Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C02010singletonON1641648551e-119
Kpol_1002.866.160ON1611605772e-76
TDEL0B039406.160ON1631625745e-76
KLTH0H05588g6.160ON1611585676e-75
Kwal_14.16066.160ON1621615651e-74
YIR037W (HYR1)2.670ON1631595632e-74
ZYRO0G21758g6.160ON2071605672e-74
Smik_9.2412.670ON1631595632e-74
KLLA0F06732g6.160ON1611585614e-74
NDAI0D024806.160ON1611585599e-74
Skud_9.2182.670ON1631595599e-74
Suva_9.2532.670ON1631595581e-73
Smik_2.3876.160ON1621605521e-72
TDEL0A04230na 1ON1611595469e-72
NCAS0F006506.160ON1611595423e-71
AFL039C6.160ON2151645464e-71
TPHA0J020506.160ON1591575407e-71
SAKL0A05940g6.160ON1721605373e-70
Skud_2.3766.160ON1621595337e-70
TBLA0B01530singletonON1671595302e-69
KAFR0A001402.670ON1611565284e-69
Suva_4.5046.160ON1621595268e-69
Ecym_22576.160ON1651585261e-68
YBR244W (GPX2)6.160ON1621595242e-68
CAGL0I00264g2.670ON1611605191e-67
CAGL0C01705g6.160ON1641615182e-67
KNAG0M005706.160ON1601595102e-66
NCAS0H036102.670ON1761615096e-66
Kpol_534.246.160ON1631615051e-65
ZYRO0D13288gna 1ON1651614948e-64
KLLA0D03905gsingletonON1681624861e-62
KAFR0G035706.160ON1611554861e-62
NDAI0D05060singletonON1611474755e-61
YKL026C (GPX1)2.670ON1671564756e-61
TPHA0N010606.160ON1741564713e-60
Smik_11.2272.670ON1671584694e-60
Skud_11.2022.670ON1671584619e-59
Suva_11.2002.670ON1671584592e-58
CAGL0I00242gsingletonON1651604513e-57
KNAG0M023802.670ON1631594479e-57
TBLA0A006602.670ON1691594151e-51
TPHA0H03120singletonON1971483102e-35
Suva_15.7singletonON3737800.004
Kwal_27.107947.403ON53556750.22
TDEL0G044906.20ON109354653.7
KNAG0D035204.113ON103051653.8
NCAS0A131907.153ON104689636.4
Kpol_1061.261.380ON127462637.5
Smik_7.1singletonON62551628.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C02010
         (164 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C02010 Chr3 complement(399375..399869) [495 bp, 164 aa] {ON}     333   e-119
Kpol_1002.86 s1002 complement(226445..226930) [486 bp, 161 aa] {...   226   2e-76
TDEL0B03940 Chr2 complement(708511..709002) [492 bp, 163 aa] {ON...   225   5e-76
KLTH0H05588g Chr8 complement(496922..497407) [486 bp, 161 aa] {O...   223   6e-75
Kwal_14.1606 s14 complement(388340..388828) [489 bp, 162 aa] {ON...   222   1e-74
YIR037W Chr9 (423128..423619) [492 bp, 163 aa] {ON}  HYR1Thiol p...   221   2e-74
ZYRO0G21758g Chr7 (1790034..1790657) [624 bp, 207 aa] {ON} highl...   223   2e-74
Smik_9.241 Chr9 (396632..397123) [492 bp, 163 aa] {ON} YIR037W (...   221   2e-74
KLLA0F06732g Chr6 complement(649269..649754) [486 bp, 161 aa] {O...   220   4e-74
NDAI0D02480 Chr4 complement(574299..574784) [486 bp, 161 aa] {ON}     219   9e-74
Skud_9.218 Chr9 (390842..391333) [492 bp, 163 aa] {ON} YIR037W (...   219   9e-74
Suva_9.253 Chr9 (408314..408805) [492 bp, 163 aa] {ON} YIR037W (...   219   1e-73
Smik_2.387 Chr2 (693799..694287) [489 bp, 162 aa] {ON} YBR244W (...   217   1e-72
TDEL0A04230 Chr1 complement(752422..752907) [486 bp, 161 aa] {ON}     214   9e-72
NCAS0F00650 Chr6 (126598..127083) [486 bp, 161 aa] {ON}               213   3e-71
AFL039C Chr6 complement(366579..367226) [648 bp, 215 aa] {ON} No...   214   4e-71
TPHA0J02050 Chr10 (458631..459110) [480 bp, 159 aa] {ON} Anc_6.1...   212   7e-71
SAKL0A05940g Chr1 complement(541828..542346) [519 bp, 172 aa] {O...   211   3e-70
Skud_2.376 Chr2 (676159..676647) [489 bp, 162 aa] {ON} YBR244W (...   209   7e-70
TBLA0B01530 Chr2 (335958..336461) [504 bp, 167 aa] {ON}               208   2e-69
KAFR0A00140 Chr1 complement(23889..24374) [486 bp, 161 aa] {ON} ...   207   4e-69
Suva_4.504 Chr4 (878603..879091) [489 bp, 162 aa] {ON} YBR244W (...   207   8e-69
Ecym_2257 Chr2 complement(509315..509812) [498 bp, 165 aa] {ON} ...   207   1e-68
YBR244W Chr2 (707528..708016) [489 bp, 162 aa] {ON}  GPX2Phospho...   206   2e-68
CAGL0I00264g Chr9 complement(18821..19306) [486 bp, 161 aa] {ON}...   204   1e-67
CAGL0C01705g Chr3 complement(182305..182799) [495 bp, 164 aa] {O...   204   2e-67
KNAG0M00570 Chr13 complement(92461..92943) [483 bp, 160 aa] {ON}...   201   2e-66
NCAS0H03610 Chr8 (687430..687960) [531 bp, 176 aa] {ON} Anc_2.670     200   6e-66
Kpol_534.24 s534 complement(55973..56464) [492 bp, 163 aa] {ON} ...   199   1e-65
ZYRO0D13288g Chr4 complement(1118074..1118571) [498 bp, 165 aa] ...   194   8e-64
KLLA0D03905g Chr4 complement(330128..330634) [507 bp, 168 aa] {O...   191   1e-62
KAFR0G03570 Chr7 (736666..737151) [486 bp, 161 aa] {ON} Anc_6.16...   191   1e-62
NDAI0D05060 Chr4 (1209831..1210316) [486 bp, 161 aa] {ON}             187   5e-61
YKL026C Chr11 complement(389380..389883) [504 bp, 167 aa] {ON}  ...   187   6e-61
TPHA0N01060 Chr14 complement(223554..224078) [525 bp, 174 aa] {O...   186   3e-60
Smik_11.227 Chr11 complement(376428..376931) [504 bp, 167 aa] {O...   185   4e-60
Skud_11.202 Chr11 complement(370313..370816) [504 bp, 167 aa] {O...   182   9e-59
Suva_11.200 Chr11 complement(373259..373762) [504 bp, 167 aa] {O...   181   2e-58
CAGL0I00242g Chr9 complement(17649..18146) [498 bp, 165 aa] {ON}...   178   3e-57
KNAG0M02380 Chr13 complement(440547..441038) [492 bp, 163 aa] {O...   176   9e-57
TBLA0A00660 Chr1 complement(139356..139865) [510 bp, 169 aa] {ON...   164   1e-51
TPHA0H03120 Chr8 (746224..746817) [594 bp, 197 aa] {ON}               124   2e-35
Suva_15.7 Chr15 complement(13820..13930) [111 bp, 37 aa] {ON} YB...    35   0.004
Kwal_27.10794 s27 complement(498413..500020) [1608 bp, 535 aa] {...    33   0.22 
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...    30   3.7  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    30   3.8  
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    29   6.4  
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    29   7.5  
Smik_7.1 Chr7 complement(1571..3448) [1878 bp, 625 aa] {ON} YOR3...    28   8.5  

