Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019903.495ON1511517981e-110
NCAS0E007803.495ON1711633765e-46
ZYRO0D09878g3.495ON1531543651e-44
TPHA0D042603.495ON1581483581e-43
KNAG0B007803.495ON1531543563e-43
Kpol_480.133.495ON1571533554e-43
NDAI0G009103.495ON1631583539e-43
TDEL0D056303.495ON1501503251e-38
TBLA0C045003.495ON1651553192e-37
KLTH0F14894g3.495ON1661573183e-37
SAKL0F02706g3.495ON1611543061e-35
AFR314W3.495ON1551563042e-35
Ecym_12343.495ON1611483025e-35
Suva_7.4213.495ON1651603001e-34
Kwal_55.212463.495ON1601572973e-34
Skud_7.4443.495ON1621552941e-33
CAGL0I10450g3.495ON1621572912e-33
Smik_6.2293.495ON1651602895e-33
YGR133W (PEX4)3.495ON1831552783e-31
KLLA0E04027g3.495ON1581542713e-30
YOR339C (UBC11)7.54ON1561092182e-22
Skud_15.5047.54ON1561392172e-22
Smik_15.5177.54ON1561262172e-22
Suva_8.3897.54ON1561092112e-21
Kpol_1065.127.54ON1591092094e-21
NDAI0E038707.54ON1641142095e-21
ABR059W2.569ON1651432052e-20
TDEL0H039707.54ON1561092033e-20
KAFR0A021602.569ON1651582027e-20
ZYRO0D04466g7.54ON1591252009e-20
Kwal_26.70097.54ON1611312019e-20
ZYRO0E06358g2.569ON1651432011e-19
TDEL0B065702.569ON1651412001e-19
SAKL0B10582g7.54ON1611092001e-19
NDAI0I016506.109ON1761031983e-19
CAGL0G08063g8.230ON1491091963e-19
KLLA0E07745g2.569ON1651431973e-19
KLTH0H06732g6.109ON1601281973e-19
KNAG0H029808.230ON152991954e-19
KLTH0D01760g7.54ON1611211957e-19
Kpol_1075.1b8.230ON152991947e-19
SAKL0D13552g2.569ON1651431948e-19
TDEL0B056701.436ON2031241961e-18
Suva_2.2183.308ON1481401921e-18
Skud_4.3143.308ON1481401921e-18
YDR059C (UBC5)3.308ON1481401921e-18
Kwal_56.234828.230ON1491271921e-18
NDAI0J015408.230ON154991931e-18
Kpol_1056.52.569ON1651431931e-18
TBLA0F024406.109ON1741361941e-18
TPHA0I024602.569ON1671431922e-18
Smik_4.2973.308ON1481401912e-18
CAGL0M07568g2.569ON1651431922e-18
Smik_13.1862.569ON1651431922e-18
TBLA0H026102.569ON1651431922e-18
KNAG0M021502.569ON1701431922e-18
Suva_13.1892.569ON1651431922e-18
YMR022W (UBC7)2.569ON1651431912e-18
NCAS0D032206.109ON1711031922e-18
Suva_2.2538.230ON143991902e-18
Skud_13.1762.569ON1651431913e-18
KNAG0H018701.436ON2101241943e-18
TDEL0A013408.230ON157991903e-18
SAKL0H17930g8.230ON153991903e-18
CAGL0I00352g6.109ON1671281913e-18
Kpol_461.86.109ON1671031913e-18
ZYRO0C04950g6.109ON1681281904e-18
Smik_7.2226.109ON1711031904e-18
Suva_7.2136.109ON1731031904e-18
KLLA0C05632g6.109ON1641361904e-18
TDEL0G036106.109ON1691031904e-18
Kwal_26.82242.569ON1651431904e-18
YGL058W (RAD6)6.109ON1721031904e-18
KNAG0F025706.109ON1511111894e-18
SAKL0A07260g6.109ON1691031904e-18
KAFR0A047006.109ON1531031894e-18
KLLA0E12563g3.308ON1481401884e-18
Ecym_30776.109ON1701031904e-18
AAR156C6.109ON1701031905e-18
KAFR0C002703.308ON1471401885e-18
Ecym_45782.569ON1651431895e-18
Kpol_1052.23.308ON1481401885e-18
Ecym_74313.308ON1471401885e-18
KLTH0E14300g3.308ON1471401885e-18
SAKL0B06512g3.308ON1471401885e-18
AER173C3.308ON1471401885e-18
KLTH0D07986g2.569ON1651431895e-18
ZYRO0E03806g1.436ON2091231925e-18
Kwal_14.18286.109ON1521051886e-18
KLTH0G14366g8.230ON149991876e-18
ZYRO0B11682g8.230ON1511231877e-18
Suva_4.3263.308ON1481081877e-18
CAGL0E04752g3.308ON1471401877e-18
NDAI0B015202.569ON1651511888e-18
Skud_4.3528.230ON143991868e-18
CAGL0M03399g1.436ON2141231918e-18
KNAG0J023403.308ON1611201878e-18
YDR092W (UBC13)8.230ON153991879e-18
TPHA0A038503.308ON1481401869e-18
TPHA0J017506.109ON1691031889e-18
Smik_4.3358.230ON143991869e-18
NCAS0B040108.230ON153991869e-18
Suva_5.531.436ON2151231901e-17
YEL012W (UBC8)1.436ON2181231901e-17
Skud_2.2073.308ON1481081861e-17
Smik_2.2193.308ON1481081861e-17
YBR082C (UBC4)3.308ON1481081861e-17
TDEL0F021003.308ON1471401861e-17
Smik_5.981.436ON2151231901e-17
ZYRO0G12870g3.308ON1471401851e-17
KLLA0C17622g8.230ON159991861e-17
NCAS0A108003.308ON1481331852e-17
NDAI0A054903.308ON1471331842e-17
TBLA0I021303.308ON1481401842e-17
Kwal_27.124013.308ON2361081882e-17
Skud_5.871.436ON2101231864e-17
Skud_7.2226.109ON1701031835e-17
TPHA0O009201.436ON2261231856e-17
KAFR0A024208.230ON147991816e-17
AGR121C8.230ON1541001816e-17
TPHA0B034108.230ON152991808e-17
NDAI0D011401.436ON2451191858e-17
NCAS0A127402.569ON1651431801e-16
TBLA0A012901.436ON2191241822e-16
Ecym_55638.230ON164991792e-16
KNAG0A048108.375ON2141251802e-16
Kpol_1030.181.436ON2231231803e-16
KLLA0A11198g1.436ON2021231793e-16
TBLA0F037908.230ON151991763e-16
NCAS0G031301.436ON2311121804e-16
Ecym_13481.436ON2111231794e-16
KAFR0H029601.436ON1871231767e-16
Skud_4.4418.375ON2151251778e-16
Suva_2.3438.375ON2151251778e-16
Smik_4.4258.375ON2151251778e-16
AEL045W1.436ON2111021769e-16
YDR177W (UBC1)8.375ON2151251761e-15
SAKL0D10560g1.436ON2071031761e-15
TBLA0H031308.375ON2141251752e-15
CAGL0E00671g8.375ON2131251742e-15
Kwal_34.161741.436ON2131031733e-15
KLTH0H13816g1.436ON2331021743e-15
TPHA0L008508.375ON2161241733e-15
NCAS0B031508.375ON2141251733e-15
KAFR0B060608.375ON2131251733e-15
Kpol_1030.108.375ON2151251716e-15
NDAI0A011608.375ON2161251716e-15
TDEL0F049908.375ON2171251691e-14
ZYRO0C03784g8.375ON2181251691e-14
ADR169C8.375ON2111081672e-14
SAKL0A00396g8.375ON2151251654e-14
Ecym_60388.375ON2111081654e-14
KLLA0C18656g8.375ON2281241647e-14
KLTH0A07546g8.375ON2151401612e-13
TPHA0B007704.249ON157991563e-13
Kwal_23.64858.375ON2151251585e-13
KLLA0C17248g4.49ON184911557e-13
Smik_4.1714.249ON157941485e-12
NCAS0A059404.49ON193991505e-12
KAFR0H012303.308ON110971456e-12
YDL064W (UBC9)4.249ON157941476e-12
Suva_4.1864.249ON157941468e-12
Skud_4.1914.249ON157941451e-11
TBLA0E015704.49ON1941051471e-11
KNAG0I029404.49ON197851462e-11
Smik_12.3894.49ON1871331452e-11
KNAG0D043904.249ON157991415e-11
CAGL0D06468g4.49ON1871491417e-11
CAGL0D00814g4.249ON1571001398e-11
Kpol_414.2singletonOFF192971419e-11
Kpol_YGOB_414.24.49ON193971411e-10
KAFR0F030404.49ON169871382e-10
KLLA0E05039g4.249ON1571241362e-10
KLTH0C04818g3.301ON2751131402e-10
Kpol_483.164.249ON122941342e-10
Kwal_27.104443.301ON278891403e-10
SAKL0H03058g4.249ON157941363e-10
KLTH0D14344g4.249ON157991345e-10
YLR306W (UBC12)4.49ON188831355e-10
Skud_12.3894.49ON1871091356e-10
Kwal_23.42274.249ON122941301e-09
KLLA0D09196g3.301ON292891361e-09
Ecym_83714.49ON267931351e-09
NDAI0A055303.301ON273891342e-09
ZYRO0B12386g4.249ON157941302e-09
Suva_10.4014.49ON1871211312e-09
AGL203C3.301ON270891332e-09
TDEL0D032603.301ON289891332e-09
NCAS0A107703.301ON273891332e-09
TDEL0E012204.249ON157971292e-09
NCAS0A024904.249ON157991292e-09
KNAG0H010403.301ON296891333e-09
Ecym_26693.301ON268891333e-09
SAKL0D02530g3.301ON272891333e-09
Suva_2.2113.301ON297891333e-09
Smik_4.2903.301ON297891333e-09
YDR054C (CDC34)3.301ON295891333e-09
ZYRO0G12650g3.301ON285891333e-09
Skud_4.3063.301ON297891333e-09
NDAI0D043804.249ON157971283e-09
AER056C4.249ON157941284e-09
CAGL0E04598g3.301ON295931314e-09
TBLA0G032703.301ON330891324e-09
Kpol_1065.453.301ON323891324e-09
NDAI0D029104.49ON189931295e-09
TPHA0M012803.301ON435891325e-09
KAFR0G032404.249ON157941275e-09
SAKL0H24112g4.49ON185731285e-09
Ecym_32704.249ON157941275e-09
KAFR0H012703.301ON287891306e-09
TBLA0I029604.249ON157941269e-09
TPHA0F003904.49ON1931151233e-08
NCAS0I014303.301ON258891243e-08
KLTH0H09504g4.49ON184801216e-08
TDEL0E055604.49ON187951217e-08
NDAI0A075703.301ON239891201e-07
ADL035C4.49ON200931182e-07
KNAG0J022803.301ON217821146e-07
NDAI0E041707.392ON2571141006e-05
ZYRO0G19910g4.49ON17981971e-04
KLLA0E20395g7.392ON251114972e-04
Kwal_27.111826.187ON10178905e-04
Skud_5.2257.392ON250114935e-04
ZYRO0B03344g7.392ON250116927e-04
Smik_5.2467.392ON250114910.001
NCAS0E026007.392ON255114910.001
YER100W (UBC6)7.392ON250114910.001
Kpol_1045.397.392ON253114900.001
KAFR0L017507.392ON251114900.002
NDAI0A016507.392ON251114890.002
KLTH0H04796g6.187ON138107860.002
Suva_5.2197.392ON249114880.002
AGR372W7.392ON242114880.002
TDEL0C015507.392ON248114870.003
ZYRO0G08228g6.187ON138107850.004
SAKL0F12474g7.392ON251115860.004
KLTH0C06688g7.392ON246116860.004
KNAG0B023607.392ON251114860.005
NCAS0A143907.392ON240114850.006
CAGL0H03157g6.187ON13978830.006
TPHA0J022506.187ON137116830.006
TPHA0K008207.392ON257114850.007
CAGL0I05478g7.392ON246116840.009
Kpol_1002.656.187ON10157800.012
Ecym_46837.392ON243114830.012
Kwal_27.108377.392ON246113830.012
SAKL0A05192g6.187ON140120810.013
YGL087C (MMS2)6.187ON137106810.013
TDEL0G015806.187ON138107810.014
KLLA0E19119g6.187ON13983810.014
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01990
         (151 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   311   e-110
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   149   5e-46
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   145   1e-44
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   142   1e-43
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   141   3e-43
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   141   4e-43
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   140   9e-43
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   129   1e-38
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   127   2e-37
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   127   3e-37
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   122   1e-35
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   121   2e-35
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   120   5e-35
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   120   1e-34
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   119   3e-34
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   117   1e-33
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   116   2e-33
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   115   5e-33
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   111   3e-31
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   108   3e-30
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    89   2e-22
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    88   2e-22
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    88   2e-22
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    86   2e-21
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    85   4e-21
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    85   5e-21
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    84   2e-20
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    83   3e-20
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    82   7e-20
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    82   9e-20
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    82   9e-20
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    82   1e-19
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    82   1e-19
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    82   1e-19
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      81   3e-19
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    80   3e-19
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    80   3e-19
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    80   3e-19
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    80   4e-19
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    80   7e-19
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    79   7e-19
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    79   8e-19
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    80   1e-18
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    79   1e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    79   1e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    79   1e-18
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    79   1e-18
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    79   1e-18
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    79   1e-18
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    79   1e-18
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    79   2e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    78   2e-18
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    79   2e-18
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    79   2e-18
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    79   2e-18
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    79   2e-18
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    79   2e-18
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    78   2e-18
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      79   2e-18
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    78   2e-18
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    78   3e-18
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    79   3e-18
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    78   3e-18
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    78   3e-18
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    78   3e-18
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    78   3e-18
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    78   4e-18
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    78   4e-18
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    78   4e-18
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    78   4e-18
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    78   4e-18
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    78   4e-18
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    78   4e-18
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    77   4e-18
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    78   4e-18
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    77   4e-18
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    77   4e-18
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    78   4e-18
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    78   5e-18
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    77   5e-18
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    77   5e-18
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    77   5e-18
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    77   5e-18
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    77   5e-18
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    77   5e-18
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    77   5e-18
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    77   5e-18
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    79   5e-18
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    77   6e-18
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    77   6e-18
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    77   7e-18
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    77   7e-18
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    77   7e-18
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    77   8e-18
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    76   8e-18
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    78   8e-18
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    77   8e-18
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    77   9e-18
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    76   9e-18
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    77   9e-18
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    76   9e-18
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    76   9e-18
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    78   1e-17
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    78   1e-17
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    76   1e-17
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    76   1e-17
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    76   1e-17
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    76   1e-17
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    78   1e-17
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    76   1e-17
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    76   1e-17
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    76   2e-17
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    75   2e-17
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    75   2e-17
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    77   2e-17
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    76   4e-17
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    75   5e-17
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    76   6e-17
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    74   6e-17
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    74   6e-17
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    74   8e-17
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    76   8e-17
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    74   1e-16
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    75   2e-16
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    74   2e-16
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    74   2e-16
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    74   3e-16
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    74   3e-16
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    72   3e-16
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                74   4e-16
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    74   4e-16
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    72   7e-16
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    73   8e-16
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    73   8e-16
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    73   8e-16
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    72   9e-16
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    72   1e-15
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    72   1e-15
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    72   2e-15
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    72   2e-15
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    71   3e-15
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    72   3e-15
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    71   3e-15
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      71   3e-15
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    71   3e-15
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    70   6e-15
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      70   6e-15
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    70   1e-14
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    70   1e-14
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    69   2e-14
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    68   4e-14
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    68   4e-14
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    68   7e-14
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    67   2e-13
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    65   3e-13
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    65   5e-13
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    64   7e-13
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    62   5e-12
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     62   5e-12
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    60   6e-12
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    61   6e-12
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    61   8e-12
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    60   1e-11
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    61   1e-11
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    61   2e-11
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    60   2e-11
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    59   5e-11
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    59   7e-11
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    58   8e-11
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    59   9e-11
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    59   1e-10
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    58   2e-10
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    57   2e-10
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    59   2e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    56   2e-10
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    59   3e-10
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    57   3e-10
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    56   5e-10
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    57   5e-10
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    57   6e-10
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    55   1e-09
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    57   1e-09
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    57   1e-09
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    56   2e-09
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    55   2e-09
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    55   2e-09
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    56   2e-09
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    56   2e-09
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    56   2e-09
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    54   2e-09
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    54   2e-09
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                56   3e-09
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    56   3e-09
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    56   3e-09
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    56   3e-09
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    56   3e-09
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    56   3e-09
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    56   3e-09
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    56   3e-09
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    54   3e-09
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    54   4e-09
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    55   4e-09
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    55   4e-09
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    55   4e-09
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       54   5e-09
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    55   5e-09
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    54   5e-09
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    54   5e-09
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    54   5e-09
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                55   6e-09
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    53   9e-09
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    52   3e-08
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                52   3e-08
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    51   6e-08
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    51   7e-08
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    51   1e-07
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    50   2e-07
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    49   6e-07
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    43   6e-05
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    42   1e-04
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    42   2e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    39   5e-04
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    40   5e-04
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    40   7e-04
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    40   0.001
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    40   0.001
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    40   0.001
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    39   0.001
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    39   0.002
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    39   0.002
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    38   0.002
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    39   0.002
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    39   0.002
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    38   0.003
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    37   0.004
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    38   0.004
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    38   0.004
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    38   0.005
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    37   0.006
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    37   0.006
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    37   0.006
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    37   0.007
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    37   0.009
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    35   0.012
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    37   0.012
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    37   0.012
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    36   0.013
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    36   0.013
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    36   0.014
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    36   0.014
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    36   0.019
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    35   0.022
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    35   0.027
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    34   0.048
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    34   0.067
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    33   0.072
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    33   0.11 
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    33   0.16 
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    32   0.27 
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    32   0.31 
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    30   0.60 

