Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C020003.497ON1066106653070.0
Suva_7.4223.497ON1127107821760.0
ZYRO0D09790g3.497ON1180110021100.0
NCAS0E007703.497ON1150108620940.0
YGR134W (CAF130)3.497ON1122106920900.0
Skud_7.4453.497ON1123107020800.0
Smik_6.2303.497ON1124109720790.0
TDEL0D056503.497ON1077105320390.0
KNAG0B007703.497ON1038107819490.0
SAKL0F02596g3.497ON1132111319380.0
Ecym_12323.497ON1204116118360.0
Kpol_480.123.497ON111482518090.0
AFR316W3.497ON1191116017720.0
Kwal_47.188863.497ON1105107017430.0
KLTH0G02442g3.497ON1113106217140.0
NDAI0G009003.497ON127987616950.0
TBLA0C045103.497ON1307124916550.0
CAGL0I10428g3.497ON116381315250.0
TPHA0A056803.497ON107490414261e-179
KLLA0E03961g3.497ON113211249771e-113
KAFR0A061304.221ON96154763.2
NDAI0A023707.272ON1005109727.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C02000
         (1066 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....  2048   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   842   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   817   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   811   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   809   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   805   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   805   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   790   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   755   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   751   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   711   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   701   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   687   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   676   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   664   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   657   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   642   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   592   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   553   e-179
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   380   e-113
KAFR0A06130 Chr1 (1241576..1244461) [2886 bp, 961 aa] {ON} Anc_4...    34   3.2  
NDAI0A02370 Chr1 complement(527490..530458,530577..530625) [3018...    32   7.8  

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score = 2048 bits (5307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1003/1066 (94%), Positives = 1003/1066 (94%)

Query: 1    MAKKKRTKSFLHIETIDVQNSSSNEPTFNLVENVNTINDLSSLLGQNNEPSVLLEGLVIS 60
            MAKKKRTKSFLHIETIDVQNSSSNEPTFNLVENVNTINDLSSLLGQNNEPSVLLEGLVIS
Sbjct: 1    MAKKKRTKSFLHIETIDVQNSSSNEPTFNLVENVNTINDLSSLLGQNNEPSVLLEGLVIS 60

Query: 61   LFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQSNRNYYLSQFT 120
            LFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQSNRNYYLSQFT
Sbjct: 61   LFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQSNRNYYLSQFT 120

Query: 121  KFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXXDFIMFFQPYMN 180
            KFLLQNEQVPFHLNNYHLTKYKLKLQR                      DFIMFFQPYMN
Sbjct: 121  KFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNYNLLLDFIMFFQPYMN 180

Query: 181  DLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRYLNDVLSIDPMITDQ 240
            DLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRYLNDVLSIDPMITDQ
Sbjct: 181  DLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRYLNDVLSIDPMITDQ 240

Query: 241  FTSNYRDKAFQESEETLLMSQQQTAKDDIIFSFDLNETGDLPNLIKHSEMRHQIIYDILN 300
            FTSNYRDKAFQESEETLLMSQQQTAKDDIIFSFDLNETGDLPNLIKHSEMRHQIIYDILN
Sbjct: 241  FTSNYRDKAFQESEETLLMSQQQTAKDDIIFSFDLNETGDLPNLIKHSEMRHQIIYDILN 300

Query: 301  LNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDK 360
            LNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDK
Sbjct: 301  LNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDK 360

Query: 361  ELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILNDFPNDYKTALNKWLPHGINTQDLEL 420
            ELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILNDFPNDYKTALNKWLPHGINTQDLEL
Sbjct: 361  ELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILNDFPNDYKTALNKWLPHGINTQDLEL 420

Query: 421  XXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTP 480
                         KLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTP
Sbjct: 421  IYMINIIAIYTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTP 480

Query: 481  IIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSH 540
            IIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSH
Sbjct: 481  IIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSH 540

Query: 541  AAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXX 600
            AAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYN                
Sbjct: 541  AAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQTNELEELE 600

Query: 601  KRSVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKSRTNPYSVRVNSIFEFDY 660
            KRSVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKSRTNPYSVRVNSIFEFDY
Sbjct: 601  KRSVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKSRTNPYSVRVNSIFEFDY 660

Query: 661  SGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVK 720
            SGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATT            QSVASCVK
Sbjct: 661  SGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSVASCVK 720

Query: 721  LEQEKMILENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEM 780
            LEQEKMILENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEM
Sbjct: 721  LEQEKMILENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEM 780

Query: 781  LMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTD 840
            LMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTD
Sbjct: 781  LMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTD 840

Query: 841  KKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSENVSLYAIGL 900
            KKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSENVSLYAIGL
Sbjct: 841  KKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSENVSLYAIGL 900

Query: 901  VKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVGEPSMEG 960
            VKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVGEPSMEG
Sbjct: 901  VKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVGEPSMEG 960

Query: 961  KSDSDGTDSNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRK 1020
            KSDSDGTDSNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRK
Sbjct: 961  KSDSDGTDSNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRK 1020

Query: 1021 VIYKDDKILPIPKLYQPILLRELIDENFEEDDDGDILDHENDTVSE 1066
            VIYKDDKILPIPKLYQPILLRELIDENFEEDDDGDILDHENDTVSE
Sbjct: 1021 VIYKDDKILPIPKLYQPILLRELIDENFEEDDDGDILDHENDTVSE 1066

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1078 (44%), Positives = 655/1078 (60%), Gaps = 97/1078 (8%)

Query: 52   VLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLES-SSGDLNYKYLKHELWQS 110
            +L E L ++LFTTKSG SIL  +    +     +   +W +S  + D NY  +    W+ 
Sbjct: 71   LLFEALSVTLFTTKSGKSILQTMKASTS-----KERKAWEKSFENHDSNYASIIRS-WKE 124

Query: 111  NRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXXD 170
            + +  L +F +F+L N+  P  ++ Y+L KYKL L                        D
Sbjct: 125  D-DVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLS-FLIVSKVNLPSIILNEGYNMLKD 182

Query: 171  FIMFFQPYMNDLI----SYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRY 226
            ++      M  LI    ++      F   + +Y+R+ E   F+ WY+ +   N +  + +
Sbjct: 183  YLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNH 242

Query: 227  ------------LNDVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQTAKD-DIIFSF 273
                        L+ V S+D        +   D   ++ ++T++    +T  D + I+SF
Sbjct: 243  NINLLMDSYEDNLDGVSSVD-------DAGKSDNHQKQPKDTII---HRTVNDQEQIYSF 292

Query: 274  DLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNE 331
            +LN+ G L  PN+++HS +RH++++ ILNL  + +P L++QF  +CGLVDPLTQP PN++
Sbjct: 293  ELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDK 352

Query: 332  HIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLS 391
            HIISID +YQLF+GLMY          +     F ICFNMQKII  +++ LNC  ++ L+
Sbjct: 353  HIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLN 412

Query: 392  TILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTL 450
            +I N D    ++T L+ WLPHG+NTQDLEL             KLY  +PIQLNPFL +L
Sbjct: 413  SINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSL 472

Query: 451  VSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEH 510
            +SLWK LS ++L+ LEIDRIEE   TY+TP++VRATIRGAAALR+VIA +LN  V + +H
Sbjct: 473  LSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDH 532

Query: 511  DFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDE 570
            DFKHES NTFMSP+GRKLC GAL ADLRSH A++LALG   + DVT+L ADLQ+GDRFDE
Sbjct: 533  DFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALG-ASIEDVTDLFADLQSGDRFDE 591

Query: 571  DVKYIFEYEYQDYNXXXX-----XXXXXXXXXXXXKRSVK----KRRCNCIFEDDKML-E 620
            D++Y+F+YE +DYN                     K S+     +RRCNCIF DDK++ E
Sbjct: 592  DIRYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAE 651

Query: 621  DYEYYEVGNES----RREDMNLESDKSRT---------NPYSVRVNSIFEFDYSGKDWRD 667
            D       N+S     R D N  S+ + T         NPYSVR  S FEFDYSG+DWRD
Sbjct: 652  DGANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRD 711

Query: 668  VPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQEKMI 727
            VP+ FN+YYSPSY FI+ PKL  + + TL+  T            +SVASCVK EQ++MI
Sbjct: 712  VPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMI 771

Query: 728  L-----------ENYSN-----TKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKE 771
            L           EN+       T + + +E+L R  TPDD+YEIW EESAFERM+Y+N +
Sbjct: 772  LADLGSNFTSIGENFEGGDTGITSDKTNDEEL-RRTTPDDIYEIWSEESAFERMLYVNHD 830

Query: 772  VAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKS 831
            VAWRLMDEMLMC GYRR+L+WF+TH+E+ HSL++Y+FEL+MGLRG          DR   
Sbjct: 831  VAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDD 890

Query: 832  LLLQDMMTDKK--GSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSND 889
            ++ + +   +K   +  +PFSRQG I+LS+IETKMLLQEFF NAAIF S+ +T      D
Sbjct: 891  MIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEE-EGED 949

Query: 890  SENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTL 949
            ++ VSLY++GLVKLIC+MV+TL+ NDKF F+KSECTFELQTLLM WIGI+PEA++LFF +
Sbjct: 950  ADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQI 1009

Query: 950  KA-------NVGEPSMEGKSDSD-----GTDSNEGELSWYNSKLLALLPSPTNSGLENPA 997
            K+        + + +++ K  +D     G   N   +S  N K+L+L PS      +N A
Sbjct: 1010 KSRLAMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSA 1069

Query: 998  IETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELIDENFEEDDDGD 1055
            I TLRSF+  YSF  +V   GR+V++ DDKILP+PK  +PI L E I     E D GD
Sbjct: 1070 ISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYI--TLAELDMGD 1125

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1100 (42%), Positives = 652/1100 (59%), Gaps = 115/1100 (10%)

Query: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSEL---FQRYNSWLES--SSGDLNYKYLKH 105
            S+LLE ++++L TT++G S+L++L    +N  +         WL      G L+   +  
Sbjct: 86   SLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQ 145

Query: 106  ELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXX 165
              WQS+ + +L +F  FLL+NE V     N +  ++K+ L                    
Sbjct: 146  --WQSDDDIFL-KFLHFLLKNEDVWLPCENVNQCEWKVPLS-FLIQSKYRAAELILDPSY 201

Query: 166  XXXXDFIMFFQP----YMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTL-TIASNT 220
                D+ +   P    ++   ISY   G      +  YNR+Y+ +G+ TWYTL T  SN 
Sbjct: 202  NLLVDYFLAVVPLCEKWLRRAISY-GNGVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNH 260

Query: 221  S-IAVRYLNDVLSIDP------------------MITDQFTSNYRD-------KAFQESE 254
              ++ + L D++  D                    I DQ  S  +D         F   E
Sbjct: 261  PFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLNSGFYGDE 320

Query: 255  ETLLMSQ------QQTAKDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQIDS 306
            +   + +       Q  +++ +FSFDLN+ G  +LPNL+ H+ +RH+I+  +L LN   S
Sbjct: 321  DRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVLKLNNSSS 380

Query: 307  PFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFT 366
            P L+ QF ++ GLVDPLTQP PN++H+IS+DL+YQ+F+G +       L  ++     F 
Sbjct: 381  PLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFH 440

Query: 367  ICFNMQKIISRSLVLLNCNDYDTLSTILNDFPN-DYKTALNKWLPHGINTQDLELXXXXX 425
            +CFNMQKII  SLV LN +D++ L++I N   N D+++ L+KWLPHG NTQDLEL     
Sbjct: 441  VCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVD 500

Query: 426  XXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRA 485
                    KLY +LPIQLNPFL +L+SLWK L+ ++L+GLEIDRIEE  ET+DTP++VRA
Sbjct: 501  IIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRA 560

Query: 486  TIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAIL 545
            TIRGAAALRA++AT+LN HV   +HD KHES NTFMSPHGRKLC GAL A+LRSHAAA+L
Sbjct: 561  TIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHAAALL 620