>KAFR0C02010 Chr3 complement(399375..399869) [495 bp, 164 aa] {ON} 
          Length = 164

 Score =  333 bits (855), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/164 (100%), Positives = 164/164 (100%)

Query: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60
           MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV
Sbjct: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60

Query: 61  VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120
           VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL
Sbjct: 61  VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120

Query: 121 GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE 164
           GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE
Sbjct: 121 GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE 164

>Kpol_1002.86 s1002 complement(226445..226930) [486 bp, 161 aa] {ON}
           complement(226445..226930) [486 nt, 162 aa]
          Length = 161

 Score =  226 bits (577), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 126/160 (78%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P DK G PY+F QLE KV L+VNVASKCGFTPQY EL+ LY K KD+G V++G
Sbjct: 2   SKFYELAPSDKKGEPYSFSQLEGKVILIVNVASKCGFTPQYKELEELYQKHKDEGLVILG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+DEEIA++    Y VTFPI+KKIEVNGN+ + VY++LK Q++G+LG +
Sbjct: 62  FPCNQFGHQEPGSDEEIAQFCTLNYGVTFPIMKKIEVNGNSVDPVYEFLKSQRAGILGFR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRN 163
            IKWNFEKFL+D+ G V ERYSS TKP  IE DIEK L+ 
Sbjct: 122 GIKWNFEKFLVDRKGEVYERYSSLTKPASIEGDIEKLLKQ 161

>TDEL0B03940 Chr2 complement(708511..709002) [492 bp, 163 aa] {ON}
           Anc_6.160 YBR244W
          Length = 163

 Score =  225 bits (574), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 105/162 (64%), Positives = 131/162 (80%)

Query: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60
           MSSS FYS +P D  G P+ FKQLE KV L+VNVASKCGFTPQY EL+ L+ K+  + F+
Sbjct: 1   MSSSSFYSLAPKDNKGEPFPFKQLEGKVVLIVNVASKCGFTPQYDELEKLFSKYNKQNFI 60

Query: 61  VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120
           ++GFPCNQF NQEPG+DEEIA++ K  Y V+FPILKKI+VNGNN + VY +LK++KSG+L
Sbjct: 61  ILGFPCNQFGNQEPGSDEEIAQFCKTKYGVSFPILKKIDVNGNNVDPVYDFLKNEKSGML 120

Query: 121 GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
           GL  IKWNFEKFLIDK G VVERYSS TKP+ +E +IE+ ++
Sbjct: 121 GLNRIKWNFEKFLIDKHGKVVERYSSLTKPHTLEPEIERLIK 162

>KLTH0H05588g Chr8 complement(496922..497407) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P40581 Saccharomyces
           cerevisiae YIR037W HYR1 Thiol peroxidase that functions
           as a hydroperoxide receptor to sense intracellular
           hydroperoxide levels and transduce a redox signal to the
           Yap1p transcription factor or similar to YBR244W
           uniprot|P38143 Saccharomyces cerevisiae YBR244W GPX2
           Phospholipid hydroperoxide glutathione peroxidase
           induced by glucose starvation that protects cells from
           phospholipid hydroperoxides and nonphospholipid
           peroxides during oxidative stress
          Length = 161

 Score =  223 bits (567), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 102/158 (64%), Positives = 126/158 (79%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +PLD+ G P+ FKQLE KV L+VNVASKCGFTPQY ELQ LY ++ DKGF +IG
Sbjct: 2   SKFYDLAPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEELQELYKRYHDKGFEIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QE GTDEEI ++ K  Y VTFP++KK+ VNG+N + VY+YLK++K+G+LG K
Sbjct: 62  FPCNQFGHQESGTDEEIGQFCKLNYGVTFPVMKKVHVNGDNADPVYEYLKNEKAGMLGFK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFLIDK GNV ERYSS TKP  ++A ++K L
Sbjct: 122 GIKWNFEKFLIDKHGNVYERYSSLTKPANLDAKVQKLL 159

>Kwal_14.1606 s14 complement(388340..388828) [489 bp, 162 aa] {ON}
           YIR037W (HYR1) - putative glutathione-peroxidase [contig
           238] FULL
          Length = 162

 Score =  222 bits (565), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 103/161 (63%), Positives = 125/161 (77%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY   PLD+ G P+ FKQLE KV L+VNVASKCGFTPQY ELQ LY ++ DKGF +IG
Sbjct: 2   SKFYELEPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEELQELYKRYHDKGFEIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF  QE GTDEEI ++ K  Y VTFPI+KKI VNG + + VY+YLK+QK+G+LG +
Sbjct: 62  FPCNQFGKQESGTDEEIGQFCKLNYGVTFPIMKKIHVNGASADPVYEYLKEQKAGMLGFR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE 164
            IKWNFEKFLIDK GNV +RYSS TKP  ++A ++K L+ E
Sbjct: 122 GIKWNFEKFLIDKHGNVHDRYSSLTKPANLDAKVDKLLKEE 162

>YIR037W Chr9 (423128..423619) [492 bp, 163 aa] {ON}  HYR1Thiol
           peroxidase that functions as a hydroperoxide receptor to
           sense intracellular hydroperoxide levels and transduce a
           redox signal to the Yap1p transcription factor
          Length = 163

 Score =  221 bits (563), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 101/159 (63%), Positives = 128/159 (80%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P+DK G P+ F QL+ KV L+VNVASKCGFTPQY EL++LY ++KD+GF +IG
Sbjct: 2   SEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+DEEIA++ +  Y VTFPI+KKI+VNG N + VYK+LK QKSG+LGL+
Sbjct: 62  FPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFL+DK G V ERYSS TKP+ +   IE+ L+
Sbjct: 122 GIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLK 160