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  311 bits (798), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%)

Query: 1   MESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQT 60
           MESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQT
Sbjct: 1   MESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQT 60

Query: 61  YPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKS 120
           YPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKS
Sbjct: 61  YPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKS 120

Query: 121 PLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
           PLNLDLANLLRFDDLKAYHDLISYHLNNSAK
Sbjct: 121 PLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  149 bits (376), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 78/163 (47%), Positives = 108/163 (66%), Gaps = 16/163 (9%)

Query: 3   SRILKEYKDSRSLQS---------------QYILALDPISTDDLTHWECTIKGPLHSPFA 47
           SR+LKEYK  ++  S               Q I  L PIST DLTHW+  IKGP  +P+A
Sbjct: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61

Query: 48  NHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIV 106
           NH F+L+I+ P TYP+  PI  F+P +MPH NVNF+TG ICLDIL+  +W+P +N+   +
Sbjct: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121

Query: 107 EAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNS 149
           +AI  LL +P   SPLN+D+AN+LR +D  AY+ L++Y+L+ S
Sbjct: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  145 bits (365), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 104/154 (67%), Gaps = 10/154 (6%)

Query: 3   SRILKEYK-------DSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRI 55
           SR  KEYK       +   + SQ I+ ++P   +DLT WE  I+GP  +P+    F+L +
Sbjct: 2   SRAAKEYKTITKVLKEGDEVYSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNFRLHL 59

Query: 56  DIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL-DTNWSPVFNIQYIVEAIVWLLN 114
            +PQ YP++ P  KFEP+AMPH NV+F TGEICLDIL   +WSP +++ ++V+AI  LL+
Sbjct: 60  SLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLD 119

Query: 115 EPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNN 148
           EP   SPLN+D+AN+L+ +D+ AY+ L+ Y++ +
Sbjct: 120 EPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  142 bits (358), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 100/148 (67%), Gaps = 4/148 (2%)

Query: 4   RILKEYK---DSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQT 60
           R+LKE +      S  S+ I  L+P++ ++   W   +KGP+++P+  H+FKL I++P  
Sbjct: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64

Query: 61  YPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNFK 119
           YPL  P   FEP++MPH NV F TG+ICL+IL+  +WSPV+N+ Y++ A+  LL EP   
Sbjct: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124

Query: 120 SPLNLDLANLLRFDDLKAYHDLISYHLN 147
           SPLN+DLAN+LR  D  AYH LI+Y+L 
Sbjct: 125 SPLNIDLANILRAGDTSAYHGLINYYLQ 152

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  141 bits (356), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 7/154 (4%)

Query: 1   MESRILKEYKDSRSLQSQYILA----LDPISTDDLTHWECTIKGPLHSPFANHTFKLRID 56
           M  R+L+EY   R L +    A    L P    DLTHWE T++GP  +P+  H+F LR+ 
Sbjct: 1   MSQRVLREY---RRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
           +P  YP   P   F    MPHPNV ++TGE+CLD L   W+PV ++QY V A+  LL EP
Sbjct: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEP 117

