + ++ S  L    + EK++     +   + GL  D   L   
Sbjct: 8   NGGVVVAMTGKDCVAIACDLRLGSQSLGVSNNFEKIFHYG-HVFFGITGLATDVTTLNEL 66

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDERYG 145
            R     Y    N  I  E     +S     Y++  G  P+ V  + AG + + G
Sbjct: 67  FRYKTNMYKLKENRSIEPETFTNLVSSTL--YSKRFG--PYFVGPVVAGLNSKTG 117

>NCAS0A14350 Chr1 complement(2826776..2827393) [618 bp, 205 aa] {ON}
          Length = 205

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSALLEQDTSVEKLYKLNDKITVAVAGLTADAEILINT 90
           + G  + +  KD + +A + ++ S  L    + EK++     + + + GL  D   L  T
Sbjct: 8   NGGIVVAMTGKDCVAIACDLRLGSQSLGVSNNFEKIFHYG-HVFLGLTGLATDVTTLSET 66

Query: 91  ARIHAQNYLKTYNEDIPVE 109
            R     Y     ED P+E
Sbjct: 67  FRYKTNLY--KLKEDRPIE 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,466,336
Number of extensions: 1090625
Number of successful extensions: 3483
Number of sequences better than 10.0: 269
Number of HSP's gapped: 3301
Number of HSP's successfully gapped: 269
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)