Query: 546  ALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXX---------X 596
            ALG  EL DVT L +DLQ GDRFDEDV+Y+FEYE++DYN                     
Sbjct: 621  ALG-SELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDS 679

Query: 597  XXXXKRSVKKRRCNCIF--EDDKMLEDYEYYEVGNESRREDMNLE------SDKSRTNPY 648
                 R    RRCNCIF  ++    EDYE    G+++ ++ +  +      S  +   P+
Sbjct: 680  SKTHARKGFGRRCNCIFDDDEMLEDEDYENEYEGHKAPKQILPQQNPTTSVSMSTTGKPH 739

Query: 649  SVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXX 708
            ++R    FEFDYSGKDWRD+PR  NLYYSP+Y F+++    T++  T KAT         
Sbjct: 740  AIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIES 799

Query: 709  XXXXQSVASCVKLEQEKMILEN-----YSNTKNCSTEEDLDREVTPDDVYEIWCEESAFE 763
                 SVA+CVK EQ++++L N     + N    S   D  ++++PDD+YE+WC++S FE
Sbjct: 800  LLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDSTFE 859

Query: 764  RMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDS-- 821
            +M+Y N EVAWRLMDEMLMC+G+RRVL+WFITHME+NHSL+HYIFELVMGLR   D++  
Sbjct: 860  KMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFDENNE 919

Query: 822  RNPGDDRLKSLLLQDMMTDKKGSE---KVPFSRQGSIILSEIETKMLLQEFFTNAAIFFS 878
             + GD+ +  +        K+  E    +PFSRQGSI LS IETKMLLQEFFTNAAIF +
Sbjct: 920  NDNGDESISEMT-------KEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLT 972

Query: 879  -----------TNDTANMSSNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFE 927
                         D A ++  ++ NVSLYA+GL+KLIC MV+  +   KFDF +SEC FE
Sbjct: 973  EKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFE 1032

Query: 928  LQTLLMNWIGIIPEAQELFFTLKANVGE-------------------PSMEGKSDSDGTD 968
            LQTLLMNWI IIPEA++LFF LKA V E                     +    ++D  +
Sbjct: 1033 LQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNIN 1092

Query: 969  SNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKI 1028
             NE   S YN KL++LL    +   EN A+  LR+F+KKYSF   VP++GRKV+Y+ ++I
Sbjct: 1093 GNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEI 1152

Query: 1029 LPIPKLYQPILLRELIDENF 1048
            LP+P+   P+ L + + +N+
Sbjct: 1153 LPLPESETPMSLLDYLVDNY 1172

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1086 (44%), Positives = 633/1086 (58%), Gaps = 108/1086 (9%)

Query: 49   EPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELF--QRYNSWLESSS-GDLNYKYLKH 105
            E S+L+E ++I   +T+SG  + S L N     + F   +Y  WL S+      ++YL+ 
Sbjct: 68   EHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRK 127

Query: 106  ELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXX 165
            + W SN+ Y+L +FTKFLL N     +++ Y    YKL L                    
Sbjct: 128  K-WSSNKLYFL-KFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKY 185

Query: 166  XXXXDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVR 225
                D+I    P +  ++   +E     ++   Y    +L   + WY L    +      
Sbjct: 186  NLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEG---- 241

Query: 226  YLNDVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQTAKDDIIFSFDLN--ETGDLPN 283
            +LN              SN      Q S +T         +   ++SFDLN  +T +L N
Sbjct: 242  HLN-------ATKQNNNSNNIPLTMQPSIKTNNNGANNNNQ--TVYSFDLNTDKTFELDN 292

Query: 284  LIKHSEMRHQIIYDILNLNQID-SPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQL 342
            ++ H+  RH+++  ++N N +  +P L  QF  + GLVDPL+QP PNN+ +IS+ L+Y +
Sbjct: 293  VVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSM 352

Query: 343  FMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTIL-------- 394
            F+GLMY          D     F ICFNM K+I+ S+V+L C++++ L+ I+        
Sbjct: 353  FIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNNDNDE 412

Query: 395  ---NDFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLV 451
               ND  + +K  LN+W+PHGINTQDLEL             +LYS+LPIQ+NPFL  L+
Sbjct: 413  GTENDDDDAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLI 472

Query: 452  SLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHD 511
            +LWK LS ++L+GL+IDR EE+ +T+ TP++VRATIRGAA+LRAV+ATILN+HV   EHD
Sbjct: 473  TLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHD 532

Query: 512  FKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDED 571
            FKHE  NTFMSPHGRKLC GAL AD+RSHAAAILALG  EL DVT+LL DLQAGDRFDED
Sbjct: 533  FKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALG-AELEDVTDLLTDLQAGDRFDED 591

Query: 572  VKYIFEYEYQDYNXXXXXXXXXXXXXXXXKRSVKKRRCNCIFEDDKMLEDYEYYE----- 626
            ++Y+F+YEY DYN                      RRCNCIFEDD ++ D          
Sbjct: 592  IRYMFDYEYDDYNDFKDDVEEQEEMEIMGSFP---RRCNCIFEDDNIINDDTDNINENDE 648

Query: 627  ---------------VGNESRREDMNLESDKSRT---NPYSVRVNSIFEFDYSGKDWRDV 668
                           V  ++   ++N   D  RT   +P S R  S FEFDY GKDWRD+
Sbjct: 649  DDDDEQEEYVDAIEGVTKDTPHNNLN-PHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDI 707

Query: 669  PRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQEKMI- 727
            PRGFNLYYSPSY FIK+P + T+   T KAT              +VASC+KLEQ+KMI 
Sbjct: 708  PRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMIS 767

Query: 728  --LENYSNTKN---CSTEEDLDREV-TPDDVYEIWCEESAFERMIYLNKEVAWRLMDEML 781
              L  ++  K+      E+D D ++ TPDD+Y++W EES FERM+YLN++VAWRLMDEML
Sbjct: 768  KELLKHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEML 827

Query: 782  MCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDK 841
            MCNGYRRVL+WFITHME+NHSL+ YIFELVMGLRG          D    LL + M    
Sbjct: 828  MCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQV 887

Query: 842  KGSEKV------PFSRQGSIILSEIETKMLLQEFFTNAAIFFST---------NDTANMS 886
            K  E V      PFSRQG +ILSEIE KMLLQEFFTNAAI+FS+         ND     
Sbjct: 888  KNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNEGTTNNDNGEGI 947

Query: 887  SNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELF 946
              ++ N S+Y+ GLVKLICFMV++LM N+KFDF+KSECTFELQTLLMNWIGIIPEA++LF
Sbjct: 948  DEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLF 1007

Query: 947  FTLKANVGEPSMEGKSDSDGTD---------SNEGEL-----------------SWYNSK 980
            FTLK+ V   S +   +SD  D         S++G+                  S +N +
Sbjct: 1008 FTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKR 1067

Query: 981  LLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILL 1040
            L++LLP   N   EN A+ TLR F+++YSF  + PV GRKV+Y D+ +LP+P   QPI  
Sbjct: 1068 LVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISF 1127

Query: 1041 RELIDE 1046
             E + E
Sbjct: 1128 HEYLTE 1133

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1069 (44%), Positives = 640/1069 (59%), Gaps = 82/1069 (7%)

Query: 52   VLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQSN 111
            +LLE L+I+LFTT SG S L ++      S L +R  SW +S   + +  Y    L   +
Sbjct: 69   LLLEALIITLFTTISGKSALRLIQT----SSLKER-KSWAQSFENN-SSSYASIVLSWKD 122

Query: 112  RNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXXDF 171
             +  L +F +FLL N+  P  +N Y+L +YKL L                        D+
Sbjct: 123  NDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLS-FLIVSKITIPSILLNETYNLLKDY 181

Query: 172  IMFFQPYMNDLISYIVEGNK----FFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRYL 227
            +      +  LIS     +K      +I+  YNR+ E   F+ WY+    +  ++     
Sbjct: 182  LYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLT---F 238

Query: 228  NDVLSIDPMITDQ--FTSNYRDKAFQESEETLLMSQQQTAKD-DIIFSFDLNETG--DLP 282
            +D +S+  M  D+    S   D  F   ++       +T  D + I+SF+LN+ G  ++P
Sbjct: 239  SDNISL-LMENDEGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIP 297

Query: 283  NLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQL 342
            N+++HS +RH++++ ILNL  + +P L+ QF  +CGLVDPL QP PN++HIISID ++QL
Sbjct: 298  NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQL 357

Query: 343  FMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILN-DFPNDY 401
            F+GLM +         D     F +CFNMQKII  +++ LNC D+D L+++ N D    +
Sbjct: 358  FLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHW 417

Query: 402  KTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLV 461
            KT L++WLPHG+NTQDLEL             KLY  +PIQLNPFL +L+SLWK LS ++
Sbjct: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477

Query: 462  LIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFM 521
            L+ LEIDRIEE N TY+TP++VRATIRGAAALR+VIAT+LN  V   +HDFKHES NTFM
Sbjct: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537

Query: 522  SPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQ 581
            SP+GRKLC GAL ADLRSH A++LALG   + DVT+L ADLQ+GDRFDED++Y+F+YE +
Sbjct: 538  SPYGRKLCHGALYADLRSHTASLLALG-ASIEDVTDLFADLQSGDRFDEDIRYMFDYECE 596

Query: 582  DYNXXXXXXXXXXXXXXXXKRSVK----------KRRCNCIFEDDKMLEDYEYYEVGNES 631
            DY+                  + K          +RRCNCIF DDK++ +    E    +
Sbjct: 597  DYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGST 656

Query: 632  RREDMNLESDKSRT-----------------NPYSVRVNSIFEFDYSGKDWRDVPRGFNL 674
              E++      +R                  NP SVR  S FEFDYSG+DWRDVPR FN+
Sbjct: 657  NSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNM 716

Query: 675  YYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQEKMIL----EN 730
            YYSPSY FI  PKL  +   TL+  T            +SVASCV+ EQ++MIL     N
Sbjct: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESN 776

Query: 731  YSNTKNCSTE------------EDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMD 778
            +S + N   E            EDL R  TPDD+YEIW EESAFERM+ +N +VAWRLMD
Sbjct: 777  FSASINGDVEGEGNTKMSKIDNEDL-RRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMD 835

Query: 779  EMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMM 838
            EMLMC GYRR+L+WF+TH+E+ HSL++Y+FEL+MGLRG+         D+   ++ + + 
Sbjct: 836  EMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILK 895

Query: 839  TDKKGSEK--VPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSENVSLY 896
              +K  +   +PFSRQG I+LS+IETKMLLQEFF NAAIF S+       + D E +SLY
Sbjct: 896  KKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK-NNEEENEDGEKISLY 954

Query: 897  AIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVG-- 954
            ++GLV+LIC+MV+TL+ NDKF F+KSECTFELQTLLM WIGI+PEA++LFF +K  +   
Sbjct: 955  SLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAME 1014

Query: 955  -EPSM-----EGKSDSDGTDS-NEGELSWYNSKLLALLPS-PTNSGLENPAIETLRSFLK 1006
             E S      EG+ +SD     N    S  N KLL L PS P N    +P I TLRSF+ 
Sbjct: 1015 EEDSADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSP-INTLRSFIA 1073

Query: 1007 KYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELIDENFEEDDDGD 1055
             YSF  +V   GR+V++ D KILP+PK  +PI L E I     E D GD
Sbjct: 1074 DYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYI--TLAELDVGD 1120

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1070 (44%), Positives = 642/1070 (60%), Gaps = 101/1070 (9%)

Query: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLES-SSGDLNYKYLKHELWQ 109
            S+L E L I LFTTKSG SIL  +      +   +    W +S    D NY  +    W+
Sbjct: 68   SILFEALSIILFTTKSGKSILQAVQ-----ASTLKEKKLWAQSLRDDDSNYASVVQG-WK 121

Query: 110  SNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXX 169
             N +    +F +FLL N+     ++ Y+L +YKL L                        
Sbjct: 122  DN-DVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLS-----FLIVSKINFPSIILNEGH 175