Query: 117 NFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSA 150
           N +SPLNL+LA L R  D KAY  +I Y L +S+
Sbjct: 118 NPESPLNLELAALSRLGDHKAYDGIIKYRLAHSS 151

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  141 bits (355), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 100/153 (65%), Gaps = 4/153 (2%)

Query: 2   ESRILKEY---KDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58
           E R+LKEY   K         I +L+PI +DDLT+W  TI GP ++P+  H+F LRI + 
Sbjct: 3   ERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLT 62

Query: 59  QTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPN 117
             YPL  P   F  + MPH N+ F+TG+ICL+ILD  NWSPV+N+  +V AI  LL++P 
Sbjct: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPV 122

Query: 118 FKSPLNLDLANLLRFDDLKAYHDLISYHLNNSA 150
             SPLN+DL+N+L+  D  AY+ LI Y+LNN +
Sbjct: 123 TDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  140 bits (353), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 80/158 (50%), Positives = 105/158 (66%), Gaps = 13/158 (8%)

Query: 3   SRILKEYK-------DSRSLQ----SQYILALDPISTD-DLTHWECTIKGPLHSPFANHT 50
           SRI+KEYK       ++R+ Q    +  I++L PI  D DLT WE  IKGP  +P+    
Sbjct: 2   SRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFN 61

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN-WSPVFNIQYIVEAI 109
           F L I IPQ YP   P  +F+P +MPH NVN+ TGEICLDIL  + W+PV+N+   ++AI
Sbjct: 62  FILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAI 121

Query: 110 VWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
             LL +P  +SPLN+DLANLLRF DL AY+ LI+Y+LN
Sbjct: 122 WLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  129 bits (325), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 100/150 (66%), Gaps = 5/150 (3%)

Query: 3   SRILKEYKDSRSL---QSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQ 59
           +RI +EYK  ++    +S  +++L+PI   DL+ W   I+GP  +P+  HTF LR+ +  
Sbjct: 2   ARIAREYKHIQATLGSESSLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60

Query: 60  TYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNF 118
            YP T P   F   +MPH NVN+ETG ICL+IL   +WSP +++ +++EAI+ LL++P  
Sbjct: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120

Query: 119 KSPLNLDLANLLRFDDLKAYHDLISYHLNN 148
            SPL++DLAN+LR  D  AY+ L++Y+L +
Sbjct: 121 DSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  127 bits (319), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 98/155 (63%), Gaps = 6/155 (3%)

Query: 3   SRILKEYKDSRSLQS--QYILALDPIS--TDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58
           SRI+KEY   R L +    +  L P+S  T DL++W   I GP  SP+ N +F L I IP
Sbjct: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61

Query: 59  QTYPLTTPICKFEPFAMP-HPNVNFETGEICLDIL-DTNWSPVFNIQYIVEAIVWLLNEP 116
             YP   P+ KF   ++P H NVNF TGEICL+IL + NWSPV+N+ Y V+AI+ LL  P
Sbjct: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121

Query: 117 NFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
           +  SPLN+DL+ LL   D KAY+ LI Y+L N  K
Sbjct: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPK 156

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  127 bits (318), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (61%), Gaps = 6/157 (3%)

Query: 1   MESRILKEYKD-----SRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRI 55
           M  R+ KEY+       R  +  YI++L P+S ++L  WE  I GP  +P+  H F L+I
Sbjct: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60

Query: 56  DIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLN 114
           +  + YPL  P  +F+   MPH NV+F++G ICL +LD  +W+P +++ ++V AI  LL 
Sbjct: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120

Query: 115 EPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
            P   SPL++DLA L+R  D  A++ LI+Y+LN  ++
Sbjct: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSR 157

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  122 bits (306), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 98/154 (63%), Gaps = 9/154 (5%)

Query: 3   SRILKEYKDSRSLQSQ-----YILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDI 57
            RI KE+K  R   ++     +IL L+P  T ++ HW   I GP  +P+A+  F L +++
Sbjct: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63

Query: 58  PQTYPLTTPICKFEPFA---MPHPNVNFETGEICLDILDT-NWSPVFNIQYIVEAIVWLL 113
           P  YPL  P  KF P +   + H NV+F+TGEICLDIL   +WSPV+++ +++ AI  LL
Sbjct: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123

Query: 114 NEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
            EP  +SPLN+D+AN+L+  DL+AY  LI Y++ 
Sbjct: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  121 bits (304), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 94/156 (60%), Gaps = 12/156 (7%)

Query: 4   RILKEYKDSRSLQSQY-----ILALDPISTD--DLTHWECTIKGPLHSPFANHTFKLRID 56
           RIL+EYK    LQ Q      +L+L P+  +  DL  WE   +GP ++P+A  TF LRI+
Sbjct: 3   RILREYK---QLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRIN 59

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNE 115
           +P+TYP   P C F P  + HPN+ + TGE+CLD+L    WSPV+N+  +VEAI  LL E
Sbjct: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119

Query: 116 PNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
           P   SPL++DL+ L    D  AY  +++Y L    +
Sbjct: 120 PGVDSPLDVDLSRLYT-TDRAAYDGVVNYRLRTRPQ 154

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  120 bits (302), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 92/148 (62%), Gaps = 5/148 (3%)

Query: 3   SRILKEYKDSR-SLQS-QYILALDPIS-TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQ 59
           SR+L EYK  R  LQS + IL L P      L+ WE    GP ++P+A+ TF L I+IP+
Sbjct: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69

Query: 60  TYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNF 118
            YP   P C+F P  + HPN+ + TGE+CLD+L    WSP++N+  +VEAI  LL EP  
Sbjct: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129

Query: 119 KSPLNLDLANLLRFDDLKAYHDLISYHL 146
            SPL++DLA L   D  +AY  L++Y L
Sbjct: 130 DSPLDVDLAKLYSVDK-QAYQGLVTYRL 156

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  120 bits (300), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 93/160 (58%), Gaps = 11/160 (6%)

Query: 3   SRILKEYKDSRSLQSQ----------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52
           SRI KEY+  R   +            I +L+P    DL+ WE TI GP H+P+  + F+
Sbjct: 2   SRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61

Query: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111
           + ID+P +YP+  P   FE  A+ H N+N  TGEICLDIL   +W+PV+++ + V A+  
Sbjct: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWR 121

Query: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
           LL EP   SPL++D+ N++R  D +AY  ++ Y L    +
Sbjct: 122 LLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERER 161

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  119 bits (297), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 1   MESRILKEYKDS-RSLQS----QYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRI 55
           M  R+ KEYK   ++L+      +I  L P+S D+L  WE  I GP  +P+  H F L I
Sbjct: 1   MSQRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60

Query: 56  DIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLN 114
            IP  YPL  P  +F    +PH NV+FE+G IC+++L+  +WSP +++ ++V AI  LL 
Sbjct: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLA 120

Query: 115 EPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
            P   SPL++DLA L R  D  A++ L++Y+LN  ++
Sbjct: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSR 157

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  117 bits (294), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 94/155 (60%), Gaps = 11/155 (7%)

Query: 3   SRILKEYKD-SRSLQSQ---------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52
           SRI KEY D  ++L S           I +L+PI   DL+ WE  I GP H+P+ ++ F+
Sbjct: 2   SRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFR 61

Query: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111
           + ID+P +YP+  P  +F+   + H N+   TGEICLDIL   +W+PV+++ + V AI  
Sbjct: 62  ILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWR 121

Query: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           LL EP + SPL++D+ N++R  D  AY  +I Y L
Sbjct: 122 LLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  116 bits (291), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 98/157 (62%), Gaps = 11/157 (7%)

Query: 3   SRILKEY-KDSRSLQ---SQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58
           +RI KE  K  ++L+   S++++ L P+   DL+ W   IKGP  +P+  + FKL I++P
Sbjct: 2   ARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVP 61

Query: 59  QTYPLTTPICKFEPFAM------PHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111
            +YP+  P  KF   A       PH NV+  TGEICLDIL    WSP+++I ++V+AI  
Sbjct: 62  ASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHI 121

Query: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNN 148
           LL EP   SPL++D+AN+L+ +D+ AY+ +I Y L  
Sbjct: 122 LLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  115 bits (289), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 93/160 (58%), Gaps = 11/160 (6%)

Query: 3   SRILKEYKDS-RSLQSQ---------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52
           SRI KEY+   ++L S           I +L+PI   DL+ WE  I GP H+P+ N+ F 
Sbjct: 2   SRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFH 61

Query: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111
           + ID+P +YP+T P   FE   + H NV   TGEICLDIL   +W+PV+++ + V A+  
Sbjct: 62  ILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWR 121

Query: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
           LL EP   SPL++D+ N++R  D  AY  ++ Y L    +
Sbjct: 122 LLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERER 161

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  111 bits (278), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 91/155 (58%), Gaps = 11/155 (7%)

Query: 3   SRILKEYKDS-RSLQSQ---------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52
           SRI+KEYK   ++L S           I +L+PI   DL+ WE  I GP  +P+ NH F+
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111
           + I++P +YP+  P   F    + H NV   TGEICL+IL    W+PV+++ + V A+  
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           LL EP   SPL++D+ N++R  D+ AY  ++ Y L
Sbjct: 140 LLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  108 bits (271), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 9/154 (5%)

Query: 3   SRILKEYKD-SRSLQS---QYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58
           SRI+KEY    + LQ+    +I  L P+  DDL+ W C  +GP  SPF      L I I 
Sbjct: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61

Query: 59  -QTYPLTT-PICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            + YP++  P   FEP  + HPNV ++TGEICLD+L   W+P++ +  +V AI  LL +P
Sbjct: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADP 121

Query: 117 NFKSPLNLDLANLLRFD-DLKAYHDLISYHLNNS 149
              SPL+LD+A +  +D D +AY  ++ Y L  +
Sbjct: 122 GLDSPLDLDIAQI--YDADYEAYVQIVRYRLEEA 153

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (60%), Gaps = 2/109 (1%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P+  +DLT+W   I GP  +P++   FK+ +  PQ YP   P+ KF    M HPNV+ ++
Sbjct: 32  PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLS-PMWHPNVD-KS 89

Query: 85  GEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFD 133
           G ICLDIL   WS V+N++ I+ ++  LL EPN +SPLN   A L   D
Sbjct: 90  GNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDAD 138

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 88.2 bits (217), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+  E     S  +Q I A  P+  +DLT+W   I GP  +P+++  FK+ ++ P+ YP 
Sbjct: 12  RLQNELLQLLSSTTQSIGAF-PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPF 70