>ZYRO0G21758g Chr7 (1790034..1790657) [624 bp, 207 aa] {ON} highly
           similar to uniprot|P40581 Saccharomyces cerevisiae
           YIR037W HYR1 Thiol peroxidase that functions as a
           hydroperoxide receptor to sense intracellular
           hydroperoxide levels and transduce a redox signal to the
           Yap1p transcription factor or YBR244W uniprot|P38143
           Saccharomyces cerevisiae YBR244W GPX2 Phospholipid
           hydroperoxide glutathione peroxidase induced by glucose
           starvation that protects cells from phospholipid
           hydroperoxides and nonphospholipid peroxides during
           oxidative stress
          Length = 207

 Score =  223 bits (567), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 100/160 (62%), Positives = 128/160 (80%)

Query: 2   SSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVV 61
           ++S FY   PLDK G P++FKQLE KV ++VNVASKCGFTPQY  L+ LY K+KD+G V+
Sbjct: 46  AASKFYGLEPLDKTGKPFSFKQLEGKVVIIVNVASKCGFTPQYAGLEELYKKYKDEGLVI 105

Query: 62  IGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLG 121
           +GFPCNQF++QEPG+DE+I ++ K  Y VTFPI+KKI+VNG N + VY++LK QKSG LG
Sbjct: 106 LGFPCNQFLSQEPGSDEQIGEFCKLNYGVTFPIMKKIDVNGKNVDPVYEFLKSQKSGTLG 165

Query: 122 LKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           +  IKWNFEKFLIDK G VVER+SS TKP+ IE  +++ L
Sbjct: 166 MTRIKWNFEKFLIDKQGKVVERFSSLTKPSSIEPKVKELL 205

>Smik_9.241 Chr9 (396632..397123) [492 bp, 163 aa] {ON} YIR037W
           (REAL)
          Length = 163

 Score =  221 bits (563), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 101/159 (63%), Positives = 127/159 (79%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P+DK G P+ F QL+ KV L+VNVASKCGFTPQY EL++LY ++KD+G  +IG
Sbjct: 2   SEFYKLAPIDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGLTIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+DEEIA++ +  Y VTFPI+KKI+VNGNN + VYK+LK QKSG+LGL+
Sbjct: 62  FPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGNNEDPVYKFLKSQKSGMLGLR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFL+DK G V ERYSS TKP+ +   IE  L+
Sbjct: 122 GIKWNFEKFLVDKKGKVHERYSSLTKPSSLSETIEALLK 160

>KLLA0F06732g Chr6 complement(649269..649754) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P40581 Saccharomyces
           cerevisiae YIR037W HYR1 Thiol peroxidase that functions
           as a hydroperoxide receptor to sense intracellular
           hydroperoxide levels and transduce a redox signal to the
           Yap1p transcription factor
          Length = 161

 Score =  220 bits (561), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 102/158 (64%), Positives = 128/158 (81%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P DK G P+ F QLE KV L+VNVASKCGFTPQY EL++LY K++DKGF+V+G
Sbjct: 2   SKFYELAPKDKKGEPFPFTQLEGKVVLIVNVASKCGFTPQYKELEALYKKYEDKGFIVLG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPGTDEEI+++ +  Y V+FPILKK++VNG+  + VY +LK++KSG+LG K
Sbjct: 62  FPCNQFGHQEPGTDEEISQFCQLNYGVSFPILKKVDVNGSEADPVYDFLKNEKSGLLGFK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFL+DK G VVERYSS TKP+ +E  IEK L
Sbjct: 122 GIKWNFEKFLVDKKGTVVERYSSLTKPSSLEEPIEKLL 159

>NDAI0D02480 Chr4 complement(574299..574784) [486 bp, 161 aa] {ON} 
          Length = 161

 Score =  219 bits (559), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (79%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P DK G  Y F QLE KV L+VNVASKCGFTPQY EL+SLY K++DKG V++G
Sbjct: 2   SEFYKLTPKDKKGEDYPFTQLEGKVVLIVNVASKCGFTPQYKELESLYKKYQDKGLVILG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPGTDE+I ++ +  Y VTFPILKKI VNGN+ + VY++LK +KSG+LG K
Sbjct: 62  FPCNQFGHQEPGTDEQIGQFCQLNYGVTFPILKKINVNGNDMDPVYEFLKSKKSGLLGFK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFLID+ G VV+RY+S TKP+ IE DIE+ L
Sbjct: 122 GIKWNFEKFLIDRKGEVVQRYASLTKPSSIEQDIERLL 159

>Skud_9.218 Chr9 (390842..391333) [492 bp, 163 aa] {ON} YIR037W
           (REAL)
          Length = 163

 Score =  219 bits (559), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 101/159 (63%), Positives = 126/159 (79%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P+DK G P+ F QL+ KV L+VNVASKCGFTPQY EL++LY  +KD+GF +IG
Sbjct: 2   SEFYKLAPIDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKSYKDQGFTIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+DEEIA++ +  Y VTFPI+KK +VNG N + VYK+LK QKSG+LGL+
Sbjct: 62  FPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKTDVNGGNEDPVYKFLKSQKSGMLGLR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFLIDK G V ERYSS TKP+ +   IE+ L+
Sbjct: 122 GIKWNFEKFLIDKKGKVHERYSSLTKPSSLSETIEELLK 160

>Suva_9.253 Chr9 (408314..408805) [492 bp, 163 aa] {ON} YIR037W
           (REAL)
          Length = 163

 Score =  219 bits (558), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 100/159 (62%), Positives = 126/159 (79%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P DK G P+ F QL+ KV L+VNVASKCGFTPQY EL++LY ++ D+GF +IG
Sbjct: 2   SEFYKLAPTDKKGQPFPFSQLKGKVVLIVNVASKCGFTPQYKELEALYKRYSDEGFTIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+DE+IA++ +  Y VTFP+LKK +VNGNN + VYK+LK QKSG+LGLK
Sbjct: 62  FPCNQFGHQEPGSDEDIAQFCQLNYGVTFPVLKKTDVNGNNEDPVYKFLKSQKSGMLGLK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFL+DK G V ERYSS TKP+ +   IE+ L+
Sbjct: 122 GIKWNFEKFLVDKKGKVHERYSSLTKPSSLSGAIEELLK 160

>Smik_2.387 Chr2 (693799..694287) [489 bp, 162 aa] {ON} YBR244W
           (REAL)
          Length = 162

 Score =  217 bits (552), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 124/160 (77%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           S+ FY     DK G  + F QL+ KV L+VNVASKCGFTPQY EL++LY K+ DKGFV++
Sbjct: 2   STTFYDLECQDKKGETFKFDQLKGKVVLIVNVASKCGFTPQYKELEALYQKYHDKGFVIL 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           GFPCNQF  QEPG+DE+I ++ +  Y VTFPI+KKIEVNGNN + VY YLK QKSG+LG 
Sbjct: 62  GFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIEVNGNNADPVYNYLKSQKSGLLGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
           K IKWNFEKFLID +GN+V+RYSS TKP  I+ +I+  LR
Sbjct: 122 KGIKWNFEKFLIDSNGNIVQRYSSLTKPASIDQEIQNLLR 161