Query: 170  DFIMFFQPYMNDLISYIVEGNKFF--------EIIAKYNRIYELNGFHTWYTLTIASNTS 221
            + +  +   M+  I  ++ GN           +I+  Y+RI E +  + WY+  + ++ +
Sbjct: 176  NMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVN 235

Query: 222  IAVRYLNDVLSIDP-------MITDQFTSNYRDKAFQESEETLLMSQQQTAKD-DIIFSF 273
                   D+L   P       +I D+  S   D   + ++ T++   ++T  D + I+SF
Sbjct: 236  FEFSDNFDLLMNSPEDHADGGVIDDRCKS---DNPQKHAKNTII---KRTINDQEQIYSF 289

Query: 274  DLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNE 331
            +L++ G L  PN+++HS MRH++++ ILNL  + +P L+ QF  +CGLVDPL QP PN+E
Sbjct: 290  ELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDE 349

Query: 332  HIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLS 391
             +ISID ++QLF+GLMY    +     D     F  CFNMQKII  +++ LNC+D++ L+
Sbjct: 350  QVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLN 409

Query: 392  TILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTL 450
            ++ N D    ++T L+KWLPHG+NTQDLEL             KLY  +PIQLNPFL +L
Sbjct: 410  SVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSL 469

Query: 451  VSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEH 510
            +SLWK LS ++L+ LEIDRIEE N TY+TP++VRATIRGAAALR+VIA++LN  V + +H
Sbjct: 470  LSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDH 529

Query: 511  DFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDE 570
            DFKHES NTFMSP+GRKLC GAL ADLRSH A++LALG   + DVT+L ADLQ+GDRFDE
Sbjct: 530  DFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALG-ASIEDVTDLFADLQSGDRFDE 588

Query: 571  DVKYIFEYEYQDYNXXXXXXXXXXXXXXXXKRSVKK---------RRCNCIFEDDKMLED 621
            D++Y+F+YE +DYN                 R   K         RRCNCIF DDK++ +
Sbjct: 589  DIRYMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAE 648

Query: 622  ---YEYYEVGNESRRED--------------MNLESDKSRTNPYSVRVNSIFEFDYSGKD 664
                E +E+   S  E+               N     S  NP SVR  S FEFDYSG+D
Sbjct: 649  DGTNEAFEISGNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGED 708

Query: 665  WRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQE 724
            WRDVP+ FN+YYSPSY FI+ PKL  + + TL+  T             SVASCVK EQ+
Sbjct: 709  WRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQD 768

Query: 725  KMILENY---------------SNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLN 769
            +MIL +                SN    +  E+L R  TPDD+YEIW EESAFERM+ +N
Sbjct: 769  QMILSDLGSNFAEIDENPEAKSSNNITKTNNEEL-RRTTPDDIYEIWSEESAFERMLNVN 827

Query: 770  KEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRL 829
             +VAWRLMDEMLMC GYRR+L+WF+TH+E+ HSL++Y+FELVMGLRG+         DR 
Sbjct: 828  HDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDR- 886

Query: 830  KSLLLQDMMTDKKGSEKV---PFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMS 886
            K  ++ +++  K+ +E V   PFSRQG I+LS+IETKMLLQEFF NAAIF S+ +    +
Sbjct: 887  KDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEEN 946

Query: 887  SNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELF 946
             +  + +SLY++GLVKLIC+MV+TL+ NDKF F+KSECTFELQTLLM WIG++PEA++LF
Sbjct: 947  EDGEK-ISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLF 1005

Query: 947  FTLKANVGEPSMEGKSDSDGT---DSNEGEL---------SWYNSKLLALLPSPTNSGLE 994
            F +K  +   +ME  SD DG    D+ + E+         S  N KLL L PS      +
Sbjct: 1006 FQIKTRL---AMEEDSDKDGQQNDDNKDLEVERRPHTKSNSELNVKLLNLFPSNPAGNND 1062

Query: 995  NPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELI 1044
            N AI TLRSF+  Y F  ++   GRKV++ D KILP+ K  +PI L E I
Sbjct: 1063 NSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYI 1112

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1097 (42%), Positives = 659/1097 (60%), Gaps = 93/1097 (8%)

Query: 31   VENVNTI-NDLSSLLGQNNEPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNS 89
            VEN+  +  D + L  Q    S+L E L I+LFTT SG SIL  +    +     ++   
Sbjct: 47   VENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTS-----KKRKL 101

Query: 90   WLES-SSGDLNYKYLKHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRX 148
            W +S  + + NY  +    W+ N +  L +F +FLL N+ +P  ++ Y+L ++KL L   
Sbjct: 102  WAQSFENNNSNYASIVFS-WKDN-DILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLS-F 158

Query: 149  XXXXXXXXXXXXXXXXXXXXXDFIMFFQPYMNDLISYIVEGNKFFEIIAK----YNRIYE 204
                                 D++      + +L+    + N+   ++ +    Y+R+ E
Sbjct: 159  LIVSKINIPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIE 218

Query: 205  LNGFHTWYTLTIASNTSIAVRYLNDVLSIDPMITDQFTSN------YRDKAFQESEETLL 258
                + WY     +  S  +++ +++  +  M ++  T N        +  + +  + ++
Sbjct: 219  CENCYCWYYFN--AENSAHLKFDDNIACL--MGSENNTENGLGDSRVNNNNYHKQPKDVV 274

Query: 259  MSQQQTAKDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLI 316
            MS+    ++ I +SF+LN  G  ++PN++KHS +RH++++ ILNL  + +P L+ QF  +
Sbjct: 275  MSRTINDQEQI-YSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFSTL 333

Query: 317  CGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIIS 376
            CGLVDPL QP PN++HIISID +++LF+GLMY    +     D     F  CFNMQKII 
Sbjct: 334  CGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIID 393

Query: 377  RSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKL 435
             ++  LNC D++ L+++ N D    ++T L++WLPHG+NTQDLEL             KL
Sbjct: 394  ATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKL 453

Query: 436  YSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRA 495
            Y  LPIQLNPFL +L+SLWK LS ++L+ LEIDRIEE N TY+TP++VRATIRGAAALR+
Sbjct: 454  YEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRS 513

Query: 496  VIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDV 555
            VIATILN  V T EHDFKHES NTFMSP+GRKL  GAL ADLRSH+A++LA G   + DV
Sbjct: 514  VIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTS-IEDV 572

Query: 556  TELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXXKRSVK---------- 605
            T+L ADLQ+GDRFDED++Y+F+YE  DY+                    K          
Sbjct: 573  TDLFADLQSGDRFDEDIRYMFDYECADYDESFSESDDEGLEEGIVNAREKIKSSNDNNVF 632

Query: 606  -KRRCNCIFEDDKMLEDYEYYEV--------GNESRREDMNLESDKSRT---------NP 647
             +RRCNCIF DDK++ +    EV        G    R ++++ S+ + T         NP
Sbjct: 633  CQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINP 692

Query: 648  YSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXX 707
            +SVR  S FEFDYSG+DWRDVPR FN+YYSPSY FI +PKL  + + TL+  T       
Sbjct: 693  FSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREE 752

Query: 708  XXXXXQSVASCVKLEQEKMIL--------------ENYSNTKNCSTEEDLDREVTPDDVY 753
                 +SVASCVK EQ++M+L              E  ++T    T+ +  R  TPDD+Y
Sbjct: 753  SILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIY 812

Query: 754  EIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMG 813
            EIW EESAFERM+ +N +VAWRLMDEMLMC GYRR+L+WF TH+E+ HSL++Y+FEL+MG
Sbjct: 813  EIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMG 872

Query: 814  LRGQRDDSRNPGDDRLKSLLLQDMMTDKKG--SEKVPFSRQGSIILSEIETKMLLQEFFT 871
            LRG+    +    D+   ++ + +   +K   +  +PFSRQG IILS+IETKMLLQEFF 
Sbjct: 873  LRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFM 932

Query: 872  NAAIFFSTNDTANMSSNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTL 931
            NAAIF S+N  +   + D E +SLY++GLV+LIC+MV+TL+ NDKF F+KSECTFELQTL
Sbjct: 933  NAAIFLSSN-NSEEENEDGEKISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTL 991

Query: 932  LMNWIGIIPEAQELFFTLKANVGEPSMEGKSDSDGTDSNEGELSWYNSKLLALLPS---- 987
            LM WIGI+PEA++LFF +K  +   +ME  +D+ GT  +EG  S    K L   P+    
Sbjct: 992  LMTWIGILPEAKDLFFEIKTRL---AMEEDNDT-GTMQHEGRRSLDIEKKLNTKPASKLN 1047

Query: 988  -------PTNSG--LENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPI 1038
                   P+NS    EN AI TLR+F+  YSF  +V   GRKV++ D KILP+ K  +PI
Sbjct: 1048 LKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPI 1107

Query: 1039 LLRELIDENFEEDDDGD 1055
             L E I     E D GD
Sbjct: 1108 PLHEYI--TLAELDVGD 1122

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1053 (44%), Positives = 629/1053 (59%), Gaps = 95/1053 (9%)

Query: 50   PSVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQ 109
            PS++ E L+I+LFTT++G S+L + +       +  R   W                   
Sbjct: 47   PSLICETLIIALFTTRAGISLLPLFSESAKRKRVGPRVLEW------------------- 87

Query: 110  SNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXX 169
             N    + +F  ++L+N         +   ++KL L                        
Sbjct: 88   HNDEELMLRFFSYILENRSSRIEPRLFEKARWKLPL-FFLIESKFLAASMVLDQNYNLLL 146

Query: 170  DFIMFFQPYMNDLI-SYIVEGNKFFEIIAKYNRIYELNGFHTWYTL-TIASNTSIAVRYL 227
            D++    P +   +     +G  F + +  YNR+YEL     WY+  T  SN     R +
Sbjct: 147  DYVHTITPMIKRWVHRAFTQGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEE--RRAI 204

Query: 228  NDVLSIDPMITDQFTSNYRDKAFQESEETL---LMSQQQTAKDDIIFSFDLNETGDL--P 282
               L  +   ++Q    Y +     +E  +        + ++ + ++SFD+N+ G L  P
Sbjct: 205  QQFLREN---SEQVLDTYHEMVRPSNERAINDTASYHHRISQHENVYSFDINQDGSLEIP 261

Query: 283  NLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQL 342
            N++ H+ +RH I+ +++ L   DSP L+ QF L+ GLVDPLTQP PN++HIIS+DL+YQ+
Sbjct: 262  NIMSHASVRHDILQNLMRLPLCDSPLLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQM 321

Query: 343  FMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILN-DFPNDY 401
             +GLM    +N L G D     F +CFNMQKII  SL  LN  D+DTL++I N D    +
Sbjct: 322  LLGLMEPAISNTL-GSDGCDWKFHLCFNMQKIIQASLKRLNLQDFDTLNSINNSDEDVSW 380

Query: 402  KTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLV 461
            +  L+ WLPHG+NTQ+LEL             KLY +LP+QLNPFL  ++SLWK L+ ++
Sbjct: 381  RDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVI 440

Query: 462  LIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFM 521
            L+GLEIDR EE +ET++TP++VRATIRGAAALRAV+ATILN HV T +HDF HE  NTFM
Sbjct: 441  LLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFM 500

Query: 522  SPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQ 581
            SPHGRKLC GAL ADLRSHAAA+LALG  EL DVT LLADLQAGDRFDEDV+Y+FEYE  
Sbjct: 501  SPHGRKLCQGALYADLRSHAAALLALG-TELEDVTNLLADLQAGDRFDEDVRYMFEYECD 559

Query: 582  DYNXXXXXXXXXXXXXXXXKRSVKKRRCNCIF-------------EDDKMLEDYEYYEVG 628
            +YN                 + + +RRCNCIF             E+D+    +  + + 
Sbjct: 560  NYNEGDSESEKDGKLAVEQPK-ILQRRCNCIFDDDEMAEDEDFDGENDEAF--FSKHLIL 616

Query: 629  NESRREDMNLESDKSRTNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKL 688
             ++ +  +++ S      P +VR    FEFDYSGKDWRD+PRG N YYSP +EFI++P L
Sbjct: 617  QQNAQTSLSMSSS---GKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSL 673