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV+ ++G ICLDIL   WS V+N++ I+ ++  LL EPN +SPLN
Sbjct: 71  HPPKVKFVS-PMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

Query: 124 LDLANLLRFDDLKAYHDLI 142
              A L    D++ Y   +
Sbjct: 129 AVAAELWD-KDMEGYKKKV 146

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 88.2 bits (217), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+  E     S  +Q I A  P+  +DLT+W   I GP  +P++   FK+ ++ P+ YP 
Sbjct: 12  RLQNELLQLLSSATQSISAF-PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPF 70

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV+ ++G ICLDIL   WS V+N++ I+ ++  LL EPN KSPLN
Sbjct: 71  HPPKIKFVS-PMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNKSPLN 128

Query: 124 LDLANL 129
              A L
Sbjct: 129 AVAAEL 134

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 85.9 bits (211), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (60%), Gaps = 2/109 (1%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P   +DLT+W   I GP  +P+++  FK+ ++ P++YP   P  KF    M HPNV+  +
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFVS-PMWHPNVDM-S 89

Query: 85  GEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFD 133
           G ICLDIL   WS V+N++ I+ ++  LL EPN +SPLN   A L   D
Sbjct: 90  GNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDKD 138

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 85.1 bits (209), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 61/109 (55%), Gaps = 2/109 (1%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P   ++LT W  TI GP  SP+A   FK+ +  P  YP   P  KF    M HPNV+  +
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFVS-PMWHPNVDL-S 93

Query: 85  GEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFD 133
           G ICLD+L   WS V+N+Q I+ ++  LL EPN  SPLN   A L   D
Sbjct: 94  GNICLDVLKEKWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAELWDGD 142

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 85.1 bits (209), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P   +DLTHW   I GP  +P+    FKL      +YP   P+ KF    M HPNV+  +
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFIS-PMWHPNVDM-S 97

Query: 85  GEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAY 138
           G ICLDIL   WS V+N++ I+ ++  LL EPN  SPLN   A L   DD+  Y
Sbjct: 98  GNICLDILKDQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAELWD-DDMNEY 150

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 76/143 (53%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R++KE +         I+A  P+S D+L  W+C I+GP  SP+    F  R+  P+ Y
Sbjct: 6   QKRLMKELQQLLRDSPDGIVA-GPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPNV +  GE+C+ IL                WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 82.8 bits (203), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 59/109 (54%), Gaps = 2/109 (1%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P S DDLT W   I GP  +P+ N  F+L +     YP   P   F    M HPNV+  +
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFVS-PMWHPNVDM-S 90

Query: 85  GEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFD 133
           G ICLDIL   WS V+N+Q I+ ++  LL EPN  SPLN   A L   D
Sbjct: 91  GNICLDILKDQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAELWDTD 139

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 84/158 (53%), Gaps = 17/158 (10%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P + D++  W+C ++GP  SP+    F  ++D P+ Y
Sbjct: 6   QKRLLKELQQLMKDSPPGIVA-GPKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           ++ +L+EPN +S  N+D   L R D+ K +   +  ++
Sbjct: 123 VMSMLSEPNIESGANIDACILWR-DNRKEFERQVKLNI 159

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 81.6 bits (200), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 2/125 (1%)

Query: 21  LALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNV 80
           L+  P + DDL  W   I GP  +P+ +  FK+ +  P +YP   P  KF    M HPNV
Sbjct: 32  LSAFPNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFIS-PMWHPNV 90

Query: 81  NFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHD 140
           +  +G ICLDIL   WS V+N+Q I+ ++  L  EPN  SPLN   A L   D ++    
Sbjct: 91  DM-SGNICLDILKDQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAELWDKDMVEYKKR 149

Query: 141 LISYH 145
           L+S +
Sbjct: 150 LLSRY 154

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 82.0 bits (201), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 72/131 (54%), Gaps = 11/131 (8%)

Query: 12  SRSLQSQYI---------LALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYP 62
           ++ LQS+ +         L+  P S DDLT W   I GP  +P+    FK+ ++  QTYP
Sbjct: 16  TKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYP 75

Query: 63  LTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPL 122
            T P  +F    M HPNV+  +G ICLDIL   WS V+N+Q I+ ++  LL EPN  SPL
Sbjct: 76  YTAPKVRFVS-PMWHPNVDM-SGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 123 NLDLANLLRFD 133
           N   A L   D
Sbjct: 134 NAVAAELWDTD 144

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 78/143 (54%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +      S  I+A  P S +DL  W+C I+GP  +P+    F  +++ P+ Y
Sbjct: 6   QKRLLKELQQLMKDSSTGIVA-GPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNVESGANVDACILWR 145

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 76/141 (53%), Gaps = 16/141 (11%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+LKEY+         ILA  P S  +L  W+C I+GP  +P+    F  R+D P+ YPL
Sbjct: 8   RLLKEYQQLIRDPPPGILAA-PKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFPKDYPL 66

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEAIV 110
           + P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +++
Sbjct: 67  SPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVM 124

Query: 111 WLLNEPNFKSPLNLDLANLLR 131
            +L+EPN +S  N+D   L R
Sbjct: 125 SMLSEPNIESGANVDACILWR 145

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 21  LALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNV 80
           L+  P + DDLT W   I GP  +P+    FK+ +  PQ+YP T P   F    M HPNV
Sbjct: 34  LSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFVS-PMWHPNV 92

Query: 81  NFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANL 129
           +  +G ICLDIL   WS V+N+Q I+ ++  LL EPN  SPLN   A L
Sbjct: 93  DM-SGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 80.9 bits (198), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 61/103 (59%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP+  P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLS-EMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 80.1 bits (196), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+    FKL + +P+ YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKA 137
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A     D+ KA
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKA 136

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +       + ILA  PI   +L  W+C I GP  S +    F  R+D P+ Y
Sbjct: 6   QKRLLKELEKLTKDSPEGILA-SPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILDT-------------NWSPVFNIQYIVEA 108
           PL  P   F+P  + HPN+ +  GE+C+ IL +              WSPV +++ I+ +
Sbjct: 65  PLNPPKLTFQPSIL-HPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSILSEPNIESGANIDACILWR 145

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 8/128 (6%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+++++KD+    S   L       D++  W   I GP  +P+ + TF+L ++  + YP 
Sbjct: 8   RLMRDFKDAPPGVSASPLP------DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPN 61

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV +  GEICLDIL   W+P +++  I+ +I  L N+PN  SP N
Sbjct: 62  KPPHVKFL-SEMFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPAN 119

Query: 124 LDLANLLR 131
           ++ A L +
Sbjct: 120 VEAATLFK 127

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 79.7 bits (195), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L ++E T++GP+ SP+ N  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 67/121 (55%), Gaps = 2/121 (1%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P   +DLT W   I GP  +P+    FK+ ++  QTYP T P  +F    M HPNV+  +
Sbjct: 38  PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDM-S 95

Query: 85  GEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISY 144
           G ICLDIL   WS V+N+Q I+ ++  LL EPN  SPLN   A L   D  +    LI+ 
Sbjct: 96  GNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIAR 155

Query: 145 H 145
           +
Sbjct: 156 Y 156

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 79.3 bits (194), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L ++E TI+GP  SP+ N  F L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 79.3 bits (194), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +       + I+A  P S D+L  W+C I GP  SP+    F   ++ P+ Y
Sbjct: 6   QKRLLKELQQLARDSPEGIVA-GPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPRLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           +  +L+EPN +S  N+D   L R
Sbjct: 123 VTSMLSEPNVESGANIDACILWR 145

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 72/124 (58%), Gaps = 3/124 (2%)

Query: 28  TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEI 87
            D++  +    +GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G I
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGSI 72

Query: 88  CLDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           CLD++++ WSP+++++ IVE ++  LL EPN   PLN + A  L+  D K Y + I  ++
Sbjct: 73  CLDVINSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 131

Query: 147 NNSA 150
           +  A
Sbjct: 132 DKYA 135

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 6   RIAKELSD---------LGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N  +G ICLDIL   WSP   +  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDILKDQWSPALTLSKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A + + D  K
Sbjct: 115 NPDDPLVPEIAQIYKTDKAK 134

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 6   RIAKELSD---------LGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N  +G ICLDIL   WSP   +  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDILKDQWSPALTLSKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A + + D  K
Sbjct: 115 NPDDPLVPEIAQIYKTDKAK 134

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 6   RIAKELSD---------LGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N  +G ICLDIL   WSP   +  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDILKDQWSPALTLSKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A + + D  K
Sbjct: 115 NPDDPLVPEIAQIYKTDKAK 134

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 10/127 (7%)

Query: 9   YKDSR-SLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRIDIPQT 60
           Y +SR S Q    L  DP+         ++L +++ TI+GP  SP+ N  FKL + +P  
Sbjct: 2   YINSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDD 61

Query: 61  YPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKS 120
           YP+  P  +F    + HPN++   G ICLD+L TNWSP   I+ ++ ++  LL  PN   
Sbjct: 62  YPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPND 119

Query: 121 PLNLDLA 127
           PL  D+A
Sbjct: 120 PLANDVA 126

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L ++  T++GP  SP+ N  FKL + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 78/143 (54%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KEY+         I+A  P + +DL  W+C I+GP  +P+ +  F  ++  P+ Y
Sbjct: 6   QKRLFKEYQQLIRDSPPGIVA-GPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P A+ HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPTLTFTP-AILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 6/136 (4%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+++++K  +S  S   ++  P+  D++  W   I GP  +P+ + TF+L ++  + YP 
Sbjct: 8   RLMRDFKRIKS-DSPPGISASPLP-DNVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPN 65

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV +  GEICLDIL   W+P +++  I+ +I  L N+PN  SP N
Sbjct: 66  KPPHVKFL-SEMFHPNV-YANGEICLDILQNRWTPTYDVSSILTSIQSLFNDPNPASPAN 123

Query: 124 LDLANLLRFDDLKAYH 139
           ++ A L  F D +A +
Sbjct: 124 VEAATL--FKDHRAQY 137

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (53%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKEY+         I+A  P   +++  W+C I GP  +P+ N  F   +  P+ Y
Sbjct: 8   QKRLLKEYQQLIRESPPGIVA-GPSDENNMFEWDCLISGPPETPYENGVFNATLLFPKDY 66

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P ++ HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 67  PLSPPKLTFTP-SLLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 124

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D + L R
Sbjct: 125 VMSMLSEPNIESGANIDASILYR 147

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 6   RIAKELSD---------LGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N  +G ICLDIL   WSP   +  ++ ++  LL + 
Sbjct: 57  FPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICLDILKDQWSPALTLSKVLLSVCSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A + + D  K
Sbjct: 115 NPDDPLVPEIAQIYKTDKAK 134