>TDEL0A04230 Chr1 complement(752422..752907) [486 bp, 161 aa] {ON} 
          Length = 161

 Score =  214 bits (546), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 98/159 (61%), Positives = 125/159 (78%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  SP DK G P+ F QLE KV L+VNVASKCGFTPQY EL++LY K+KD+G VV+G
Sbjct: 2   SEFYKLSPKDKKGEPFPFSQLEGKVVLIVNVASKCGFTPQYEELEALYKKYKDQGLVVLG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+DEEI ++ +  Y V+FP+LKK++VNG N + VY+YLK QKSG+LG +
Sbjct: 62  FPCNQFGSQEPGSDEEIGQFCQLNYGVSFPVLKKVDVNGGNADPVYEYLKSQKSGLLGFR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFL+DK G V +RYSS TKP+ +++ I   L+
Sbjct: 122 GIKWNFEKFLVDKKGVVQQRYSSLTKPSSLDSAIADLLK 160

>NCAS0F00650 Chr6 (126598..127083) [486 bp, 161 aa] {ON} 
          Length = 161

 Score =  213 bits (542), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 100/159 (62%), Positives = 123/159 (77%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +P DK G  Y F QL+ KV L+VNVASKCGFTPQY EL++LY+K+ DKG V+IG
Sbjct: 2   SEFYKLTPKDKKGEDYPFSQLKGKVVLIVNVASKCGFTPQYKELEALYEKYNDKGLVIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPGTDEEI ++ +  Y VTFPI+KKI+VNG N + VY +LK QKSG+LG K
Sbjct: 62  FPCNQFGHQEPGTDEEIGQFCQLNYGVTFPIMKKIDVNGKNEDPVYGFLKSQKSGILGFK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFL+DK+G V ERY+S TKP+ I+  I   L+
Sbjct: 122 GIKWNFEKFLVDKNGKVYERYASLTKPSSIDETIATLLK 160

>AFL039C Chr6 complement(366579..367226) [648 bp, 215 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIR037W
           (HYR1) and Syntenic homolog of Saccharomyces cerevisiae
           YBR244W (GPX2)
          Length = 215

 Score =  214 bits (546), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 100/164 (60%), Positives = 123/164 (75%)

Query: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60
            + S FY  SPLD  G P+ F QL+ KV ++VNVASKCGFTPQY EL+ LY K+KD+GF 
Sbjct: 25  FTMSGFYDLSPLDAKGEPFPFSQLKGKVVIIVNVASKCGFTPQYEELEELYKKYKDQGFE 84

Query: 61  VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120
           VIGFPCNQF +QEP T+EEI ++ K  Y VTFP+LKK++VNG + + VY YLK QKSG+L
Sbjct: 85  VIGFPCNQFAHQEPATNEEIVQFCKLNYGVTFPVLKKVDVNGADADPVYVYLKSQKSGLL 144

Query: 121 GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE 164
           G K IKWNFEKFL+D+ G V +RYSS TKP  +E  IE  L+ E
Sbjct: 145 GFKGIKWNFEKFLVDRKGQVKDRYSSITKPLSLEKTIETLLKEE 188

>TPHA0J02050 Chr10 (458631..459110) [480 bp, 159 aa] {ON} Anc_6.160
           YBR244W
          Length = 159

 Score =  212 bits (540), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 100/157 (63%), Positives = 121/157 (77%)

Query: 6   FYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFP 65
           FY  +P DK    Y F+QLE KV L+VNVASKCGFTPQY  L+ +Y K+KD+G V++GFP
Sbjct: 3   FYELTPKDKANQDYPFQQLEGKVVLIVNVASKCGFTPQYKGLEEIYQKYKDQGLVILGFP 62

Query: 66  CNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLKAI 125
           CNQF +QEPG DEEI+ +    Y VTFP+LKKI+VNG NT+ VY YLK+ KSG+LG K I
Sbjct: 63  CNQFGHQEPGNDEEISSFCSLNYGVTFPVLKKIDVNGANTDPVYDYLKNSKSGLLGFKGI 122

Query: 126 KWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
           KWNFEKFL+DK GNV +RYSS TKP  IE DI+K L+
Sbjct: 123 KWNFEKFLVDKKGNVYQRYSSLTKPTSIEEDIQKLLK 159

>SAKL0A05940g Chr1 complement(541828..542346) [519 bp, 172 aa] {ON}
           highly similar to uniprot|P40581 Saccharomyces
           cerevisiae YIR037W HYR1 Thiol peroxidase that functions
           as a hydroperoxide receptor to sense intracellular
           hydroperoxide levels and transduce a redox signal to the
           Yap1p transcription factor
          Length = 172

 Score =  211 bits (537), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 123/160 (76%)

Query: 2   SSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVV 61
           + S FY  +PLDK G  + F QL+ KV L+VNVASKCGFTPQY EL+ LY K++ +GF V
Sbjct: 11  TMSKFYELTPLDKAGQAFPFSQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQSQGFEV 70

Query: 62  IGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLG 121
           IGFPCNQF +QEPG+DEEI ++ +  Y VTFPI+KKI VNG+  + VY++LK QKSG+LG
Sbjct: 71  IGFPCNQFGHQEPGSDEEIGQFCQLNYGVTFPIMKKINVNGSEADPVYEFLKSQKSGLLG 130

Query: 122 LKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            K IKWNFEKFL++K G V ERYSS TKP+ +E  IE+ L
Sbjct: 131 FKGIKWNFEKFLVNKKGEVYERYSSLTKPSSLEKTIEELL 170

>Skud_2.376 Chr2 (676159..676647) [489 bp, 162 aa] {ON} YBR244W
           (REAL)
          Length = 162

 Score =  209 bits (533), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 95/159 (59%), Positives = 125/159 (78%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           S+ FY     DK G  + F QL+ KV L+VNVASKCGFTPQY +L++LY K++ KGF+++
Sbjct: 2   STSFYELECQDKKGEIFKFDQLKGKVVLIVNVASKCGFTPQYKDLEALYQKYQGKGFIIL 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           GFPCNQF  QEPG+DE+I ++ +  Y VTFPI+KKIEVNG+N + VY YLK QKSG+LG 
Sbjct: 62  GFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIEVNGSNADPVYNYLKSQKSGLLGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           K IKWNFEKFL+D++GNVV+RYSS TKP+ ++ +I+  L
Sbjct: 122 KGIKWNFEKFLVDRNGNVVQRYSSLTKPSSLDQEIQSLL 160