Query: 689  GTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQEKMILENYSNTKNCSTEEDLDR--- 745
             ++L  T KA++            +SVASCVK EQ+++ L N  +    S  ++  R   
Sbjct: 674  SSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGNLIDPHQDSQADEESRNAD 733

Query: 746  EVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVH 805
            ++ PDD+YE+WCE S FE+++Y N  +AW+LMDEML+C GYRRVL+WFITHME+NHSL+H
Sbjct: 734  KIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLIH 793

Query: 806  YIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDK-KGSEKVPFSRQGSIILSEIETKM 864
            YIFELVMGLRG  D+  N  D  L    LQD+  DK KG   V FSRQG++ LS IETKM
Sbjct: 794  YIFELVMGLRGNSDE--NDRDVDLAGPPLQDV--DKVKGELSVGFSRQGALQLSTIETKM 849

Query: 865  LLQEFFTNAAIFFS-----TNDTANMSSN--------DSENVSLYAIGLVKLICFMVKTL 911
            LLQEFFTNAAIF S     + D AN   N        +SENVSLYA+GL+KLICFMV+T 
Sbjct: 850  LLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMVRTF 909

Query: 912  MNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVG----------EPSMEGK 961
            +N +KFDFS+SEC FELQ LLMNWIGIIPEA+ LFF LK+ +           + + E K
Sbjct: 910  INKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTATSVQEQKNAEVK 969

Query: 962  SD---------SDGTDSNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTN 1012
            +D         S    SN      +N KL+ LLP    +  EN A++TLRSF+K  SF N
Sbjct: 970  NDTQEDVPKEQSPVRVSNTAGFE-FNRKLMTLLPPLVKNKEENAAMQTLRSFIKTSSFLN 1028

Query: 1013 KVPVVGRKVIYKDDKILPIPKLYQPILLRELID 1045
             VPV+GRK++Y+DDKILP+PK   P+ L E ID
Sbjct: 1029 TVPVIGRKIVYEDDKILPLPKSDVPLALHEYID 1061

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1078 (40%), Positives = 626/1078 (58%), Gaps = 144/1078 (13%)

Query: 53   LLEGLVISLFTTKSGHSILSVLNNPDAN--------SELFQRY-NSWLESSSGDLNYKYL 103
            LLE  V++LFTT  G  +  +L   D          S + Q+   +W E +     + + 
Sbjct: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEEALSKYIHLFF 70

Query: 104  KHELWQSNRNYYLSQFTK--FLLQ-NEQVPFHLNNYHL---TKYKLKLQRXXXXXXXXXX 157
            +H    +   + + Q+ +  F LQ ++  P   +   L   T Y + L            
Sbjct: 71   QHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLL------------ 118

Query: 158  XXXXXXXXXXXXDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIA 217
                        DF+   +P +  LI   V+G+    I+ KY R+YE + +  W+ L+  
Sbjct: 119  ------------DFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKK 166

Query: 218  SNTSIAVRYLN--------------------DVLSIDPMITDQFTSNYRDKAFQESEETL 257
               +  V  LN                    DV  + P + + F  N   K         
Sbjct: 167  KFANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVK--------- 217

Query: 258  LMSQQQTAKDDIIFSFDLNE-----TGD---LPNLIKHSEMRHQIIYDILNLNQIDSPFL 309
                QQ   ++ ++ FDL+E     +G+     +L++ S  RH+I+  +LNL +IDSP L
Sbjct: 218  ---YQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHL 274

Query: 310  KKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICF 369
             +QF  +  LVDPLTQP P++ +++S+DL+Y+LF+  + K  + E      +   F +CF
Sbjct: 275  YEQFKCMISLVDPLTQPPPSDTYVVSLDLLYKLFLAFLPKNQDTE------QNDTFLLCF 328

Query: 370  NMQKIISRSLVLLNCNDYDTLSTIL------NDFPNDYKTALNKWLPHGINTQDLELXXX 423
            NMQKII+R+L  L C DY  L++I       ++   +Y+  L +W+P+G+NTQDLEL   
Sbjct: 329  NMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYM 388

Query: 424  XXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIV 483
                        YS+LPIQLNPFL  L+SLWK LS ++L+ LE+DR EE+N+T+DTP++V
Sbjct: 389  VDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLV 448

Query: 484  RATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAA 543
            RATIRGA+ALRAV+A +LN HV   EHDFKHE  NTFMSPHGRKLC G+L ADLRSHAAA
Sbjct: 449  RATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAA 508

Query: 544  ILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXX---------------XX 588
            +L+LG  +L DVTELL+DLQ GDRFDED++Y+FEYEY+DYN                   
Sbjct: 509  MLSLG-VDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTAT 567

Query: 589  XXXXXXXXXXXXKRSVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKSRTNPY 648
                          + +KRRCNCIF DDK+++        +ES+   ++L   K+R  PY
Sbjct: 568  ASAAAITAANEGTGASQKRRCNCIFTDDKIIQ-------SDESK---VSLGGGKNR--PY 615

Query: 649  SVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXX 708
            SVR  S FEFDYSG DWRDVPRG NLY+ PSYEF+  P L    + + KA          
Sbjct: 616  SVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLNPMES 675

Query: 709  XXXXQSVASCVKLEQEKMILEN-YSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIY 767
                + VAS +K+EQE +I+   Y  T+  +  +D    +TPD++Y+ W ++  F+R+++
Sbjct: 676  QQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDD--GLLTPDNIYDAWFQDKVFDRILF 733

Query: 768  LNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDD 827
            +N+E+AW+LMDE+LMC+GYRRVL+WF+THME+NHS++HYIFELVMGLRGQ   +    ++
Sbjct: 734  MNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQELSADVTLEE 793

Query: 828  RLKSLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSS 887
            + K  L   M  D      + FSRQG++ LSEIE KMLLQEFFTNAAIF S +  +    
Sbjct: 794  QRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIFLSAS-ESEEPE 852

Query: 888  NDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFF 947
            +++ +VSLY+IGLVKLICFMVKTL+ N KF+FSKSECTFELQTLLMNW+GI+P+AQELFF
Sbjct: 853  SETSDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFF 912

Query: 948  TLKANV----------------GEPSMEGKSDSDGTDSNEG---ELSWYNSKLLALLPSP 988
             LK N+                G P     + +D  D N      LS +N KL+ LLP  
Sbjct: 913  LLKKNISDTKTATTTTTTTSALGAPGDIFPTLTDADDDNNAVAENLSEFNKKLVMLLPRA 972

Query: 989  TNSGLENP--AIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELI 1044
            T S  +    AI+ LR+F++K+S ++++PV+GR+++ +  +ILP     + + LRE +
Sbjct: 973  TQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYL 1030

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1113 (40%), Positives = 621/1113 (55%), Gaps = 139/1113 (12%)

Query: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESS--SGDLNYKYLKHELW 108
            +V+ E L++SLF T  GHSIL +  +          Y  W  S   S D   K +K   W
Sbjct: 47   AVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKR--W 104

Query: 109  QSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXX 168
             S     L +FT  LLQN+ VP     ++  +YKL L                       
Sbjct: 105  -STSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSL-------IFLLDKQNEFLILDPD 156

Query: 169  XDFIMFFQPYMNDLISYIVEGN---KFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVR 225
             + ++ +  +   +I  I+ GN       ++ +YN++ E NG HTWYT     + +  + 
Sbjct: 157  YNLLLDYLLHAKPMIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIF 216

Query: 226  Y-----LNDVLS------------------------IDPMITDQFTSNYRDKAFQESEET 256
            +     L D  +                        I P+  D +TS+     F E   T
Sbjct: 217  HKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWT 276

Query: 257  LLMSQQQTAKDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFL 314
                QQ+T   + ++SF+LNE G  ++PN+  H++ RH  +Y +L LN   +P LK  FL
Sbjct: 277  ----QQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCFL 332

Query: 315  LICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGK-DKELQHFTICFNMQK 373
              C L DP+TQP PN++HI+S+DL+  +F+GLMY     +L    +K+     ICFN+QK
Sbjct: 333  TFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQK 392

Query: 374  IISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXX 432
            II+ +L  LNC+D+  L+ I N D   D++  L KWLP G+NTQDLEL            
Sbjct: 393  IINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTI 452

Query: 433  XKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAA 492
             KLYSN PIQ+NPFL  ++SLWK L+ +VL+GLEIDR+EE  ET++TP++VRATIRGA+A
Sbjct: 453  YKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASA 512

Query: 493  LRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGEL 552
            LR+V+ATI+N H   K HDFKHE  N FMSPHGRKLC+GAL ADLRSHAA +LALG  EL
Sbjct: 513  LRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALG-IEL 571

Query: 553  HDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXXKRSVKK------ 606
              +T+LL+DLQ GDRFDEDVKY+F+YE+ DYN                 R   K      
Sbjct: 572  ETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYY 631

Query: 607  RRCNCIFEDDKMLED--------------YEYYEVGNESRREDMNLESDKSRTNPYSVRV 652
            +RC+C+F+DD ++ +               ++ +  +E +          + + P +VR 
Sbjct: 632  KRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRS 691

Query: 653  NSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXX 712
                EFD++G+DWRD+PRG N YY+ +Y F+       V +   +AT             
Sbjct: 692  RDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFIL 751

Query: 713  QSVASCVKLEQEKMIL---------ENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFE 763
            +S+A+CVKLEQE+ I+         +  SN     TE     E+T D +YE WCE+S FE
Sbjct: 752  RSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTE----NELTSDFIYEKWCEDSLFE 807

Query: 764  RMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRG----QRD 819
            +M+Y N ++ WR+MDEMLMC+GYRRVL+WFITH+EINHS++HYIFELVMGLRG    + D
Sbjct: 808  KMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDD 867

Query: 820  DSRNPGDDRLKSLLLQDMMTDKKGSE----KVPFSRQGSIILSEIETKMLLQEFFTNAAI 875
            + ++   D L  L         +GS      +PFSRQG IILS IE  MLLQEFFTNAAI
Sbjct: 868  EEKSKNLDALDGL--------AQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAI 919

Query: 876  FFSTNDTANMSSNDSE-----------NVSLYAIGLVKLICFMVKTLMNNDKFDFSKSEC 924
            FFS+    +  S + E           +V  + IGL+KL+CFMV TLM   KFDF+ SE 
Sbjct: 920  FFSSKLRESFDSENEELDENFEDEDEFSVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEY 979

Query: 925  TFELQTLLMNWIGIIPEAQELFFTLKANV----------GEPSMEG-KSDSDGTDSNE-- 971
             FELQTLLMNWIGI+PEA++LFF LK+ +          G P  E  K D D  D+ E  
Sbjct: 980  IFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESEKDDIDAPDTLEMN 1039

Query: 972  GELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPI 1031
              +S +N KL+ L+P  T +  E  A+  LR F+ KYS TNK  V GRK+IY+DD+I+ +
Sbjct: 1040 DTMSEHNKKLMMLIPPGTTN--ERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGM 1097

Query: 1032 PKLYQPILLREL-----IDEN------FEEDDD 1053
                + ++ RE      ID N      +EEDDD
Sbjct: 1098 YMTDKEMMYREFLAEFGIDYNDIVEGVYEEDDD 1130

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1161 (38%), Positives = 620/1161 (53%), Gaps = 171/1161 (14%)

Query: 44   LGQNNEPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYL 103
            +G  +  +++ E +V++LF T+SG+S+L +L +          Y   L+  S   N+ Y 
Sbjct: 39   VGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRS---NHSYW 95

Query: 104  K--HELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXX 161
            K  ++ W S R+  LS+F  F L+NE        Y     KL LQ               
Sbjct: 96   KSCYKDWGSRRDI-LSEFLDFCLRNENCALDYIEYASATRKLPLQ---FLLPEPLRPYLI 151