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (53%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KE +         I+A  P S D+L  W+C I+GP  +P+A   F  +++ P+ Y
Sbjct: 6   QKRLYKELQQLIKDSPPGIVA-GPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNIESGANIDACILWR 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 79/143 (55%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P S +++  W+C I+GP  +P+A+  F  +++ P+ Y
Sbjct: 6   QKRLLKELQQLIKDSPPGIVA-GPKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNIESGANIDACILWR 145

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 74/143 (51%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P +  DL  W+C + GP  +P+A   F  ++  P  Y
Sbjct: 6   QKRLLKELQQLTRDPPPGIIAA-PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPNV +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPTLTFTPSIL-HPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           +V +L+EPN +S  N+D   L R
Sbjct: 123 VVSMLSEPNVESGANIDACILWR 145

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P    DL  W+C ++GP  SP+    F+ ++  P+ Y
Sbjct: 6   QRRLLKELQQLMRDPPPGIVA-GPQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPNV +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFVPSVL-HPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           +V +L+EPN +S  N+D   L R
Sbjct: 123 VVSMLSEPNVESGANIDACVLWR 145

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 79/143 (55%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P S +++  W+C I+GP  +P+A+  F  +++ P+ Y
Sbjct: 6   QKRLLKELQQLIKDSPPGIVA-GPKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNIESGANIDACILWR 145

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 79/143 (55%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P S +++  W+C I+GP  +P+A+  F  +++ P+ Y
Sbjct: 6   QKRLLKELQQLIKDSPPGIVA-GPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNIESGANIDACILWR 145

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 77.8 bits (190), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ +  FKL + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 77

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 78  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 79/143 (55%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P S +++  W+C I+GP  +P+A+  F  +++ P+ Y
Sbjct: 6   QKRLLKELQQLIKDSPPGIVA-GPKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNIESGANIDACILWR 145

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 28  TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEI 87
            D +  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G I
Sbjct: 27  NDSMQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSI 85

Query: 88  CLDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           CLD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D K Y + I  ++
Sbjct: 86  CLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

Query: 147 NNSA 150
           +  A
Sbjct: 145 DKYA 148

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ N  F L + +P  YP+  P  +F    + HPN++ + G IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFL-TKIYHPNID-KLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ ++  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ N  F+L + +P+ YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L  NWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 73/128 (57%), Gaps = 4/128 (3%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+++++K  +   S   ++  P+  D++  W   I GP  +P+ + TF+L ++  + YP 
Sbjct: 8   RLMRDFKRMKE-DSPPGVSASPLP-DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPN 65

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV +  GEICLDIL   W+P +++  I+ +I  L N+PN  SP N
Sbjct: 66  KPPHVKFL-SEMFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPAN 123

Query: 124 LDLANLLR 131
           ++ A L +
Sbjct: 124 VEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFV-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 4/128 (3%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+++++K  +      + A  P+  D++  W   I GP  +P+ + TF+L ++  + YP 
Sbjct: 8   RLMRDFKRMKEDAPPGVSA-SPLP-DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPN 65

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV +  GEICLDIL   W+P +++  I+ +I  L N+PN  SP N
Sbjct: 66  KPPHVKFL-SEMFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPAN 123

Query: 124 LDLANLLR 131
           ++ A L +
Sbjct: 124 VEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 77/136 (56%), Gaps = 6/136 (4%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+++++K  +   S   ++  P+  D++  W   I GP  +P+ + TF+L ++  + YP 
Sbjct: 8   RLMRDFKRMKE-DSPPGVSASPLP-DNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPN 65

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF    M HPNV +  GEICLDIL   W+P +++  I+ +I  L N+PN  SP N
Sbjct: 66  KPPHVKFLS-EMFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPAN 123

Query: 124 LDLANLLRFDDLKAYH 139
           ++ A L  F D K+ +
Sbjct: 124 VEAATL--FQDHKSQY 137

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KE +       + I+A  P S D+L  W+C I GP  SP+    F   ++ P+ Y
Sbjct: 6   QKRLFKELQQLLKDSPEGIVA-GPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 77.4 bits (189), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 73

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYH 139
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L  F D K+ +
Sbjct: 74  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDYKSQY 122

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 77.4 bits (189), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 73

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 74  LDILQNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 77.0 bits (188), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DD+ HW+ +I GP  SP+A   F L I 
Sbjct: 6   RITKELND---------LGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A+L + D  K
Sbjct: 115 NPDDPLVPEIAHLYKTDRAK 134

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 77.8 bits (190), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 68/140 (48%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D R          DPI++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 5   RISKELNDLRK---------DPITSFSAGPVGDDLFHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   +  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTLSKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRSK 133

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R++KE +       + I+A  P++ +++  W+C I GP  SP+    F  R+  P  Y
Sbjct: 6   QKRLMKEMQQLLKDCPEGIVA-GPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPNV +  GE+C+ IL                WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DD+ HW+ +I GP  SP+A   F L I 
Sbjct: 6   RITKELND---------LGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A+L + D  K
Sbjct: 115 NPDDPLVPEIAHLYKTDRAK 134

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 5   RITKELND---------LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 5   RITKELND---------LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 5   RITKELND---------LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 5   RITKELND---------LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KE +       + I+A  P S D+L  W+C I GP  SP+    F   ++ P+ Y
Sbjct: 6   QKRLFKELQQLLKDSPEGIVA-GPRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 78.6 bits (192), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 71/123 (57%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 29  DNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP+++++ IVE ++  LL EPN   PLN + A  L+  D K Y + I  +++
Sbjct: 88  LDVINSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 146

Query: 148 NSA 150
             A
Sbjct: 147 KYA 149

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 77.0 bits (188), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 6/105 (5%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKF--EPFAMPHPNVNFETGE 86
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF  E F   HPNV +  GE
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF---HPNV-YANGE 71

Query: 87  ICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           ICLDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 72  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 76.6 bits (187), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ +  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ ++  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 76.6 bits (187), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 66/123 (53%), Gaps = 9/123 (7%)

Query: 12  SRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLT 64
            R ++    LA DP+         D+L ++  TI+GP  SP+ N  F+L + +P  YP+ 
Sbjct: 6   KRIIKETERLASDPVPGISAEPHEDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPME 65

Query: 65  TPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNL 124
            P  +F    + HPN++   G ICLD+L  NWSP   I+ ++ +I  LL  PN   PL  
Sbjct: 66  APKVRFL-TRIYHPNID-RLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLAN 123

Query: 125 DLA 127
           D+A
Sbjct: 124 DVA 126

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 76.6 bits (187), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           DDL HW+ +I GP  SP+A   F L I  P  YP   P   F    + HPN+N   G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           LDIL   WSP   +  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 87  LDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRSK 134

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 76.6 bits (187), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DDL HW+ +I GP  SP+A   F L I 
Sbjct: 5   RIAKELSD---------LGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   +  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTLSKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 80/151 (52%), Gaps = 17/151 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P + ++L  W+C ++GP  + +    F  R+D P+ Y
Sbjct: 6   QRRLLKELQQLNKDSPPGIVA-GPANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +++ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLRFDDLKAYH 139
           ++ +L+EPN +S  N+D   L R D+ K + 
Sbjct: 123 VMSMLSEPNIESGANIDACILWR-DNRKEFE 152

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 76.3 bits (186), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ +  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFL-TRIYHPNID-RLGRIC 77

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 78  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 78.2 bits (191), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D +  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 28  DSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + AN L+  D K Y + +  +++
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREYID 145

Query: 148 NSA 150
             A
Sbjct: 146 KYA 148

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 76.6 bits (187), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (51%), Gaps = 9/120 (7%)

Query: 24  DPIST-------DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMP 76
           DPIS+       DDL HW+ +I GP  SP+A   F L I  P  YP   P   F    + 
Sbjct: 30  DPISSFSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIY 88

Query: 77  HPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           HPN+N   G ICLDIL   WSP   +  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 89  HPNIN-ANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRSK 147

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 76.6 bits (187), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ +  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 76.3 bits (186), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DD+ HW+ +I GP  SP+A   F L I 
Sbjct: 6   RITKELND---------LGRDPPTSCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A+L + D  K
Sbjct: 115 NPDDPLVPEIAHLYKTDRPK 134

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 77.0 bits (188), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  +P+ + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFI-SEMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 76.3 bits (186), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ +  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 77

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 78  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 76.3 bits (186), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L ++  T++GP  SP+ N  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ ++  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D +  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D K Y + I  +++
Sbjct: 86  LDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 144

Query: 148 NSA 150
             A
Sbjct: 145 KYA 147

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D +  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D K Y + I  +++
Sbjct: 86  LDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 144

Query: 148 NSA 150
             A
Sbjct: 145 KYA 147

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           DDL HW+ +I GP  SP+A   F L I  P  YP   P   F    + HPN+N   G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           LDIL   WSP   +  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 87  LDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPK 134

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           DDL HW+ +I GP  SP+A   F L I  P  YP   P   F    + HPN+N   G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           LDIL   WSP   +  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 87  LDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPK 134

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           DDL HW+ +I GP  SP+A   F L I  P  YP   P   F    + HPN+N   G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           LDIL   WSP   +  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 87  LDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPK 134

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DD+ HW+ +I GP  SP+A   F L I 
Sbjct: 5   RITKELND---------LGRDPPTSCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKIAFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D +  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D K Y + I  +++
Sbjct: 86  LDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 144

Query: 148 NSA 150
             A
Sbjct: 145 KYA 147

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 75.9 bits (185), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DD+ HW+ +I GP  SP+A   F L I 
Sbjct: 5   RITKELND---------LGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 56  FPTDYPFKPPKIAFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 113

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 114 NPDDPLVPEIAHIYKTDRAK 133

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ TI+GP  SP+ N  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L  NWSP   I+ ++ ++  LL  PN   PL  D+A
Sbjct: 88  LDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 65/133 (48%), Gaps = 4/133 (3%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI KE  D          +  P+  DDL HW+ +I GP  SP+A   F L I  P  YP 
Sbjct: 6   RITKELSD-MGRDPPTSCSAGPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPF 63

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P   F    + HPN+N   G ICLDIL   WSP   +  ++ +I  LL + N   PL 
Sbjct: 64  KPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLV 121

Query: 124 LDLANLLRFDDLK 136
            ++A++ + D  K
Sbjct: 122 PEIAHIYKTDRPK 134