>TBLA0B01530 Chr2 (335958..336461) [504 bp, 167 aa] {ON} 
          Length = 167

 Score =  208 bits (530), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 123/159 (77%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           ++ FY  +P D  G P+ F QL+ KV ++VNVASKCGFTPQY EL+ LY ++KDK F++I
Sbjct: 2   TTSFYELTPKDNKGQPFPFTQLKGKVVMIVNVASKCGFTPQYKELEDLYKEYKDKDFIII 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           GFPCNQF NQEPG+D +IAK+    Y VTFP+LKKI+VNG + + VY +LKDQKSG+LG 
Sbjct: 62  GFPCNQFGNQEPGSDTDIAKFCSLNYGVTFPVLKKIDVNGVDEDPVYTFLKDQKSGLLGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           K IKWNF+KFLI K+G V +RYSS TKP  +E DI+K L
Sbjct: 122 KGIKWNFQKFLISKNGEVFQRYSSLTKPKSMEDDIKKLL 160

>KAFR0A00140 Chr1 complement(23889..24374) [486 bp, 161 aa] {ON}
           Anc_2.670 YKL026C
          Length = 161

 Score =  207 bits (528), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 95/156 (60%), Positives = 118/156 (75%)

Query: 6   FYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFP 65
           FY  +PLD   NP+ F+Q + KV L+VNVAS+CGFTPQY EL++LY K+ DKG VV+GFP
Sbjct: 4   FYDLAPLDSKCNPFPFQQFKGKVVLIVNVASRCGFTPQYAELEALYKKYNDKGLVVLGFP 63

Query: 66  CNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLKAI 125
           CNQF  QEPG+ E+IAK+    Y +TFPIL+KI+VNG N N VYK+LK +K+G+LG + I
Sbjct: 64  CNQFGGQEPGSAEDIAKFCSMNYGITFPILQKIDVNGRNENPVYKFLKSRKAGLLGFRGI 123

Query: 126 KWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           KWNFEKFLID +G V+ RY S TKP  IE  IE  L
Sbjct: 124 KWNFEKFLIDSEGTVLARYPSLTKPMSIEPTIENLL 159

>Suva_4.504 Chr4 (878603..879091) [489 bp, 162 aa] {ON} YBR244W
           (REAL)
          Length = 162

 Score =  207 bits (526), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (74%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           S+ FY     DK G  + F QL+ KV L+VNVASKCGFTPQY EL+ LY K +DKGF+++
Sbjct: 2   STSFYDLECKDKKGETFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKHQDKGFIIL 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           GFPCNQF  QEPG+DE+I ++ +  Y VTFPI+KKIEVNGN  + VY YLK QKSG+LG 
Sbjct: 62  GFPCNQFGKQEPGSDEQIGEFCQLNYGVTFPIMKKIEVNGNGADPVYNYLKSQKSGLLGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           K IKWNFEKFL+D  GNV +RYSS TKP  ++ +I+  L
Sbjct: 122 KGIKWNFEKFLVDAKGNVAQRYSSLTKPMSLDQEIQNML 160

>Ecym_2257 Chr2 complement(509315..509812) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii AFL039C
          Length = 165

 Score =  207 bits (526), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 119/158 (75%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY  +PL+K G P++F QL+ KV L+VNVAS+CGFTPQY EL+ LY K K+ G  +IG
Sbjct: 2   SSFYDLAPLNKKGEPFSFSQLKGKVVLIVNVASECGFTPQYKELEELYKKHKEAGLEIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QE GTDEEI ++ K  Y VTFPILKKI VNG   + VY+YLK QKSG++G K
Sbjct: 62  FPCNQFGHQEQGTDEEIGQFCKLNYGVTFPILKKINVNGAEADPVYEYLKSQKSGIMGFK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFL+D++G V +RYSS TKP+ IE  I   L
Sbjct: 122 GIKWNFEKFLVDRNGKVHDRYSSLTKPHSIENTIVSLL 159

>YBR244W Chr2 (707528..708016) [489 bp, 162 aa] {ON}
           GPX2Phospholipid hydroperoxide glutathione peroxidase
           induced by glucose starvation that protects cells from
           phospholipid hydroperoxides and nonphospholipid
           peroxides during oxidative stress
          Length = 162

 Score =  206 bits (524), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 123/159 (77%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           ++ FY     DK G  + F QL+ KV L+VNVASKCGFTPQY EL+ LY K++DKGFV++
Sbjct: 2   TTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVIL 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           GFPCNQF  QEPG+DE+I ++ +  Y VTFPI+KKI+VNG+N + VY YLK QK+G+LG 
Sbjct: 62  GFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           K IKWNFEKFL+D +G VV+R+SS TKP+ ++ +I+  L
Sbjct: 122 KGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLL 160

>CAGL0I00264g Chr9 complement(18821..19306) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P40581 Saccharomyces
           cerevisiae YIR037w HYR1
          Length = 161

 Score =  204 bits (519), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 122/160 (76%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           SPF+   P+D  GN Y F+ L+ KV L+VN AS CGFTPQY EL+++Y K+K++GF ++G
Sbjct: 2   SPFHQLRPVDGQGNIYPFEMLKGKVVLIVNTASNCGFTPQYIELENMYQKYKNEGFEILG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QEPG+D EI K+    Y VTFPI+KKI+VNG   + V+KY+K+QK G+LGLK
Sbjct: 62  FPCNQFGHQEPGSDAEIQKFCSSKYKVTFPIMKKIDVNGPYEDPVFKYIKEQKPGMLGLK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRN 163
            IKWNFEKFLID+ GNVV R SS TKP+ +   IEK L+N
Sbjct: 122 GIKWNFEKFLIDRQGNVVLRASSLTKPSTLNETIEKLLKN 161

>CAGL0C01705g Chr3 complement(182305..182799) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P38143 Saccharomyces
           cerevisiae YBR244w GPX2
          Length = 164

 Score =  204 bits (518), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 96/161 (59%), Positives = 119/161 (73%)

Query: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60
           M++  FY     DK G  + F  L+ KV L+VNVASKCGFTPQY +L+SLY K KD+G V
Sbjct: 1   MAAKSFYELECKDKKGETFKFDTLKGKVVLIVNVASKCGFTPQYKDLESLYQKHKDEGLV 60

Query: 61  VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120
           ++GFPCNQF  QEPG+ EEI  + +  Y VTFPI+ KIEVNG+NT+ VY +LK QKSG+L
Sbjct: 61  ILGFPCNQFGGQEPGSQEEIGNFCQLNYGVTFPIMHKIEVNGDNTDPVYDFLKSQKSGLL 120

Query: 121 GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           GL  +KWNFEKFL+DK G V +RYSS TKP  IE DI++ L
Sbjct: 121 GLNRVKWNFEKFLVDKHGKVHQRYSSLTKPMSIEDDIKQLL 161

>KNAG0M00570 Chr13 complement(92461..92943) [483 bp, 160 aa] {ON}
           Anc_6.160 YBR244W
          Length = 160