Query: 162  XXXXXXXXDFIMFFQPYMNDLISYIVEGNKFF-EIIAKYNRIYELNGFHTWYTLTIASNT 220
                    D+++  +P    L++  +   KF  E++ +YNR YE NG++ WY     S  
Sbjct: 152  DDEYNLLLDYMIQSRPMWEMLLTQGIP--KFLPELVDEYNRSYEFNGYYVWYGNVTCSQV 209

Query: 221  SIAVRY----------LNDVLSIDPMITDQFTSNYRDKAFQES----------------- 253
             +              L D L++   +  +        ++  S                 
Sbjct: 210  QVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTLLDLSNDDDDHY 269

Query: 254  -----EETLLMSQQQTAKDDIIFSFDLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDS 306
                  E     QQ+ +  + +F+FDLN  G L  PN+  H++ RH+I+Y +L L   + 
Sbjct: 270  DQDVDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEG 329

Query: 307  PFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFT 366
            P LK QF+ +  LVDP+TQP P  +HIISIDLI+Q+F+G       N L  + ++ + F 
Sbjct: 330  PLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWR-FH 388

Query: 367  ICFNMQKIISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXX 425
            +C+NMQKI+  ++  LNC+D D L+T+ N D    +   L+KW P G+NTQDLEL     
Sbjct: 389  VCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVD 448

Query: 426  XXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRA 485
                    +LYS LP+Q+NPFL   + LWK L++++L GLEIDR EE  ET++TPIIVRA
Sbjct: 449  MLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRA 508

Query: 486  TIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAIL 545
             IRG AALR+V+AT++NDH S+KEHDFKHE  N FMSPHGRKLC GAL AD+RSHAAA+L
Sbjct: 509  AIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAML 568

Query: 546  ALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXXK-RSV 604
            +LG  +L+DVT+LL+DLQ GDRFD+DVKY+F+YEY DYN                +   +
Sbjct: 569  SLG-IDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEI 627

Query: 605  KKR-----------RCNCIFEDDKMLEDYEYYEVGNES------RREDMNLES------- 640
            ++R           RC+C+F+DD++L D E  E  + +          +NL S       
Sbjct: 628  QQRERIKDMRGYYKRCHCVFDDDELLSDEEEGETASSNIDRPKYSHNSLNLPSSMLSTTF 687

Query: 641  DKSRTNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATT 700
            +   +  +++R     +FD++GKDWRD+PRG N YY+  Y F+       V +   +ATT
Sbjct: 688  NGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATT 747

Query: 701  XXXXXXXXXXXXQSVASCVKLEQEKMILENYSNT---KNCSTEEDLDR--EVTPDDVYEI 755
                        +S+A+C+KLEQEK ++ +  N    K  S+  + DR  E+T D +YE 
Sbjct: 748  KKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDFIYEK 807

Query: 756  WCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLR 815
            WCEES F +M+Y N ++ WR+MDEMLMC+GYRRVL+WFITH+EI+HSL+HYIFELVMG+R
Sbjct: 808  WCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMR 867

Query: 816  GQRDDSRNPGDD---RLKSLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTN 872
            G  D      DD   R   +L    +     + K+PFSRQG IILS IE  MLL EFF N
Sbjct: 868  GNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPIILSIIEINMLLLEFFIN 927

Query: 873  AAIFFSTN-------------DTANMSSNDSE------------NVSLYAIGLVKLICFM 907
            A I+FS N              + N  S+D E             VS + IGL+KL+CFM
Sbjct: 928  ATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFM 987

Query: 908  VKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVGEPSME---GKSDS 964
            V  LM   KFDF+ SE  FELQTLLMNWIGIIPEA+ LFF LK+++ E S +    KSD 
Sbjct: 988  VDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEASSQNDSSKSDK 1047

Query: 965  DGTDS----------NEGE----------------------------------------- 973
             GT++           EGE                                         
Sbjct: 1048 QGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLKLENVGS 1107

Query: 974  --------LSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKD 1025
                    LS YN  L+ LLP   ++  EN A+  LRSF+ K+S TNK  V GR+VIY+D
Sbjct: 1108 PEIDNNNNLSKYNKMLIELLPLHVDN--ENTAVTALRSFITKHSLTNKTAVFGRRVIYQD 1165

Query: 1026 DKILPIPKLYQPILLRELIDE 1046
              I+ +    + +  RE + E
Sbjct: 1166 HAIMGLYMADKEMRQREFLAE 1186

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/825 (46%), Positives = 520/825 (63%), Gaps = 70/825 (8%)

Query: 280  DLPNLIKHSEMRH----QIIYDILNLNQI-DSPFLKKQFLLICGLVDPLTQPQPNNEHII 334
            D P+L+  +  RH    ++I D     QI +SP L+ Q+  +  L+DPLTQP PN+ H+I
Sbjct: 297  DFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVI 356

Query: 335  SIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTIL 394
            SIDL+  +F+GLM  + +N+L   D     F ICFNMQ+II  SL +LNCND++ L T+ 
Sbjct: 357  SIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV- 415

Query: 395  NDFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLW 454
             D   D+++ L+ WLP G+NTQ+LEL             KLYS+ P+  NPFL +L+SLW
Sbjct: 416  -DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLW 474

Query: 455  KTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKH 514
            K+L+ +VL GL+IDR+EESN+++DTPIIVRATIRGAAALR+++AT+LN+ +  K HDF H
Sbjct: 475  KSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIH 534

Query: 515  ESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKY 574
            ES NTFMSPHGRKLC GAL ADL+++ A+ILALG  E  +VT+L++ LQAGD+FDEDVKY
Sbjct: 535  ESLNTFMSPHGRKLCDGALYADLKAYTASILALG-AEFQEVTDLVSYLQAGDQFDEDVKY 593

Query: 575  IFEYEYQDYNXXXXXXXXXXXXXXXXKRSVKKRRCNCIFEDDKMLEDYEYY--------- 625
            +FEYEY+DYN                  +  KRRCNCIF DD ++E+ E           
Sbjct: 594  MFEYEYEDYNEIYEDSSNENEENEEIDYAFNKRRCNCIFSDDNLIEEEEDDEEESDVEKT 653

Query: 626  -----EVGNESRRE-DMNLESDKSRTN----PYSVRVNSIFEFDYSGKDWRDVPRGFNLY 675
                 E+  +S+   +  +ESD   +N    P++VR  S FEFDYSGKDWRD+PR +NLY
Sbjct: 654  SDIDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLY 713

Query: 676  YSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQEKMILENYSNTK 735
            YSP Y FI  P L TV   TLKAT+             SVAS VK EQ++MI  N     
Sbjct: 714  YSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNLLEQD 773

Query: 736  NCST---EEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMW 792
              ST    ED  +E TPDD+YEIWCEESAFER+++ N ++AW+LMDEMLMC+GYRRVL+W
Sbjct: 774  KSSTADEHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIW 833

Query: 793  FITHMEINHSLVHYIFELVMGLRG--QRDDSRNPGDDRLKSLLLQDMMTDKKGSEKVPFS 850
            FITHME++HSL+ YIF+L+MG RG  + D S+N     +KS  + + ++D   S  + FS
Sbjct: 834  FITHMELSHSLIIYIFDLMMGSRGINKTDTSKN-----VKSTFITENISD-SNSNSLKFS 887

Query: 851  RQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSND-----------------SENV 893
            R G + LSE+ET+M+LQE FTNAAI+FS  D A  S+                       
Sbjct: 888  RMGHLKLSELETRMILQELFTNAAIYFS--DKARKSNQSILTPDYSTEEEEFDEENEGGY 945

Query: 894  SLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANV 953
            S+Y++GL+KLIC MV  L+ N KF+ ++S+C FELQTLLM WI I+PEA+EL F + +++
Sbjct: 946  SIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSL 1005

Query: 954  GE---------PSMEG---KSDSDGTDSNEGELSWYNSKLLALLPSPTNSGLENPAIETL 1001
             E          S+EG   KS     D N  E   YN  LL L+P       EN    T 
Sbjct: 1006 SEFSHVENSELASIEGASTKSHKQLVDKN-SESYKYNEILLKLIPPTFGGKEENIIFNTF 1064

Query: 1002 RSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELIDE 1046
            R ++K YSF ++V  + RK+I++ D+ILP+    +P    + + E
Sbjct: 1065 RDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLTE 1109

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1160 (37%), Positives = 615/1160 (53%), Gaps = 164/1160 (14%)

Query: 36   TINDLSSLLGQNNEPS---VLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLE 92
            +I  L  L  Q  +P    +++E +V++LF T+ G+SIL +L +          Y   L+
Sbjct: 28   SIQSLLELNVQEGDPHFELMIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLSEYRQSLK 87

Query: 93   SSSGDLNYKYLKHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXX 152
              S    +K    E W S R+  LS+F  F L+NE        Y     KL LQ      
Sbjct: 88   VRSNVHQWKTCYKE-WGSRRDT-LSRFLDFCLRNEDCALDYTEYGRVMRKLPLQ---FLL 142

Query: 153  XXXXXXXXXXXXXXXXXDFIMFFQPYMNDLISYIVEG--NKFFEIIAKYNRIYELNGFHT 210
                             D+I+  +    +L+   ++G      E+I  YNR++E NG++T
Sbjct: 143  PAGLHAYVLDEGYNLLLDYIINSRLMWEELL---IQGIPRLLPELIEDYNRVFEFNGYYT 199

Query: 211  WYT--------------------------LTIASNTSIAVRYLNDVLSIDPMI----TDQ 240
            WY                           LT+A      +       S  PM      ++
Sbjct: 200  WYGGAPSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHKHGINE 259

Query: 241  FTSNYRDKAFQESE-ETLLMSQQQTAKDDIIFSFDLNETGDL--PNLIKHSEMRHQIIYD 297
            F++   D    +SE E     Q +++  + +++F+LN  G L  PN+  H+  RH+ +Y 
Sbjct: 260  FSNEEEDLYDFDSELEGDSWPQHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHETLYR 319

Query: 298  ILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAG 357
            IL L   + P L+ QF+ +C LVDP+TQP P  +HIISIDLIYQ+F+G +     + L G
Sbjct: 320  ILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESSLRG 379

Query: 358  KDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQ 416
            +D     F +C N+QKII  ++  LNC+D + L++I N D    +   + KW P G+NTQ
Sbjct: 380  QD---WRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSDETVHWNVNIGKWTPRGLNTQ 436

Query: 417  DLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNET 476
            DLEL             +LYS+LP+Q+NPFL     LWK L++++L+GLEIDR EE  ET
Sbjct: 437  DLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRET 496

Query: 477  YDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLAD 536
            + TPIIVRATIRG+AALR+V+AT++N H S KEHDFKHE  N FMSPHGRKLC GAL AD
Sbjct: 497  FSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYAD 556

Query: 537  LRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXX 596
            +RSHAAA+LALG  EL+DVT+LL+DLQ GDRFD+DVKY+F+YEY DYN            
Sbjct: 557  VRSHAAAMLALGI-ELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENE 615

Query: 597  XXXXK-RSVKKR-----------RCNCIFEDDKMLEDYEYYEVGNES--------RREDM 636
                +   +++R           RC+C+F+DD++L D E  + G  +        +   +
Sbjct: 616  EDLERLEEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEGTDTGEHTDNHITETVQSAPL 675

Query: 637  NLESDKSRTNPYSVRVNS--IFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHF 694
            NL +  S + P  V V S    EFD++GKDWRD+PRG N YY   Y F+ N     VLH+
Sbjct: 676  NLVTGVSTSGPQKVAVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFV-NKLHADVLHY 734

Query: 695  TLK-ATTXXXXXXXXXXXXQSVASCVKLEQEK-----MILENYSNTKNCSTEEDLDREVT 748
             +K AT+            +SVA+C+KLEQEK      I ++   +   ++  +    +T
Sbjct: 735  LMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHDAIFKSKDKSPLSASGSEGSNGLT 794

Query: 749  PDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIF 808
             D +YE WCE++ FE+M+Y N ++ WR+MDEMLMC+GYRRVL+WFITH+E++HS++HYIF
Sbjct: 795  SDFIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIF 854