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 65/133 (48%), Gaps = 4/133 (3%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI KE  D          +  P+  DDL HW+ +I GP  SP+A   F L I  P  YP 
Sbjct: 5   RITKELSD-MGRDPPTSCSAGPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPF 62

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P   F    + HPN+N   G ICLDIL   WSP   +  ++ +I  LL + N   PL 
Sbjct: 63  KPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLV 120

Query: 124 LDLANLLRFDDLK 136
            ++A++ + D  K
Sbjct: 121 PEIAHIYKTDRPK 133

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 4   RILKEYKDSRSLQSQYILALDPIST-------DDLTHWECTIKGPLHSPFANHTFKLRID 56
           RI KE  D         L  DP ++       DD+ HW+ +I GP  SP+A   F L I 
Sbjct: 6   RITKELND---------LGRDPPTSCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIH 56

Query: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116
            P  YP   P   F    + HPN+N   G ICLDIL   WSP   I  ++ +I  LL + 
Sbjct: 57  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPALTISKVLLSICSLLTDA 114

Query: 117 NFKSPLNLDLANLLRFDDLK 136
           N   PL  ++A++ + D  K
Sbjct: 115 NPDDPLVPEIAHIYKTDRPK 134

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           DDL HW+ +I GP  SP+A   F L I  P  YP   P   F    + HPN+N   G IC
Sbjct: 117 DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 174

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           LDIL   WSP   I  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 175 LDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAK 222

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 76.3 bits (186), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D +  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 26  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 84

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  I+E ++  LL EPN   PLN + A  L+  D K Y + I  +++
Sbjct: 85  LDVINSTWSPLYDLINILEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 143

Query: 148 NSA 150
             A
Sbjct: 144 KYA 146

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 59/103 (57%), Gaps = 2/103 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  W   I GP  + + + TF+L ++  + YP   P  KF    M HPNV +  GEIC
Sbjct: 31  DNVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           LDIL   W+P +++  I+ +I  L N+PN  SP N++ A L +
Sbjct: 89  LDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 29  DNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  I+E ++  LL EPN   PLN + A  L+  D K Y + I  +++
Sbjct: 88  LDVINSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYID 146

Query: 148 NSA 150
             A
Sbjct: 147 KYA 149

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 74.3 bits (181), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ +I+GP  SP+    F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 26  DNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 83

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LDIL TNWSP   I+ ++ ++  LL  PN   PL  D+A
Sbjct: 84  LDILKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 74.3 bits (181), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ +I+GP  SP+ +  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLAN 128
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A 
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 73.9 bits (180), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L ++  TI+GP  SP+ +  F L + +P  YP+ +P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 75.9 bits (185), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 68/119 (57%), Gaps = 3/119 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 45  DNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 103

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L   D K Y + I  ++
Sbjct: 104 LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELKDKKLYEERIKEYI 161

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 76/143 (53%), Gaps = 16/143 (11%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+LKE +         I+A  P + ++L  W+C ++GP  + +    F  R++ P+ Y
Sbjct: 6   QRRLLKELQQLTKDSPPGIVAC-PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDIL-------------DTNWSPVFNIQYIVEA 108
           PL+ P   F P  + HPN+ +  GE+C+ IL             +  WSPV +I+ I+ +
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLS 122

Query: 109 IVWLLNEPNFKSPLNLDLANLLR 131
           ++ +L+EPN +S  N+D   L R
Sbjct: 123 VMSMLSEPNIESGANIDACILWR 145

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 28  TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEI 87
            D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G I
Sbjct: 26  NDNMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 88  CLDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146
           CLD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D K Y + I  ++
Sbjct: 85  CLDVINSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYI 143

Query: 147 NNSA 150
           +  A
Sbjct: 144 DKYA 147

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L +++ +I+GP  S + N  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L TNWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +     +I  L+ ++  D+ H + T +GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEMQAVKDDPEAHI-TLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPNV+  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDT-KVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 69/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+ N  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 28  DNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D   Y   I  +++
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYID 145

Query: 148 NSA 150
             A
Sbjct: 146 KYA 148

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D +  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 28  DKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 86

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D   Y   I  ++N
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKDKDMYEQKIHEYIN 145

Query: 148 NSA 150
             A
Sbjct: 146 KYA 148

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 72.4 bits (176), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (57%), Gaps = 2/99 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D+L ++  TI+GP  S + N  F+L + +P  YP+  P  +F    + HPN++   G IC
Sbjct: 30  DNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 89  LDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           LD+L  NWSP   I+ ++ +I  LL  PN   PL  D+A
Sbjct: 88  LDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 73.9 bits (180), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 40  GPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPV 99
           GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G ICLD++++ WSP+
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINSTWSPL 119

Query: 100 FNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSA 150
           +++  IVE ++  LL EPN   PLN + A  L   D K Y + I  +++  A
Sbjct: 120 YDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYIDKYA 170

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 73.6 bits (179), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  + K Y + I  +++
Sbjct: 86  LDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKNPKMYEEKIQEYID 144

Query: 148 NSA 150
             A
Sbjct: 145 KYA 147

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 72.4 bits (176), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 69/123 (56%), Gaps = 3/123 (2%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+ +  ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDVASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A  L+  D   Y   I  +++
Sbjct: 86  LDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKVLYEQKIKEYID 144

Query: 148 NSA 150
             A
Sbjct: 145 KYA 147

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.8 bits (177), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   + +I  L+ +S  D+ H + T  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEIQAVKDDPAAHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  +F+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMQFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.8 bits (177), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   + +I  L+ +S  D+ H + T  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEIQAVKDDPAAHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  +F+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMQFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.8 bits (177), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   + +I  L+ +S  D+ H + T  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEIQAVKDDPAAHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  +F+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMQFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANL 129
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A L
Sbjct: 86  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATL 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   + +I  L+ +S  D+ H + T  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEIQAVKDDPAAHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  +F+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMQFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 2/103 (1%)

Query: 28  TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEI 87
            D +  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G I
Sbjct: 14  NDSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 88  CLDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANL 129
           CLD++++ WSP++++  IVE ++  LL EPN   PLN + A L
Sbjct: 73  CLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 115

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   +  I  LD ++  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEMQAVKDDPAANI-TLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +    +  ++L+ +S  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKELQAVKD-DPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDS-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 60/103 (58%), Gaps = 2/103 (1%)

Query: 28  TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEI 87
            D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G I
Sbjct: 14  NDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 88  CLDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANL 129
           CLD++++ WSP++++  I+E ++  LL EPN   PLN + A L
Sbjct: 73  CLDVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATL 115

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 29  DDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEIC 88
           D++  +     GP  +P+    ++L +++P  YP  +P   F    + HPN++  +G IC
Sbjct: 27  DNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 89  LDILDTNWSPVFNIQYIVEAIV-WLLNEPNFKSPLNLDLANL 129
           LD++++ WSP++++  IVE ++  LL EPN   PLN + A L
Sbjct: 86  LDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 127

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 66/124 (53%), Gaps = 2/124 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  R    +  + L+ +S  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEMEAVRD-DPEANIDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLA 127
            ++A
Sbjct: 124 AEVA 127

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +    +  + L+ ++  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKELQAVKD-DPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P+ KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPMMKFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +    +  + L+ +   D+ H + +  GP  +P+ N  F + I++P  YP 
Sbjct: 6   RIMKELQAVKD-DPEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPQMKFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 70.5 bits (171), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   +  I  L+ +S  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEMQAVKDDPAANI-NLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 70.5 bits (171), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   +  I  L+ ++  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKELQAVKDDPTAKI-GLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE +  +   +  I  L+ ++  D+ H + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RIMKEMQAVKDDPAAKI-NLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPNV+  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFD-TKVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R++KE +  R   +  I  L+ IS  D+   + +  GP  +P+    F + I++P  YP 
Sbjct: 6   RLMKELQAVRDDPAANI-TLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFD-TKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 68.9 bits (167), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 1/108 (0%)

Query: 21  LALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNV 80
           ++L  +S  D+ H + T  GP  +P+   TF + I +P  YP   P  +F+   + HPN+
Sbjct: 22  ISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPFKPPKMQFDT-KVYHPNI 80

Query: 81  NFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLAN 128
           +  TG ICLDIL  +WSPV  ++  + ++  LL  P    P + ++A 
Sbjct: 81  SSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAK 128

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RI+KE + ++    +  + L  +S  D+ H + +  GP  +P+    F + I +P  YP 
Sbjct: 6   RIIKEIQAAKD-DPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  +F+   + HPN++  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMQFDT-KVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 21  LALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNV 80
           ++L  +S  D+ H + T  GP  +P+    F + I +P  YP   P  +F+   + HPN+
Sbjct: 22  ISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPLEYPFKPPKMQFDT-KVYHPNI 80

Query: 81  NFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLAN 128
           +  TG ICLDIL  +WSPV  ++  + ++  LL  P    P + ++A 
Sbjct: 81  SSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAK 128

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (51%), Gaps = 2/124 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           RILKE +  +    +  + L  ++  D+ H + +  GP  +P+    F + I+IP  YP 
Sbjct: 6   RILKEIQAVKE-DPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPY 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPNV+  TG ICLDIL   W+PV  ++  + ++  LL  P    P +
Sbjct: 65  KPPQMKFDT-KVYHPNVSSVTGAICLDILKNAWTPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLA 127
             +A
Sbjct: 124 AQVA 127

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 72/140 (51%), Gaps = 7/140 (5%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R++KE +  +    +  + L  ++ +D+   + +  GP  +P+ N  F + I++P  YP 
Sbjct: 6   RVMKELQAIKD-DPEAKVDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPNV+  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFDT-KVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN-LLR----FDDLKAY 138
            ++A   LR    FD   A+
Sbjct: 124 AEVAQHFLRDKASFDKTAAF 143

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 27  STDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGE 86
            T DL HWE  I G   + +A+  + + I+ P  YP   P  KF P    HPN+ + +G 
Sbjct: 34  GTMDLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGT 91

Query: 87  ICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
           +CL IL  D +W P   ++ IV  +  LL+ PN  SP  
Sbjct: 92  VCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 65.5 bits (158), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R++KE +  +    +  + L  ++ +D+   + +  GP  +P+ N  + + I++P  YP 
Sbjct: 6   RVMKELQAIKD-DPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYPF 64

Query: 64  TTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLN 123
             P  KF+   + HPNV+  TG ICLDIL   WSPV  ++  + ++  LL  P    P +
Sbjct: 65  KPPKMKFQT-KVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQD 123

Query: 124 LDLAN 128
            ++A 
Sbjct: 124 AEVAQ 128

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 64.3 bits (155), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 2/91 (2%)