 Score =  201 bits (510), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 95/159 (59%), Positives = 120/159 (75%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FYS    D  GN ++F+QL+ KV L+VNVASKCGFTPQY  L+ LY K+  KG  +IG
Sbjct: 2   SRFYSLVAKDMKGNNFSFEQLKGKVVLIVNVASKCGFTPQYEGLEELYKKYNPKGLEIIG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF NQEPG+ +EI ++ K  Y V+FPI+ KIEVNG+  + VY +LK +KSG+LGL 
Sbjct: 62  FPCNQFGNQEPGSSDEITQFCKLNYGVSFPIMSKIEVNGSKEDPVYAFLKGEKSGMLGLT 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
            IKWNFEKFL+DK+GNVVERYSS TKP  +E  I++ L+
Sbjct: 122 RIKWNFEKFLVDKNGNVVERYSSMTKPASLETKIQELLK 160

>NCAS0H03610 Chr8 (687430..687960) [531 bp, 176 aa] {ON} Anc_2.670
          Length = 176

 Score =  200 bits (509), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 124/161 (77%)

Query: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60
           ++ S FY  +    D   + F QL+N V L+VNVASKC FTPQY +L+ LY K++++G +
Sbjct: 16  ITMSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLI 75

Query: 61  VIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120
           ++GFPCNQF NQEPG+DE+I K+ ++++ VTFP++KKI VNG   + +Y+YLK+++ G+ 
Sbjct: 76  ILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLF 135

Query: 121 GLKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           G+K+IKWNFEKFLIDK GN+ +RYSS TKP+EI  DIE+ L
Sbjct: 136 GIKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176

>Kpol_534.24 s534 complement(55973..56464) [492 bp, 163 aa] {ON}
           complement(55973..56464) [492 nt, 164 aa]
          Length = 163

 Score =  199 bits (505), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 125/161 (77%), Gaps = 1/161 (0%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQ-LENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVV 61
           +S FY   PLD DGN Y+F++ L+ KV L+VNVASKCGFTPQY +L++LY ++ +KGFV+
Sbjct: 2   TSKFYDHKPLDSDGNVYSFEEHLKGKVVLIVNVASKCGFTPQYKDLENLYREYHEKGFVI 61

Query: 62  IGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLG 121
           + FPCNQF +QEPGTDEEI ++    + V+FPI+KKI+VNG NT+ VY+YLK++K G LG
Sbjct: 62  LAFPCNQFGHQEPGTDEEIGRFCALNFGVSFPIMKKIDVNGVNTDPVYEYLKNEKVGSLG 121

Query: 122 LKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLR 162
           LK +KWNFEKFL+D++G V  R+SS   P  IE +I + L+
Sbjct: 122 LKGVKWNFEKFLVDRNGTVTNRFSSLVGPTSIEQNIIELLK 162

>ZYRO0D13288g Chr4 complement(1118074..1118571) [498 bp, 165 aa]
           {ON} highly similar to uniprot|P40581 Saccharomyces
           cerevisiae YIR037W HYR1 Thiol peroxidase that functions
           as a hydroperoxide receptor to sense intracellular
           hydroperoxide levels and transduce a redox signal to the
           Yap1p transcription factor
          Length = 165

 Score =  194 bits (494), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 120/161 (74%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY   P D  G  ++F QL+ KV L+VNVASKCGFTPQY EL+ LY K+KD G V++G
Sbjct: 2   SKFYELQPRDGKGEVFSFDQLKGKVVLIVNVASKCGFTPQYHELEELYKKYKDMGLVILG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF +QE G+D +IA++ K  Y VTFPI+KKI VNG +++ VY++LK QK+G++G +
Sbjct: 62  FPCNQFGHQETGSDTQIAQFCKLNYGVTFPIMKKINVNGPDSDPVYQFLKSQKAGLMGFR 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE 164
            IKWNFEKFL+D+ G V  R+ S  KP+ +++ I++ L +E
Sbjct: 122 GIKWNFEKFLVDRQGQVFGRWGSLEKPSSLDSVIQQLLESE 162

>KLLA0D03905g Chr4 complement(330128..330634) [507 bp, 168 aa] {ON}
           similar to uniprot|P38143 Saccharomyces cerevisiae
           YBR244W GPX2 Phospholipid hydroperoxide glutathione
           peroxidase induced by glucose starvation that protects
           cells from phospholipid hydroperoxides and
           nonphospholipid peroxides during oxidative stress
          Length = 168

 Score =  191 bits (486), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 89/162 (54%), Positives = 116/162 (71%)

Query: 3   SSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           S  FYS+S   KDG+ Y+  +L  KV L+VNVASKCGF  QY ELQ LY +F  KGF ++
Sbjct: 2   SDDFYSYSCETKDGSEYHMSELRGKVVLIVNVASKCGFRGQYGELQELYKEFHAKGFEIL 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
            FPCNQFMNQEPG+DEEI K+ ++ Y V+F I+KK +VNG N   +YKYLKDQ+  + G 
Sbjct: 62  AFPCNQFMNQEPGSDEEIGKFCQEHYGVSFKIMKKCKVNGVNALPLYKYLKDQQPRMFGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCLRNE 164
             ++WNFEKFLID+ G V  RYS+ TKP  ++ DIE+ L+ +
Sbjct: 122 TFVRWNFEKFLIDRSGRVHGRYSTLTKPKSMKEDIEQLLKQK 163

>KAFR0G03570 Chr7 (736666..737151) [486 bp, 161 aa] {ON} Anc_6.160
           YBR244W
          Length = 161

 Score =  191 bits (486), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 91/155 (58%), Positives = 116/155 (74%)

Query: 7   YSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFPC 66
           Y F   DK G      Q + KV LVVNVASKCGFTPQY  L+ +Y K++D+G V++GFPC
Sbjct: 5   YDFEVKDKKGEVVKLDQYKGKVILVVNVASKCGFTPQYAGLEKIYKKYEDQGLVILGFPC 64

Query: 67  NQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLKAIK 126
           NQF+ QEPGT+EEI+++ +  Y VTFPI++KI+VNG+N +  Y+YLK QK G +GLK IK
Sbjct: 65  NQFLGQEPGTNEEISQFCQLNYGVTFPIMQKIDVNGSNADPFYEYLKSQKKGPMGLKRIK 124

Query: 127 WNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           WNFEKFLID++G VVER+SS TKP  I+  I K L
Sbjct: 125 WNFEKFLIDQNGKVVERFSSLTKPESIDPKIGKLL 159

>NDAI0D05060 Chr4 (1209831..1210316) [486 bp, 161 aa] {ON} 
          Length = 161

 Score =  187 bits (475), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (74%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           + FY  +    +   ++F  L+ KV L+VNVASKC FTPQY  L+ LY K+KDKGF ++G
Sbjct: 2   TTFYDLTANLPNDETFHFSDLKGKVVLIVNVASKCSFTPQYKPLEHLYRKYKDKGFTILG 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPCNQF  QEPG+D +I K+ ++T+ VTFP++KKI VNG+ T+ VY+YLK QK GV GLK
Sbjct: 62  FPCNQFAGQEPGSDADIKKFCQETFGVTFPLMKKINVNGSQTDPVYQYLKSQKPGVFGLK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKP 150
            IKWNFEKFLIDK GNV ERYSS  +P
Sbjct: 122 TIKWNFEKFLIDKSGNVYERYSSLIRP 148