Query: 809  ELVMGLRGQ---RDDSRNPGDDRLKSLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKML 865
            ELVMG+RG    +D       +R   LL    +        +PFSRQG I+LS IE  ML
Sbjct: 855  ELVMGMRGNVAYKDLEEEYIINRNLDLLDSFSLGSSCIPASIPFSRQGPIVLSTIEVNML 914

Query: 866  LQEFFTNAAIFFST--NDTANMSSNDSE----------------------NVSLYAIGLV 901
            LQEFF NAAI+FS    DTA+    D E                        S + +GL+
Sbjct: 915  LQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLM 974

Query: 902  KLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANV-------- 953
            KL+CFMV  L+   K DF+ SE  FELQTLLMNWIG++PEA+ LFF LK+ +        
Sbjct: 975  KLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNG 1034

Query: 954  -------GEPSMEGKSDSDGTDS------------------------------------- 969
                   GE +     DS+  D+                                     
Sbjct: 1035 SALSHLEGELASNDNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAP 1094

Query: 970  ---NEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDD 1026
               +E  +S+ N  L+ LLP   +S  EN A+  LRSF+ K+  T K  + GR+VIY+D+
Sbjct: 1095 NGMSESNISYCNQMLIKLLPP--HSADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDN 1152

Query: 1027 KILPIPKLYQPILLRELIDE 1046
             I+ +    + +  RE + E
Sbjct: 1153 AIMGLYMADKELQQREFLAE 1172

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1070 (38%), Positives = 599/1070 (55%), Gaps = 117/1070 (10%)

Query: 45   GQNNEPSV-LLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLES---SSGDLNY 100
            G N+  S+ + E LVI LFTTK G SIL +            RY  W +S   S  D  Y
Sbjct: 37   GTNSYASLSIQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVY 96

Query: 101  KYLKHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXX 160
            K L  + W  + +Y +S   ++LL+N+       +++  +YKL +               
Sbjct: 97   KKLVKK-WTGSSDY-ISALMEYLLRNDSTSLDYVSFYSAEYKLSM---AFLLDQDTELLI 151

Query: 161  XXXXXXXXXDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLT---IA 217
                     DF++  +  + +L+S     +   +    ++R+++L+G + WYT +    A
Sbjct: 152  IDDEYNLLLDFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFA 211

Query: 218  SNTSIAVRYLN---DVLSID----PMITDQFTSNYRDKAFQESEETLLMS---------- 260
                I  +YL+   D L+      P I   F S    +    S+   L S          
Sbjct: 212  EAQDICYKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSD 271

Query: 261  -----QQQTAKDDIIFSFDLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDS-PFLKKQ 312
                 Q++ +  + I+SFDL + G L  PN+   +  RHQ +Y +L L Q +S P LK Q
Sbjct: 272  SDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQ 331

Query: 313  FLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQ---HFTICF 369
            F  +C LVDP+TQP PN+ HIISIDL+  +F+GL++         + K+L     F ICF
Sbjct: 332  FFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLH--------SEIKQLPFNWRFHICF 383

Query: 370  NMQKIISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXX 428
            N+QKI+  +L  LNC+D+  L+++ N D   D++  L+KWLP G+NTQDLEL        
Sbjct: 384  NLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILA 443

Query: 429  XXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIR 488
                 KLY + P+Q+NPFL +++SLWK L+ +VL+GLEIDR EE  ET+ TP++VRA IR
Sbjct: 444  IYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIR 503

Query: 489  GAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALG 548
            G++ALR+V+AT+LN HV  K HDF+HE  N FMSPHGRKLC GAL  D+RSHAAA+LALG
Sbjct: 504  GSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALG 563

Query: 549  DGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXXKRSVKK-- 606
              EL DVT LL+DLQ GDRFDEDVKY+F+YEY +YN                 R   K  
Sbjct: 564  -IELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELEDVESRERIKEM 622

Query: 607  ----RRCNCIFEDDKMLEDYEYYE---VGNESRREDMNLESDKSRTN---PYSVR-VNSI 655
                +RC+C F+DD++L + E      + +    +++  +++   +N   P ++R     
Sbjct: 623  RAYYKRCHCQFDDDELLPEEEEESGIPISHTRISKELPPDTNVKLSNTAKPVALRNKKDT 682

Query: 656  FEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSV 715
             EFD++G+DWRD+PRG N Y++ +Y+F K+ K G        A              + V
Sbjct: 683  IEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLV 742

Query: 716  ASCVKLEQEKMILENY-----SNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNK 770
            ++CV  EQE  +L +      S   +C +    D ++T D +YE WC++S F++M++ N+
Sbjct: 743  STCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNE 802

Query: 771  EVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLK 830
             + WR+MDEMLMC+GYRRVL+WFITH+E+  S++ YI+ LVMG RG++            
Sbjct: 803  TLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEK------------ 850

Query: 831  SLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDS 890
                  +  ++    K+PFSRQG I+LSEIE KMLLQEFFTNAAIFFS     ++   + 
Sbjct: 851  ------LANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDEEE 904

Query: 891  E-----NVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQEL 945
            E      +S Y +GL++L+CFMVK+L+  + FDF   +  FEL+TLLM+WI I+PEA++L
Sbjct: 905  EETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDL 964

Query: 946  FFTLKANVGEPSME-GKSDSDG---------------TDSNEG--------ELSWYNSKL 981
            FF L++ V + S +  K D D                TD N+G         +S YN KL
Sbjct: 965  FFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKL 1024

Query: 982  LALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPI 1031
            ++LLP     G EN A+  LRSF+ K+S T    V GR+VI  DD+I+ +
Sbjct: 1025 ISLLPPVV--GTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSM 1072

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1062 (38%), Positives = 586/1062 (55%), Gaps = 119/1062 (11%)

Query: 55   EGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSS---GDLNYKYLKHELWQSN 111
            E LV+ LFTT+ G S L +            RY  W +S      D  YK +    W S+
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKR-WTSS 109

Query: 112  RNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXXDF 171
              + +       L+N+       +++   +KL +                        DF
Sbjct: 110  TEH-VGLLMDHFLRNDNWALDYASFYSPAHKLSV---AFLLDPETEVLVIDDEYNLLLDF 165

Query: 172  IMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIAS---NTSIAVRYLN 228
             +  +  +  L++ I   +   +    + R+++L G + WYT +         I  +YL+
Sbjct: 166  ALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKYLS 225

Query: 229  ---DVLS--------IDPM---ITDQFTSN--YRDKAFQESEETLLMS------QQQTAK 266
               D L+        I P+   I+    S+  Y D  F E+ E+   S      Q++ + 
Sbjct: 226  VLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQKRLSA 285

Query: 267  DDIIFSFDLNETGDL--PNLIKHSEMRHQIIYDILNLN-QIDSPFLKKQFLLICGLVDPL 323
             + ++SFDL + G L   N+   +  RHQ +Y +LNL  Q  +P L  QF  +C LVDP+
Sbjct: 286  QERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCALVDPV 345

Query: 324  TQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLN 383
            TQP PN+ HI+SIDL+  +F+GL+Y    NEL    +    F +CFN+QKI+  +L  LN
Sbjct: 346  TQPTPNDSHIVSIDLLSDMFLGLLYS-EINELHIDWR----FHVCFNLQKIVQATLPRLN 400

Query: 384  CNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQ 442
            C+D+  L+++ N D   D++  L+KWLP G+NTQDLEL             KLY +LP Q
Sbjct: 401  CHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHKLYRDLPAQ 460

Query: 443  LNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILN 502
            +NPFL +++SLWK L+ +VL+GLEIDR EE  ET+ TP++VRA IRG++ALR+V+ATILN
Sbjct: 461  MNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATILN 520

Query: 503  DHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADL 562
             HV  K HDF+HE  N FMSPHGRKLC GAL  D+RSHAAA+LALG  EL DVT LL+DL
Sbjct: 521  GHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALG-IELEDVTNLLSDL 579

Query: 563  QAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXXKRSVKK------RRCNCIFEDD 616
            Q GDRFDEDVKY+F+YEY +YN                 R   K      +RC+C F+DD
Sbjct: 580  QPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKEMRAYYKRCHCQFDDD 639

Query: 617  KML--------EDYEYYEVGNESRREDMNLESDKSRTNPYSVRVNSIFEFDYSGKDWRDV 668
            ++L         D   Y V  ++  ++    S+ S+      + +S+ EFD++G+DWR +
Sbjct: 640  ELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNTSKPMALRSQKDSV-EFDFNGRDWRGI 698

Query: 669  PRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQE---- 724
            PRG N Y++ +YEF K+   G        A              + +A+CV  EQE    
Sbjct: 699  PRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQLLRVIATCVAKEQELTVL 758

Query: 725  --KMILENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLM 782
               ++L     ++N ST    D ++T D VYE WCE S FE++++ N+ + WR+MDEMLM
Sbjct: 759  RSALLLGETPESENHSTLV-ADGDLTTDFVYEKWCENSMFEKILFHNETLVWRMMDEMLM 817

Query: 783  CNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDKK 842
            C+GYRRVL+WFITH+E+++S++ YI+ LV+G RG++  + + GD                
Sbjct: 818  CSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRGEK--AASDGD---------------- 859

Query: 843  GSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANM----------SSNDSEN 892
               KVPFSRQG+I+LS+IE KMLLQEFFTNAAIFFS     ++                 
Sbjct: 860  -YAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAIFFSKQLRESLGDGEDDEDQGDDEKGSG 918

Query: 893  VSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKAN 952
            +S + +GL+KL+C+MVK+LM  + FDF   +  FELQTLLM+WI I+PEA++LFF L++ 
Sbjct: 919  ISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDYIFELQTLLMSWICILPEARDLFFALRSL 978

Query: 953  VGEPSMEGKSDSDGTDS-------NEGEL----------------SWYNSKLLALLPSPT 989
            V E S   K +S+   S       +E +L                S YN KL++LLP   
Sbjct: 979  VDEQSQNIKLESESIASACEPDSQSEPQLPQGTHAELEPEATHAVSIYNKKLMSLLPPA- 1037

Query: 990  NSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPI 1031
             +G EN AI  LRSF+ K+S T K  + GR+VI +DD I+P+
Sbjct: 1038 -AGTENSAITALRSFISKHSLTTKTALFGRRVISQDDTIMPM 1078

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/876 (43%), Positives = 539/876 (61%), Gaps = 120/876 (13%)

Query: 270  IFSFDLNETGDLP---NLIKHSEMRHQIIYDILNLNQIDS-PFLKKQFLLICGLVDPLTQ 325
            ++SFDLN  G +    NL+ +++ RHQI+  +LN N  DS P L+ QF L+ GLVDPL+Q
Sbjct: 397  VYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDPLSQ 456

Query: 326  PQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFT-ICFNMQKIISRSLVLLNC 384
            P PN++HIIS+DL+YQLF+ ++Y   N E+   +      T +CF M KII+  +  LNC
Sbjct: 457  PPPNDKHIISLDLLYQLFIAILYP--NFEIFQNNLGFNWKTHVCFQMVKIINNCMEKLNC 514

Query: 385  NDYDTLSTILNDFPND---------------------------YKTALNKWLPHGINTQD 417
            ND   L   L  F  +                           +++ L +WLPHG+NTQD
Sbjct: 515  NDLQKLYD-LTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQD 573

Query: 418  LELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETY 477
            LEL             KL   +PIQLNPFL TL++LWK L+ ++++GL+IDR EE++ETY
Sbjct: 574  LELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETY 633

Query: 478  DTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADL 537
             TP++V+ATIRGA+ALR+V+ATILN+++   +HDFKHE+ NTFMSPHGRKLC+GAL  D+
Sbjct: 634  KTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDI 693

Query: 538  RSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXXX 597
            +  AA++ ALG  +L ++  LL+ L+ GDRFDED+ Y+FEYEY DYN             
Sbjct: 694  KLFAASLYALG-MDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKT 752

Query: 598  XXX-------------KRSVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKS- 643
                            K    +RRCNCIFEDDK+L+D +      +   ++    + K+ 
Sbjct: 753  LKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNGDEQQGEQEEQEGTPKNV 812