Query: 46  FANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYI 105
           +A  T+   + I  TYP+  P+ K     + HPN++ + G +CL++L  +W+P  +IQ I
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCM-HRIYHPNIDID-GNVCLNLLREDWTPALDIQSI 129

Query: 106 VEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
           +  I++L +EPN + PLN D A  L  D L+
Sbjct: 130 IIGILFLFHEPNGRDPLNKDAAKTLIEDPLR 160

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           DL  WE  I G   + +A   + + ++ P  YP   P  KF P    HPNV + +G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 6/99 (6%)

Query: 37  TIKGPLHSPFANHTFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDT 94
            I  P    + N  F+  ++    YP+  P  +C+   +   HPN++ + G++CL+IL  
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIY---HPNIDVQ-GKVCLNILRE 128

Query: 95  NWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFD 133
           +WSP  ++Q I+  +++L  EPN K PLN D A +   D
Sbjct: 129 DWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKD 167

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 60.5 bits (145), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 40  GPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPV 99
           GP  SP+A   F L I  P  YP   P   F    + HPN+N   G ICLDIL   WSP 
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQWSPA 59

Query: 100 FNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
             +  ++ +I  LL + N   PL  ++A++ + D  K
Sbjct: 60  LTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPK 96

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 61.2 bits (147), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           DL  WE  I G   + +A   + + ++ P  YP   P  KF P    HPNV + +G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 60.8 bits (146), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           DL  WE  I G   + +A   + + ++ P  YP   P  KF P    HPNV + +G ICL
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           DL  WE  I G   + +A   + + ++ P  YP   P  KF P    HPNV + +G ICL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 46  FANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYI 105
           + +  F   +    +YP+  P+ KF    + HPN++   G+ICL+IL  +WSPV ++Q I
Sbjct: 80  YKDGYFPFSMVFKDSYPIEPPVVKFLK-KIYHPNIDL-NGKICLNILREDWSPVLDLQSI 137

Query: 106 VEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSA 150
           +  +++L  EPN + PLNL    LL+ ++ + + D++   +  + 
Sbjct: 138 IIGLMFLFLEPNPRDPLNLKAGELLK-ENKQEFIDIVRLTMRGTT 181

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 6/85 (7%)

Query: 51  FKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEA 108
           F+ +  I + YP+  P  +C  + +   HPN+N  TGEICL+IL  +WSP  ++Q ++  
Sbjct: 91  FRFQFTINENYPIEPPKVVCLTKIY---HPNIN-RTGEICLNILREDWSPALDLQSVIIG 146

Query: 109 IVWLLNEPNFKSPLNLDLANLLRFD 133
           +++L  EPN K PLN   A+ L  D
Sbjct: 147 LLFLFIEPNPKDPLNKQAADTLLHD 171

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 13/133 (9%)

Query: 10  KDSRSLQSQYILALDPISTDDLTH------WECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           +D  SL     + LD I++ D T+       E T+  P    + + +    +D  + YP+
Sbjct: 33  RDLDSLDLPPTVKLDVITSPDSTNRTHSPKLEITV-NPDEGYYTHGSINFSLDFNEVYPI 91

Query: 64  TTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
             P   C    F   HPN++F+ G +CL+IL  +WSP  ++Q IV  +++L  EPN   P
Sbjct: 92  EPPKVACLKRIF---HPNIDFK-GNVCLNILREDWSPALDLQSIVTGLLFLFLEPNPNDP 147

Query: 122 LNLDLANLLRFDD 134
           LN D A LL  D+
Sbjct: 148 LNKDAAKLLCQDE 160

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P  T DL  WE  I G   + +A+  + L I+ P  YP   P  K  P    HPNV + +
Sbjct: 32  PDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKL-PANFYHPNV-YPS 89

Query: 85  GEICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
           G ICL IL  D +W P   ++ I   I  LL+ PN  SP
Sbjct: 90  GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 76/149 (51%), Gaps = 12/149 (8%)

Query: 6   LKEYKDSRSLQSQYILALDPISTDDLTHWECT---IKGPLHSPFANHTFKLRIDIPQTYP 62
           L+  KD   L+    + ++ IS D+  H E +   I  P    +    F+      +TYP
Sbjct: 35  LRLQKDIEELELPPTVRVNIISLDN--HKEMSLNIIIIPDEGFYKGGKFRFTATFLETYP 92

Query: 63  LTTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKS 120
           +  P  IC  + F   HPN++   G+ICL+IL  +WSP  ++Q IV  ++ L  EPN   
Sbjct: 93  IDPPKVICNNKIF---HPNID-PHGKICLNILREDWSPALDLQCIVLGLLSLFQEPNGND 148

Query: 121 PLNLDLANLLRFDDLKAYHDLISYHLNNS 149
           PLN + A +L  D L+ + +L+   ++ +
Sbjct: 149 PLNKEAAEVLNKDKLE-FGNLVRLAMSGA 176

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 58.2 bits (139), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 4/100 (4%)

Query: 24  DPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFE 83
            P  T +L  WE  I G   + + +  F + ++ P  YP   P  KF P    HPN+ + 
Sbjct: 31  GPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKF-PAGFYHPNI-YP 88

Query: 84  TGEICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
           +G +CL IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 58.9 bits (141), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (55%), Gaps = 6/97 (6%)

Query: 40  GPLHSPFANHTFKLRIDIPQTYPLTTPI--CKFEPFAMPHPNVNFETGEICLDILDTNWS 97
            P    + +  FK  +   + YP+  PI  C  + F   HPN++ + G+ICL+IL  +WS
Sbjct: 75  SPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKIF---HPNIDLD-GKICLNILREDWS 130

Query: 98  PVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDD 134
           P  ++  I+  +++L  E N K PLN + AN+L  D+
Sbjct: 131 PALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 167

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (55%), Gaps = 6/97 (6%)

Query: 40  GPLHSPFANHTFKLRIDIPQTYPLTTPI--CKFEPFAMPHPNVNFETGEICLDILDTNWS 97
            P    + +  FK  +   + YP+  PI  C  + F   HPN++ + G+ICL+IL  +WS
Sbjct: 76  SPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKIF---HPNIDLD-GKICLNILREDWS 131

Query: 98  PVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDD 134
           P  ++  I+  +++L  E N K PLN + AN+L  D+
Sbjct: 132 PALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 168

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 6/87 (6%)

Query: 46  FANHTFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQ 103
           +    FK  +   ++YP+  P  +C  + +   HPN++   G+ICL+IL  +WSP  +IQ
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVVCLQKIY---HPNIDLN-GKICLNILREDWSPALDIQ 113

Query: 104 YIVEAIVWLLNEPNFKSPLNLDLANLL 130
            ++  +++L  EPN + PLN D A+ L
Sbjct: 114 SVIVGLLFLFLEPNPRDPLNKDAASTL 140

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.0 bits (136), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 57/124 (45%), Gaps = 7/124 (5%)

Query: 3   SRILKEYKDSRSLQSQYILALDPISTD---DLTHWECTIKGPLHSPFANHTFKLRIDIPQ 59
            R+ +E K  R        A     TD   +L  WE  I G   + + N  + L I+ P 
Sbjct: 7   QRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPD 66

Query: 60  TYPLTTPICKFEPFAMPHPNVNFETGEICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPN 117
            YP   P  KF P    HPNV + +G ICL IL  D +W P   ++ ++  +  LL+ PN
Sbjct: 67  DYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPN 124

Query: 118 FKSP 121
             SP
Sbjct: 125 PNSP 128

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 59/113 (52%), Gaps = 15/113 (13%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL T+            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151
           V  ++ ++ +IV LL +PN  SP N+D A   R  +++ Y   +   +  S +
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYR-KNIEQYKQRVQLEVERSKQ 169

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 56.2 bits (134), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           DL  WE  I G   + +A   + + I+ P  YP   P   F P    HPNV + +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  + +W P   ++ IV  +  LL+ PN  SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL T+            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + +    + + I+ P  YP   P  KF P    HPN+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ IV  +  LLN PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P  + +L  WE  I G   + + +  F + I+ P  YP   P  KF P    HPN+ + +
Sbjct: 32  PDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPS 89

Query: 85  GEICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
           G +CL IL  D +W P   ++ I   +  LL+ PN  SP
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%), Gaps = 6/83 (7%)

Query: 50  TFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVE 107
           +    +D  + YP+  P  +C  + F   HPN++ + G +CL+IL  +WSP  ++Q I+ 
Sbjct: 79  SINFNLDFNEVYPIEPPKVVCLKKIF---HPNIDLK-GNVCLNILREDWSPALDLQSIIT 134

Query: 108 AIVWLLNEPNFKSPLNLDLANLL 130
            +++L  EPN   PLN D A LL
Sbjct: 135 GLLFLFLEPNPNDPLNKDAAKLL 157

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 7/109 (6%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANH-TFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVN 81
           P STD +   +  +       + NH +    +D  + YP+  P   C  + F   HPN++
Sbjct: 52  PDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLKKIF---HPNID 108

Query: 82  FETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLL 130
            + G +CL+IL  +WSP  ++Q I+  +++L  EPN   PLN D A L 
Sbjct: 109 LK-GNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF 156

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 54.7 bits (130), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + +    F + I+ P  YP   P  KF P    HPN+ + +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ I   +  LL+ PN  SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL------------DTNWSP 98
           FK ++  P  +P + P  +F P A+ HPNV +  G +C+ IL            +  WSP
Sbjct: 59  FKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSP 116

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 117 VQTVESVLISIVSLLEDPNISSPANVDAA 145

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIV 110
           F   +    +YP+  PI K     + HPN+++  G ICL++L  +W+PV ++Q IV  ++
Sbjct: 160 FGFSVSFKDSYPIDPPIVKCL-TTIYHPNIDYN-GNICLNVLREDWTPVLDLQTIVIGLL 217

Query: 111 WLLNEPNFKSPLNLDLANLLRFDDLKAYHDLIS 143
           +L  EPN K PLN   A+ +  D  +   ++++
Sbjct: 218 FLFLEPNPKDPLNKHAAHTMVKDPFRFERNVLA 250

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL               WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + + +  + + I+ P  YP   P  KF P    HPN+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ I   +  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANH-TFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVN 81
           P STD +   +  +       + NH +    +D  + YP+  P   C  + F   HPN++
Sbjct: 52  PQSTDRMQPPKLEVVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKKIF---HPNID 108

Query: 82  FETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDL 141
              G +CL+IL  +WSP  ++Q I+  +++L  EPN   PLN D A L   D  K    +
Sbjct: 109 L-NGNVCLNILREDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKFAETV 167