>YKL026C Chr11 complement(389380..389883) [504 bp, 167 aa] {ON}
           GPX1Phospholipid hydroperoxide glutathione peroxidase
           induced by glucose starvation that protects cells from
           phospholipid hydroperoxides and nonphospholipid
           peroxides during oxidative stress
          Length = 167

 Score =  187 bits (475), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 114/156 (73%)

Query: 6   FYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFP 65
           FYSFSP+D++GNP+ F  L NKV L+VNVAS C FTPQY EL+ LY+K+K  G V++ FP
Sbjct: 4   FYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFP 63

Query: 66  CNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLKAI 125
           C QF NQE   D+EI K+ +D Y VTFPIL KI  NG   + VYK+LK+  SG  G+K I
Sbjct: 64  CGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMI 123

Query: 126 KWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           KWNFEKF++D++G VV+R+S  T+P E+   IE+ L
Sbjct: 124 KWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELL 159

>TPHA0N01060 Chr14 complement(223554..224078) [525 bp, 174 aa] {ON}
           Anc_6.160 YBR244W
          Length = 174

 Score =  186 bits (471), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 113/156 (72%)

Query: 6   FYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFP 65
           FY F PLD +G P++F+QL  KV L+VNVAS CGFTPQY +L+ L+ K+  KG V++GFP
Sbjct: 10  FYGFKPLDSEGKPFDFEQLRGKVVLIVNVASHCGFTPQYKDLEYLHRKYNRKGLVILGFP 69

Query: 66  CNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLKAI 125
           CNQF +QEPG++ EI+K+    + +TFPIL KI VNG  ++ +YKYLK++K    GLK I
Sbjct: 70  CNQFGHQEPGSNYEISKFCTLNFGITFPILNKINVNGVYSDPLYKYLKERKLDSAGLKGI 129

Query: 126 KWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           KWNFEKFL+  +G V  RYSS   P E+E+DI   +
Sbjct: 130 KWNFEKFLVSSEGEVYGRYSSLMSPLELESDISTLI 165

>Smik_11.227 Chr11 complement(376428..376931) [504 bp, 167 aa] {ON}
           YKL026C (REAL)
          Length = 167

 Score =  185 bits (469), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 114/158 (72%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FYSF+P+D+DGN + F  L NKV L+VNVAS C FTPQY EL+ LY+K+K  G V+I 
Sbjct: 2   SEFYSFAPIDQDGNTFPFGSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKPYGLVIIA 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPC QF NQE   D+EI K+ ++ + VTFPIL KI  NG N + VYK+LK+   G  G+K
Sbjct: 62  FPCGQFGNQEFEKDDEINKFCQNKFGVTFPILHKIRCNGQNQDPVYKFLKNSVRGQSGIK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFL+D++G V++R+S  T+P E+   IE+ L
Sbjct: 122 MIKWNFEKFLVDRNGKVIKRFSCMTRPLELSQLIEELL 159

>Skud_11.202 Chr11 complement(370313..370816) [504 bp, 167 aa] {ON}
           YKL026C (REAL)
          Length = 167

 Score =  182 bits (461), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 113/158 (71%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FYSF+P D+DGNP+    L +KV LVVNVAS C FTPQY EL+ LY+K++  G  +I 
Sbjct: 2   SEFYSFAPTDQDGNPFPLSSLHDKVVLVVNVASHCTFTPQYKELEYLYEKYRSYGLEIIA 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPC QF NQE   DEEI K+ ++ + VTFPIL KI+ NG   + VY++LK+  +G  G+K
Sbjct: 62  FPCGQFGNQEFEKDEEINKFCQNKFGVTFPILHKIQCNGQRQDPVYRFLKNSVNGKSGIK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFLID++G VV+R+S  T+P E+ + IE  L
Sbjct: 122 MIKWNFEKFLIDRNGKVVKRFSCMTRPLELSSLIEGLL 159

>Suva_11.200 Chr11 complement(373259..373762) [504 bp, 167 aa] {ON}
           YKL026C (REAL)
          Length = 167

 Score =  181 bits (459), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 85/158 (53%), Positives = 113/158 (71%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FYS +P+D+DGNP+ F  L  KV L+VNVAS C FTPQY EL+ +Y+K+K  G  +I 
Sbjct: 2   SRFYSLTPIDRDGNPFPFASLNGKVVLIVNVASHCTFTPQYKELEYIYEKYKCHGVEIIA 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGLK 123
           FPC+QF NQE   D EI K+ ++ + VTFPIL K+  NG   + VY++LKD  +G  G+K
Sbjct: 62  FPCSQFGNQEIEKDNEINKFCQNKFGVTFPILHKVYCNGQKQDPVYRFLKDSVTGKFGIK 121

Query: 124 AIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
            IKWNFEKFLID++G+VV+R+S  T+P EI   IE+ L
Sbjct: 122 MIKWNFEKFLIDRNGHVVKRFSCMTRPLEIVPFIEELL 159

>CAGL0I00242g Chr9 complement(17649..18146) [498 bp, 165 aa] {ON}
           similar to uniprot|P40581 Saccharomyces cerevisiae
           YIR037w HYR1 glutathione peroxidase
          Length = 165

 Score =  178 bits (451), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 86/160 (53%), Positives = 109/160 (68%)

Query: 2   SSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVV 61
           S S FY  SP DKD N + F  L+ +V L+VNVASKC FTPQY +LQ L++K+  +G  +
Sbjct: 3   SQSSFYDLSPHDKDNNEFPFSNLKGQVVLIVNVASKCNFTPQYNDLQYLHEKYSYRGLKI 62

Query: 62  IGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLG 121
           IGFPCNQF  QEP  DE I K+    Y V+F ILKKI+VNG N + VY YLK++    +G
Sbjct: 63  IGFPCNQFGQQEPENDEVIQKFCLSNYGVSFKILKKIKVNGPNADPVYTYLKNEMPSQIG 122

Query: 122 LKAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           LK I+WNFEKFL+DK G V  RYSS T P  ++  I++ L
Sbjct: 123 LKVIRWNFEKFLVDKHGRVRHRYSSLTSPKSLQRTIDQLL 162

>KNAG0M02380 Chr13 complement(440547..441038) [492 bp, 163 aa] {ON}
           Anc_2.670 YKL026C
          Length = 163

 Score =  176 bits (447), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 106/159 (66%), Gaps = 1/159 (0%)

Query: 4   SPFYSFSPLDKDGNPYNFK-QLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVI 62
           S FY  S +  DG+ + F   L  KV L+VNVAS+CG+TPQY+ELQ L++++  +G VV+
Sbjct: 2   SAFYELSAVRADGSRFLFGDTLAGKVVLIVNVASRCGYTPQYSELQQLHERYSQEGLVVL 61