Query: 644  ---------RTNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHF 694
                     R   Y+VR  + FEFDYSGKDWRD+PRGFN+YYS SY FI +  L T+++ 
Sbjct: 813  ASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINL 872

Query: 695  TLKATTXXXXXXXXXXXXQSVASCVKLEQEKMILEN--------YSNTKN--CSTEEDLD 744
            T KA+T            Q +AS +K EQ  MI+++        +SN  N   +++E+ +
Sbjct: 873  TSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSKEEKE 932

Query: 745  RE---VTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINH 801
            R     TPDD+++ W ++  F  M++ N+E++WRLMDEMLMCNGYRRVL+W+ITHM++NH
Sbjct: 933  RSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNH 992

Query: 802  SLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDKK--GSEKVPFSRQGSIILSE 859
            SL+ YIFEL+MGLRG    S    ++  K+ LL ++M  KK   +   PFSRQG +ILS+
Sbjct: 993  SLIQYIFELLMGLRG----SPFANNNECKNELLHELMLGKKIVDNHTYPFSRQGPLILSD 1048

Query: 860  IETKMLLQEFFTNAAIFFSTNDTAN-------------------MSSNDSENVSLYAIGL 900
            IETKMLLQEFF+NAAI+F  +   N                   + +N++  VS+Y++GL
Sbjct: 1049 IETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENNENHGVSMYSMGL 1108

Query: 901  VKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVGEP--SM 958
            +KLIC MV +L+ N KFDF+KS+C FELQTLLMNWIGI+ EA+ELFF LK+++ E   S 
Sbjct: 1109 MKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFFKLKSDIEETSEST 1168

Query: 959  EGKSDSD--------GTDSNE-------GELSWYNSKLLALLPSPTNSG---LENPAIET 1000
            +G  D D         ++SN        G+++ +N +LL LL +P +SG   L +  + T
Sbjct: 1169 DGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLLRLL-APIHSGDTDLNSDTVTT 1227

Query: 1001 -LRSFLKKYSFTNKV-PVVGRKVIYKDDKILPIPKL 1034
              R  LK YSFT+K   V GRKV+Y DD+ILP+PK+
Sbjct: 1228 PFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 67/168 (39%), Gaps = 21/168 (12%)

Query: 51  SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQS 110
           S++LE LVI+ FTTKSG SIL+ L +        Q               K L+ + W+ 
Sbjct: 115 SIMLETLVIAYFTTKSGQSILNYLFDTKRKPPTVQN--------------KILR-KTWEV 159

Query: 111 NRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXXXXXXXXD 170
           N   Y   F  FL++N+    +++ ++  + KL ++                        
Sbjct: 160 NEFLYFC-FIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNM 218

Query: 171 FIMFFQPYMNDLISYIVE-----GNKFFEIIAKYNRIYELNGFHTWYT 213
              +     N LI  I       G  F+  I +YNRI + NG   WYT
Sbjct: 219 LTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYT 266

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1249 (35%), Positives = 632/1249 (50%), Gaps = 275/1249 (22%)

Query: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWL-ESSSGDLNYKYLKHE--- 106
            S+L E L+++LFTT  G S+L++++   + +   Q+ N+ +  +++  ++ K+ K E   
Sbjct: 41   SLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLD 100

Query: 107  -------------------------------LWQSNRNYYLSQFTKFLLQNEQVPFHLNN 135
                                            W++++   L +FTKF+L+N   P + N 
Sbjct: 101  TTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDK-ITLLKFTKFILKNSNFPLNYNA 159

Query: 136  YHLTKYKLKLQ---------------RXXXXXXXXXXXXXXXXXXXXXXDFIMFFQPYMN 180
            +     KL L+                                      D++    P + 
Sbjct: 160  FFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLI 219

Query: 181  DLISYIVEGNKFFEIIAKYNRIYELNGFHT--WYTLTIASNTSI------AVRYLNDVLS 232
             L+   ++   F  II+ YN+ +EL   +   WY    + +T+        +  +N+ L 
Sbjct: 220  SLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINNFLE 279

Query: 233  IDPM---------ITDQF-----TSNYRDKAFQESEET---LLMSQQQTAKDDIIFSF-- 273
            I  M         I++       +S  +     E+E     LLM +    +  + F+   
Sbjct: 280  IFDMHKNFTLNAEISNSLFNISSSSTTKSNMHNENEGADLNLLMDENSMGEHTLSFNLFE 339

Query: 274  -DLNETGDLPNLIKHSEMRHQIIYDILNLNQID----SPFLKKQFLLICGLVDPLTQPQP 328
             ++N     P+L+ H   RH I+  ILN+   D    SP L  QF L+C LVDPLTQP P
Sbjct: 340  NNINHGILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTP 399

Query: 329  NNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYD 388
            N+++IISIDL++QLF+G +    +   + +D     F +CFNM+KII+  +  LNC D++
Sbjct: 400  NHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFN 459

Query: 389  TLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNPFL 447
            TL++I N D    ++T L+KWLP G NTQDLEL             KL  +LPIQLNPFL
Sbjct: 460  TLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFL 519

Query: 448  QTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVST 507
             ++VS WK LS  +L+GLEIDR+EE NET+DTP+IVRAT+R + ALR++IATILN+HV+ 
Sbjct: 520  SSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNA 579

Query: 508  KEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDR 567
              HDFKHES NTFMSP+GRKLC+GAL  D RSHA+ ILAL  G+L  VT+L++DLQ GDR
Sbjct: 580  FAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALT-GDLEHVTQLISDLQPGDR 638

Query: 568  FDEDVKYIFEYEYQDYNXXXXXXXXXXXXXXXX------------------------KRS 603
            FDEDVKY+FE+E  DYN                                        +R 
Sbjct: 639  FDEDVKYMFEFE--DYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPDNEENDERE 696

Query: 604  VKK------------RRCNCIFEDDKM----LEDYEYY---------------------- 625
            ++             RRCNCIF DD++    + D  Y                       
Sbjct: 697  IRNYLEQKLREMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSR 756

Query: 626  EVGNESRRED---------MNLESDKSRTN------------PYSVRVNS---------- 654
            + GN +  ED          NL  D+  +             P++VR ++          
Sbjct: 757  KGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTSNLNNNPSSVNN 816

Query: 655  -----IFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXX 709
                 IF+FDY+GKDWRD PRG NLYY+ +YEFI+ P L  V   TLKAT          
Sbjct: 817  KNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSN 876

Query: 710  XXXQSVASCVKLEQEKMILENYSNTKNC-------------------------STEEDLD 744
               + VAS VK EQ+++I  +   +K                             E+++ 
Sbjct: 877  LLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEII 936

Query: 745  REVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLV 804
             E+TPDD+YEIWCEESAFERM+ LN EV +RLMDEMLMC GYRRVL+WFITH+E++HS++
Sbjct: 937  TEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVI 996

Query: 805  HYIFELVMGLRGQRDDSRNPGDDRLKS-----------------LLLQDMMTDKKGSEKV 847
            HYIFELVMG RG  +++    D    +                 +LL D    K    ++
Sbjct: 997  HYIFELVMGFRGTSEENGATEDKHTNTKGNVNELENKNENELVNMLLNDY--SKIFDLQL 1054

Query: 848  PFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANM------------------SSND 889
            PFSRQG+I LSEIE KML+QEF TNAAI F  N+  N+                     D
Sbjct: 1055 PFSRQGNIELSEIERKMLIQEFLTNAAIHF--NERNNLKHNPNSNDNSNSNEDNINKDED 1112

Query: 890  SENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTL 949
             + +SLY+IGL++LICFM++  ++N+K      +  FELQTLLMNWI IIPEA++LFF +
Sbjct: 1113 EDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFQI 1172

Query: 950  KANVGEP--------------------SMEGKSDSDGTD-----SNEGELSWYNSKLLAL 984
            K  +                       ++E ++  D  D     S     S +N KL+ L
Sbjct: 1173 KDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSKDNNDKMDESSKVDSNSSFNKKLIEL 1232

Query: 985  LPSPTNSGL-ENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIP 1032
             P  +++   EN AI+TL+++LKK+ F  +VP++GRKVIY+D KIL IP
Sbjct: 1233 FPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKIP 1281

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/813 (41%), Positives = 491/813 (60%), Gaps = 57/813 (7%)

Query: 266  KDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQID--SPFLKKQFLLICGLVD 321
            ++++I SFD+NE G  ++PN++K S +RH I+++ L L+Q +  +P+L+ QF  + GLVD
Sbjct: 355  EEEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQRNTLAPYLEMQFKTLAGLVD 414

Query: 322  PLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTIC-FNMQKIISRSLV 380
            PLTQP PN+ HIISIDL++ L+ GL++       +GK +      +C FN+ KI+ +SL 
Sbjct: 415  PLTQPTPNDTHIISIDLLHGLYTGLVHPALIK--SGKARNYDWKYLCGFNLIKIVWKSLK 472

Query: 381  LLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNL 439
             L+C+ YDTL+ I N +  ND++  L  W+P  +NTQDLEL             KLY + 
Sbjct: 473  KLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNTQDLELLYMIDILSVYAIYKLYEDQ 532

Query: 440  PIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIAT 499
            PIQ NPFL  L S+WK ++ ++ +GL++DRIEE N++ +TP+++RAT+RGA+A RA + T
Sbjct: 533  PIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEETPLMIRATVRGASAFRAALTT 592

Query: 500  ILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELL 559
            ILN  +   EHDFKHE  NTFMSPHGRKLCSG+L AD+R  +  I      EL D+T LL
Sbjct: 593  ILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRV-STKIFVENGVELDDITNLL 651

Query: 560  ADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXXX---XXXXKRSVKKRRCNCIFEDD 616
             DLQ GDRFDEDV+Y+F+YEY+DYN                   + +   RRCNC+FEDD
Sbjct: 652  TDLQPGDRFDEDVEYMFDYEYEDYNLVSDSEDMDEKADNESDGVRPAPIFRRCNCVFEDD 711

Query: 617  KMLEDYEYYEVGNESRREDMNLESDK-------------SRTNPYSVRVNSIFEFDYSGK 663
            K++++     + ++S   DM LE++              S+  P++VR+ S F+F+Y GK
Sbjct: 712  KIMDE---STIDHQSLITDMELENNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGK 768

Query: 664  DWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXXXXXXXXXQSVASCVKLEQ 723
            DWRD+PRG NLYY+  + F++         +  KA              Q VASC++ EQ
Sbjct: 769  DWRDIPRGENLYYNGEFVFVQECSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQ 828

Query: 724  EKMILENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMC 783
            ++M++ +  +    +  +    ++T D++Y+     + F +M+Y + E+A  LMDE+LM 
Sbjct: 829  DRMVIYHGMSQLPLANGDVNKSKLTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMI 888

Query: 784  NGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDKKG 843
             GYRRVL+WF+TH+ I   L+HYIFELVMG R    D    GD+  KS            
Sbjct: 889  VGYRRVLIWFLTHINITFPLIHYIFELVMGYRVGFSDGDANGDNNKKS-----------S 937

Query: 844  SEKVPFSRQGSIILSEIETKMLLQEFFTNAAI-----FFSTNDTA-----NMSSNDSENV 893
            + K  FSR G++ LS IE +MLLQEFF NA +      F +N T      + +  D+E +
Sbjct: 938  TGKCGFSRLGTVALSSIEKQMLLQEFFLNATVSLSAKSFESNGTEIDNYDDNADEDNEYI 997

Query: 894  SLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANV 953
            S YA+G+V LIC MVKTL+   + D SKSE T ELQTLL+NWI +IPEA+ELFF LK   
Sbjct: 998  SSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQEA 1057

Query: 954  GE----PSMEGKSDSD-GTDSNEGELSWYNSKLL--ALLPSPTNSGLENPAIETLRSFLK 1006
             E     S+E  ++S+  T  N  E +  +S  L   +  S T+S   + A + L +FL+
Sbjct: 1058 HEFDIQDSLEPINESELQTSGNINEPAATDSIPLDDTINTSLTSSTKNSNATDALSTFLE 1117