Query: 63  GFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           GFPCNQF NQEPGT EEI  + +D + VTFPIL KI VNG   + VYKYLK Q+   LG 
Sbjct: 62  GFPCNQFGNQEPGTMEEIVAFTRDKFGVTFPILSKINVNGPREDPVYKYLKSQRGNALGF 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           K +KWNFEKF++D+ G V  RY S       E D+   L
Sbjct: 122 KGVKWNFEKFVVDRAGVVQFRYGSKDTMAVYERDLRALL 160

>TBLA0A00660 Chr1 complement(139356..139865) [510 bp, 169 aa] {ON}
           Anc_2.670 YKL026C
          Length = 169

 Score =  164 bits (415), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 82/159 (51%), Positives = 109/159 (68%), Gaps = 1/159 (0%)

Query: 4   SPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIG 63
           S FY    +D D  PY F QL+ KV L+VNV    G+ PQY EL+ LY+K+KD+GFV++ 
Sbjct: 2   SEFYKLIAVDTDKKPYPFSQLKGKVVLIVNVYLHFGYMPQYKELEILYEKYKDRGFVILA 61

Query: 64  FPCNQFMNQEPGTDEEIAKYVKDTYNVT-FPILKKIEVNGNNTNDVYKYLKDQKSGVLGL 122
           FPC QF ++   + +EI + +K    VT FPI+ ++ VNG +TN VYKYLK + +  LGL
Sbjct: 62  FPCAQFEHEARDSPDEIQEDIKQLEFVTKFPIMNEVNVNGPDTNPVYKYLKSKVTDSLGL 121

Query: 123 KAIKWNFEKFLIDKDGNVVERYSSNTKPNEIEADIEKCL 161
           + IKWNF KFLID+DGNVV RYSS  KP+ +E  IE+ L
Sbjct: 122 RNIKWNFAKFLIDRDGNVVNRYSSLVKPSSLENIIERLL 160

>TPHA0H03120 Chr8 (746224..746817) [594 bp, 197 aa] {ON} 
          Length = 197

 Score =  124 bits (310), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 96/148 (64%), Gaps = 9/148 (6%)

Query: 6   FYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFP 65
           FY  S +D +G  ++F+ L+ KV L+VN++S+ G  PQ  EL +LY +FK+  FV+IGF 
Sbjct: 3   FYELSAVDINGEKFSFETLKGKVVLIVNMSSQSGLDPQCKELNNLYRRFKESNFVIIGFI 62

Query: 66  CNQFMNQ----EPGT-----DEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQK 116
            +Q +N+    +P +     DE  +  +  + NV F I+  I+VNG NT+ V+K+LK++K
Sbjct: 63  SDQLINESIMNQPSSPSNVIDEVTSNLMSPSCNVEFLIMDNIDVNGPNTDPVFKFLKERK 122

Query: 117 SGVLGLKAIKWNFEKFLIDKDGNVVERY 144
               G + IKWNF KFLID +GNVV+R+
Sbjct: 123 KDSAGFQGIKWNFAKFLIDSNGNVVKRF 150

>Suva_15.7 Chr15 complement(13820..13930) [111 bp, 37 aa] {ON}
          YBR244W (REAL)
          Length = 37

 Score = 35.4 bits (80), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 21 FKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDK 57
          F QL+ KV LVVN+  K GFT +  EL+  Y + +DK
Sbjct: 1  FVQLKGKVDLVVNITGKYGFTTECRELEVPYKRCEDK 37

>Kwal_27.10794 s27 complement(498413..500020) [1608 bp, 535 aa] {ON}
           YBL080C (PET112) - 62-kDa protein [contig 33] FULL
          Length = 535

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 66  CNQFMNQEPGT-DEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYLKDQKSGVL 120
           CN+ MN  P   D ++ K + + YN++    K + +NGN  + +YK     +SG+L
Sbjct: 311 CNRIMNSLPELPDTQLRKLMSEPYNLSLKDAKILALNGNGHDQLYK-----QSGLL 361

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa]
          {ON} Anc_6.20 YML002W
          Length = 1093

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 18 PYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFPCNQFMN 71
          PY+   L N +   VN    C   P  + L+ L+   KD+ F+++  PC++ ++
Sbjct: 2  PYHLPVLLNPL---VNAVFNCP-NPSTSNLKKLFSNLKDRKFILLVPPCDRLLD 51

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1030

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 42  PQYTELQSLYDKFKDKGFVVIGFPCNQFMNQEPGTDEEIAKYVKDTYNVTF 92
           P   E   LY  F+   F  IGF C  F+NQ+  ++  I K +K++  +T 
Sbjct: 263 PLIDEFFGLYSAFEAFSFHGIGFCCKAFLNQDK-SNVGITKDIKESLYITL 312

>NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]
           {ON} Anc_7.153 YIR002C
          Length = 1046

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query: 28  VALVVNVASKCGFTPQYTELQSLYDKFKDKGFVVIGFPCNQFMNQEPGTDEEIAKYVKDT 87
           V LV++ A +   +  YT +    D+F +  + ++           PG+D E  + V + 
Sbjct: 205 VCLVIDEAHRATGSYAYTNVVKFIDRF-NSSYRILALTAT------PGSDLESVQEVVNN 257

Query: 88  YNVTFPILKKIEVNGNNTNDVYKYLKDQK 116
            +++      IE+    + D+ KY+K +K
Sbjct: 258 LDIS-----SIEIRTEESMDIIKYMKKRK 281

>Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON}
           (69833..73657) [3825 nt, 1275 aa]
          Length = 1274

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 29/62 (46%)

Query: 1   MSSSPFYSFSPLDKDGNPYNFKQLENKVALVVNVASKCGFTPQYTELQSLYDKFKDKGFV 60
           +S SP  +FS L +   P N   ++  +++   +++ C   P  + +    DKF    + 
Sbjct: 280 LSKSPLPNFSQLSRSTTPINSGNIDGDISMSKIISNICDLLPPKSVISVYLDKFFRHIYP 339

Query: 61  VI 62
           VI
Sbjct: 340 VI 341

>Smik_7.1 Chr7 complement(1571..3448) [1878 bp, 625 aa] {ON} YOR389W
           (REAL)
          Length = 625

 Score = 28.5 bits (62), Expect = 8.5,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 62  IGFPCNQFMNQEPGTDEEIAKYVKDTYNVTFPILKKIEVNGNNTNDVYKYL 112
           +GF  ++ MN +   DE +AK+         P+LK +    N T D+ +Y+
Sbjct: 399 VGFDASRSMNWQVALDELVAKFA--------PLLKTVSAILNRTGDINEYV 441

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,752,048
Number of extensions: 1069198
Number of successful extensions: 2646
Number of sequences better than 10.0: 87
Number of HSP's gapped: 2643
Number of HSP's successfully gapped: 87
Length of query: 164
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 63
Effective length of database: 41,900,133
Effective search space: 2639708379
Effective search space used: 2639708379
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)