Query: 1007 KYSFTN-KVPVVGRKVIYKDDKILPIPKLYQPI 1038
                T+ + P +GRKVIYK  KILP+P+  +PI
Sbjct: 1118 TVEETSVQPPQIGRKVIYKGTKILPLPEQERPI 1150

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 49  EPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELW 108
           E +   E L I+LFTTK G+ IL    N   +S +   +N   ++      Y++LK  LW
Sbjct: 112 EDNFFYELLTIALFTTKPGNKILHFFKNTGLDSAI--EHNDSDDTLFHSPAYEHLKM-LW 168

Query: 109 QSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKL 145
           +   + YL    +F+L+N  V   L NY  T YK  L
Sbjct: 169 KW-EDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPL 204

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  553 bits (1426), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 341/904 (37%), Positives = 508/904 (56%), Gaps = 88/904 (9%)

Query: 190  NKFF-EIIAKYNRIYELNGFHTWYTLTIASNTSIAVRYLNDVLSIDPMITDQFTSNYRDK 248
            N FF +II  Y R Y ++    + TL      S+   Y+        M+++ + S+  D 
Sbjct: 191  NSFFHKIIKLYKREYLVSA--EFLTLINVLTNSVLFSYI-------VMLSEGYISSNYDG 241

Query: 249  AFQESEETLLMSQQQTA-------KDDIIFSFDLNETGDLPNLIKHSEMRHQIIYDIL-- 299
               +S  T  + Q++         +   + + D N + DL   +K +E R  I+Y +L  
Sbjct: 242  LLYKSPPTYNVKQRENMMNSFGEFQSSAMLTNDENNSIDL---MKLTERRQNILYKVLIF 298

Query: 300  -NLNQIDSPFLKKQFLL---ICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNEL 355
              L QI+    +   LL   IC LVDPLTQP PN+EH+IS+DL+Y++F+ +M       +
Sbjct: 299  SKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYKIFLAMMLPHVQVLI 358

Query: 356  AGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILNDFPNDYKTALNKWLPHGINT 415
              +      + I  N+QKI+  + + LNC D + L+ +  D    +K  L+ WLPHG+N 
Sbjct: 359  ERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKV--DETKHWKEQLHLWLPHGLNP 416

Query: 416  QDLELXXXXXXXXXXXXXKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNE 475
            Q+LEL             KLY + P+  NPFL TL+S WK L++++L GL++DR EE NE
Sbjct: 417  QNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQVDRFEEENE 476

Query: 476  TYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLA 535
            +++TPI+VRATIRGA+ALR+V+A+ILN+ +  K+HDF+HE  NTFMSPHGRKLC+GAL A
Sbjct: 477  SFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRKLCTGALYA 536

Query: 536  DLRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNXXXXXXXXXXX 595
            DL+S+ A++LA G  E  D+TELL+ LQ GD FDEDVKY+FEYEY DYN           
Sbjct: 537  DLKSYTASMLACG-MEFKDITELLSYLQPGDCFDEDVKYMFEYEYDDYNEPEEDESDEDG 595

Query: 596  XXXXXKRSVK----KRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKSRTNPYSVR 651
                 + ++K    +RRC C+F DD +LE  ++    N++  E  N E + +  + + + 
Sbjct: 596  ERNNSEENIKFNFNRRRCRCVFSDDDVLEHGDF----NDANSEYSNSEENSNDVDNFVLP 651

Query: 652  VNSI------FEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXXX 705
             + I       EFD+ GKDWR VPR  N++YS  Y FI+NP    +     +A+      
Sbjct: 652  NDGIDKPKNGVEFDFDGKDWRAVPRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSK 711

Query: 706  XXXXXXXQSVASCVKLEQEKMILENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERM 765
                   +++AS +K+ Q+  IL +   + N +        ++  D+ ++      FE +
Sbjct: 712  KKSHLLLRNIASVIKINQDSRILGS-KRSPNGTDSSKSQNGLSTGDLIKLITAGDTFENI 770

Query: 766  IYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPG 825
            +  N+E+   LMDE+LM  GYRRVL+WF+TH+ ++H++++YIFEL+M  RGQ  D     
Sbjct: 771  LKFNRELGCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHRGQVSD----- 825

Query: 826  DDRLKSLLLQDMMTDKKGSE-KVPFSRQGSIILSEIETKMLLQEFFTNAAIFFST----- 879
                         T+++ SE    FSRQG + LS++E +MLLQEFFTNA +FFS+     
Sbjct: 826  -------------TEREQSELSYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLF 872

Query: 880  ------NDTANMSSNDSENV-SLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLL 932
                  N+  N   +  E + SLYA+GL+++ C M+ +L +N  FD S SE  FELQTLL
Sbjct: 873  ASDTGDNNEINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLL 932

Query: 933  MNWIGIIPEAQELFFTLKANV----GEPSMEGKS--------DSDGTDSNEGELSWYNSK 980
            M WI IIPEA+ LFF LK +V    G  + E KS             D N  E   +N K
Sbjct: 933  MGWINIIPEAKLLFFKLKESVKSFNGIDNPELKSIEESSTTTKKTTIDEN-SEQYRFNKK 991

Query: 981  LLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILL 1040
            LL   P   +    +  ++T + FL+ YSF ++ P +GRKVIY+ D+IL +  + +PI L
Sbjct: 992  LLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQLTDIEKPISL 1051

Query: 1041 RELI 1044
             + +
Sbjct: 1052 HKFL 1055

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  380 bits (977), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 310/1124 (27%), Positives = 513/1124 (45%), Gaps = 169/1124 (15%)

Query: 51   SVLLEGLVISLFTTKSGHSILSVL-------NNPDANSELFQRYNSWLESSSGDLNYKYL 103
            SVLLE LVI+LFTT  G ++++ L       N+ D    L +  + +  +  G       
Sbjct: 21   SVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVALFGT------ 74

Query: 104  KHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRXXXXXXXXXXXXXXXX 163
                W +++ + LS F  ++L+NE     L  Y    +K+ + R                
Sbjct: 75   ----WATDK-HILSLFLGWVLRNETDHIDLERYSDQSFKMAM-RFLLTNQDPKFTAPLWD 128

Query: 164  XXXXXXDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIA-----S 218
                  D++   +P +  ++  + +G++F + + KYNR+YE NG + W+T   +     S
Sbjct: 129  TSNILLDYLHNAKPLIESVLKKL-DGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAES 187

Query: 219  NTSIAVR----------YLNDVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQTAKDD 268
             T+I  R          + ND++     ++   T + R  + +   +    +    +K D
Sbjct: 188  PTTILERNSTFLSTLGNFGNDMVR---ALSQLKTGDIRLNSLESYGKNSGHNNPPLSKQD 244

Query: 269  IIFSFDLNETGDLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQP 328
                 +LN   D  NL           +  L L++   P L +QF  +C   DP+TQP P
Sbjct: 245  DHNPLNLNGKSDRFNL-----------FFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPP 293

Query: 329  NNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDY- 387
            N+ HIIS+DL++ L++G +  +   +L    +++    +  N++ I    L +L   DY 
Sbjct: 294  NDSHIISLDLLHDLYLGSLTAYIV-KLIPNYQKVWKIHLSANLETITLAILQMLQIWDYR 352

Query: 388  --DTLSTILNDFPNDYKTALNKWLPHGINTQDLELXXXXXXXXXXXXXKLYSNLPIQLNP 445
              D L  I    P+ Y   +  W+P+ ++  ++E+             K++S+ P +LNP
Sbjct: 353  SLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNP 412

Query: 446  FLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHV 505
            FL  ++  W+ LS  +++GL+IDR EE    Y TP+IV A IRGA+ALR++IATILN HV
Sbjct: 413  FLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHV 472

Query: 506  STKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAG 565
              K HDFKH+ F  FMSPHGRKLC+GAL      + AA+L  G  +  ++ ELL D+Q G
Sbjct: 473  DEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSG-MDYDEIVELLTDIQKG 531

Query: 566  DRFDEDVKYIFEYE---YQDYNXXXXXXXXXXXXXXXXKRSVKKR---------RCNCIF 613
            DR DEDV+Y+F+YE   Y D +                +   K R         RC C F
Sbjct: 532  DRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKF 591

Query: 614  ---------------------------EDDKMLEDYEYYEVGNESRREDM--NLESDKSR 644
                                       +++  + + E  +  +ES       +L + +  
Sbjct: 592  SDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDS 651

Query: 645  TNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTXXXX 704
             N +   + +   +D +G DWRD+PRG NLYY   Y+F+      ++     +       
Sbjct: 652  QNDFVSHLTT--GYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVT 709

Query: 705  XXXXXXXXQSVASCVKLEQEKMILENYSNTKNCSTEEDLDREVTP----DDVYEIWCEES 760
                    +S+A+CVKLEQE+++L+  +     +T  ++D +V P    + +  I+ ++ 
Sbjct: 710  FSQACTVLRSIATCVKLEQEQILLKLIT-----ATSAEVDLKVLPFSTDEVITAIFNDDG 764

Query: 761  AFERMIYL---NKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQ 817
               +       N  + W++ DE++M +G+RR+L++ +TH     S +HY++EL+ GLRG 
Sbjct: 765  GIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGN 824

Query: 818  RDDSRNPGDDRLKSLLLQDMMTDKKGSEKVP---FSRQGSIILSEIETKMLLQEFFT--- 871
               S +    + K L +    T     E+V    FSRQG I LS IE KMLLQEFF    
Sbjct: 825  PARSYDLESTKNKQLGILS-WTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVS 883

Query: 872  -------NAAIF--FSTNDTANMSSNDSENVSLYAI-------GLVKLICFMVKTLMNND 915
                   N A F  FS  + + +  +D       A        G VK++CF+++ ++N+ 
Sbjct: 884  SGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDK 943

Query: 916  KFDFSKSE-CTFELQTLLMNWIGIIPEAQELFFTLKA-------NVGEPSMEGKSDSDGT 967
            +F+F   E   +EL+  LM W     EA  ++  LK+       ++G   ++ + ++D  
Sbjct: 944  EFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPD 1003

Query: 968  DS---------------------------NEGELSWYNSKLLALLPSPTNSGLENPAIET 1000
            D                            N  + S  + +   +LP  +  G   P  + 
Sbjct: 1004 DQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDG--QPVDKV 1061

Query: 1001 LRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELI 1044
             R  L+KY  T   P+ GR  +   D ILP+       L RE +
Sbjct: 1062 FRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFL 1105

>KAFR0A06130 Chr1 (1241576..1244461) [2886 bp, 961 aa] {ON} Anc_4.221
            YLR373C
          Length = 961

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 969  SNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVI 1022
            +NE ELS+  SKLLA++ +  N  L       +R  L K SF N  P++ ++ I
Sbjct: 269  ANERELSFPTSKLLAIIIASENLSLSFGNNSVIRMLLSKNSFYNSNPIIIKESI 322

>NDAI0A02370 Chr1 complement(527490..530458,530577..530625) [3018
           bp, 1005 aa] {ON} Anc_7.272 YIL073C
          Length = 1005

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 16/109 (14%)

Query: 267 DDIIFSFDLNETGDLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQP 326
           D  +F+  L+   DLP       M  ++IY IL  N I +  +    L +C  ++   + 
Sbjct: 848 DTALFNITLDR-KDLP-----KGMFLEVIYVILKRN-IGNTIVDD--LTLCSWLNIYLET 898

Query: 327 QPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHF-----TICFN 370
             NNEHII+IDL+  +F+  + K N     G D+++        T+C+N
Sbjct: 899 CLNNEHIIAIDLVENIFV--VIKTNVRMTNGNDEQIMQVLEGVATLCWN 945

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,040,865
Number of extensions: 5489360
Number of successful extensions: 20743
Number of sequences better than 10.0: 35
Number of HSP's gapped: 21053
Number of HSP's successfully gapped: 49
Length of query: 1066
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 946
Effective length of database: 39,721,479
Effective search space: 37576519134
Effective search space used: 37576519134
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)