Query: 142 I 142
           I
Sbjct: 168 I 168

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL------------DTNWSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL               WSP
Sbjct: 60  FKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL               WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 54.3 bits (129), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 27  STDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGE 86
            T +L  WE  I G   + + +  + + I+ P  YP   P  +F P    HPN+ + +G 
Sbjct: 34  GTMNLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSGT 91

Query: 87  ICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
           +CL IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 92  VCLSILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 54.3 bits (129), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 25  PISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFET 84
           P  + +L  WE  I G   + +A   + + I+ P  YP   P  K  P    HPNV + +
Sbjct: 32  PDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKL-PANFYHPNV-YPS 89

Query: 85  GEICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
           G ICL IL  D +W P   ++ I   I  LL+ PN  SP
Sbjct: 90  GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL------------DTNWSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL               WSP
Sbjct: 60  FKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL------------DTNWSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL               WSP
Sbjct: 60  FKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAA 146

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAA 146

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 53.9 bits (128), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 4/97 (4%)

Query: 27  STDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGE 86
            T +L  WE  I G   + +A   + + I+ P  YP   P  K  P    HPNV + +G 
Sbjct: 34  GTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPSGT 91

Query: 87  ICLDIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
           ICL IL  + +W P   ++ I   I  LL+ PN  SP
Sbjct: 92  ICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 53.9 bits (128), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + + +  + + I+ P  YP   P  KF P    HPN+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKF-PAGFYHPNI-YPSGTVCL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ I+  +  LL  PN  SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P  +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLR 131
           V  ++ ++ +IV LL +PN  SP N+D A   R
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDFR 150

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P+ +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P  +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 6/93 (6%)

Query: 46  FANHTFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQ 103
           +    F  +++    YP+  P  IC  + +   HPN++ + G++CL+IL  +WSP  ++Q
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTVICTSKLY---HPNIDID-GKVCLNILREDWSPALDVQ 133

Query: 104 YIVEAIVWLLNEPNFKSPLNLDLANLLRFDDLK 136
            I+  +++LL EPN K PLN D A +L  D  +
Sbjct: 134 SIIIGLLFLLLEPNAKDPLNKDAAMMLSTDTAR 166

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P  +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V +++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQSVESVLISIVSLLEDPNISSPANVDAA 146

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 53.5 bits (127), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 45/94 (47%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + +    + L I+ P  YP   P  K  P    HPNV + +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ I   I  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIV 110
           F+  +    TYP+  P  K     + HPN++ + G +CL+IL  +WSPV ++Q +V  ++
Sbjct: 78  FRFSLFFKDTYPIEPPAVKCVN-KIYHPNIDTQ-GNVCLNILREDWSPVLDLQSVVIGLL 135

Query: 111 WLLNEPNFKSPLN 123
           +L  EPN K PLN
Sbjct: 136 FLFLEPNDKDPLN 148

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 53.5 bits (127), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + + +  + + I+ P  YP   P  KF P    HPN+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ I+  +  LL  PN  SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 54.7 bits (130), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN------------WSP 98
           FK ++  P  +P + P  +F P A+ HPNV +  G +C+ IL  +            WSP
Sbjct: 60  FKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V  ++ ++ +IV LL +PN  SP N+D A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 30  DLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICL 89
           +L  WE  I G   + +    + + I+ P  YP   P  KF P    HPN+ + +G +CL
Sbjct: 37  NLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 90  DIL--DTNWSPVFNIQYIVEAIVWLLNEPNFKSP 121
            IL  D +W P   ++ IV  +  LL+ PN  SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 12/115 (10%)

Query: 41  PLHSPFANHTFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDTNWSP 98
           P   P+    FK  +   + YP+  P  IC  + F   HPN++   G+ICL+IL  +WSP
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSAICLNKIF---HPNIDL-NGKICLNILREDWSP 132

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLANLL-----RFDDLKAYHDLISYHLNN 148
             ++  IV  +++L  +     PLN   A +L     RF +L     ++   +NN
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLANDRNRFCEL-VQRAMLGSEINN 186

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL------------DTNWSP 98
           F+ ++  P+ +P + P  KF P  + HPNV +  G++C+ IL            +  WSP
Sbjct: 67  FQSQMKFPKDFPFSPPQFKFIP-PIYHPNV-YRDGKLCISILHQSGDAMTSEPDNETWSP 124

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V +++ ++ +IV LL +PN  SP N+D A
Sbjct: 125 VQSVESVLISIVSLLEDPNVSSPANVDAA 153

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIV 110
           FK       TYP+  P        + HPN++ + G +CL+IL  +WSPV ++Q I+  ++
Sbjct: 78  FKFCATFKDTYPIEPPKVTLLS-KIFHPNIDLQ-GNVCLNILREDWSPVLDVQSILIGLL 135

Query: 111 WLLNEPNFKSPLNLDLANLL 130
            L  EPN   PLN   A++L
Sbjct: 136 MLFLEPNATDPLNKVAADVL 155

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 38  IKGPLHSPFANHTFKLRIDIPQTYPLTTP--ICKFEPFAMPHPNVNFETGEICLDILDTN 95
           I  P    +    F   +   + YP+  P   C  + F   HPN++ + G+ICL+IL  +
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCMNQIF---HPNIDLQ-GKICLNILRED 122

Query: 96  WSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLL 130
           WSP  ++Q ++  I++L  E + + PLN   A+LL
Sbjct: 123 WSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 14/89 (15%)

Query: 51  FKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL------------DTNWSP 98
           FK  +  P  +P + P  KF P  + HPNV ++ G++C+ IL            +  WSP
Sbjct: 61  FKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSEPDNETWSP 118

Query: 99  VFNIQYIVEAIVWLLNEPNFKSPLNLDLA 127
           V +++ ++ +I+ LL +PN  SP N+D +
Sbjct: 119 VQSVESVLISIISLLEDPNISSPANVDAS 147

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 41  PLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVF 100
           P    +    F+  +    TYP+  P  K     + HPN+++ +G ICL++L  +WSPV 
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL-NTIYHPNIDY-SGNICLNVLREDWSPVM 140

Query: 101 NIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFD 133
           ++Q +V  +++L  EPN   PLN   A+ +  D
Sbjct: 141 DLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRD 173

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 14/82 (17%)

Query: 58  PQTYPLTTPICKFEPFAMPHPNVNFETGEICLDIL-----DTN-------WSPVFNIQYI 105
           P+ +P + P   F P  + HPNV F  G +C+ IL     DTN       WSPV  ++ +
Sbjct: 68  PRNFPFSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETV 125

Query: 106 VEAIVWLLNEPNFKSPLNLDLA 127
           + +I+ LL++PN  SP N+D A
Sbjct: 126 LISIISLLDDPNVSSPANVDAA 147

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + D++  W   I GP  SP++   +   +  P  YP 
Sbjct: 9   RLTKEYKTLTETPPPYILARP--NEDNILEWHYIITGPPDSPYSEGQYHGTLTFPTDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILDTN---WSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D +   W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLSMSDYHPDLWNPSWSVSTILTGLLSFM 115

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 47  ANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIV 106
            N TF+L  +  + YP+  P  K     + HPN++ + G +CL+IL  +W+P  ++Q ++
Sbjct: 69  GNFTFELLFN--EQYPMEPPKVKCLN-RIYHPNIDTD-GRVCLNILRQDWTPALDLQSVI 124

Query: 107 EAIVWLLNEPNFKSPLNLDLA 127
             +++L  E +   PLN   A
Sbjct: 125 IGLLFLFLEISGVDPLNKQAA 145

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK+  +    +I+A      D++  W   I GP  +P+ N  +   +  P  YP 
Sbjct: 9   RLTKEYKNIVNNPPPFIIAAP--HEDNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPF 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 67  NPPAIR-----MITPNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 31  LTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLD 90
           +T+W  TI GP HS   N  + + ++    YP   P  KF    +  P VN  TGE+  D
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFIS-KINLPCVNQTTGEVKRD 59

Query: 91  ILDT--NWSPVFNIQYIV 106
              T  +W   +N++ ++
Sbjct: 60  QFSTLRDWKRSYNMETLL 77

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + D++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLMVENPPPYILARP--NEDNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNFE-TGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F+    +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MVTPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 40.0 bits (92), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 11/116 (9%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KE+K        YI+A    +  ++  W   I GP  +P+ N  +   +  P  Y
Sbjct: 7   QKRLAKEFKAMTEDPPPYIMARP--NESNILDWHYIITGPPGTPYENGQYHGTLTFPSDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
           P   P  +     M  P+  F E   +CL + D   T W+P +++  I+  ++  +
Sbjct: 65  PFQPPAIR-----MVTPSGRFQENTRLCLSMSDYHPTTWNPGWSVSTILNGLLSFM 115

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + D++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLMVENPPPYILARP--NEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNFE-TGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F+    +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MVTPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + D++  W   I GP  +P+ +  +   +  P  YP 
Sbjct: 9   RLTKEYKLMVENPPPYILARP--NEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILDTN---WSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D +   W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLSMSDYHPDLWNPGWSVNTILNGLLSFM 115

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + D++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLMVENPPPYILARP--NEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNFE-TGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F+    +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK      + YI+A    +  ++  W   I GP  SP+ +  +   +  P  YP 
Sbjct: 9   RLTKEYKMMMENPTPYIIARP--NESNILEWHYVITGPPDSPYHDGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MVTPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YI+A    + D++  W   I GP  +P+++  +   +  P  YP 
Sbjct: 9   RLTKEYKLIVENPPPYIVARP--NEDNILEWHYVITGPSDTPYSSGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILDTN---WSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D +   W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFM 115

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        +ILA    + D++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLLVESSPPFILARP--NEDNILEWHYIITGPPDTPYDGGQYHGTLTFPNDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           R+L+E +           +     +DD  +THW  TI GP HS   N  + + I+  + Y
Sbjct: 9   RLLEELEKGEKGMGPESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIYSVAIECGEAY 68

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILDT--NWSPVFNIQYIV 106
           P   P  +F    +  P V+  TGE+  +   T  +W   + ++ ++
Sbjct: 69  PDQPPKIRFLS-KVNLPCVDQNTGEVKKEQFSTLRDWKRSYTMETLL 114

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + D++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLMVENPPPYILARP--NEDNILEWHYIITGPADTPYKAGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNFE-TGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F+    +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YI+A      D++  W   I GP  +P+ +  +   +  P  YP 
Sbjct: 9   RLSKEYKMMTENPPPYIVAAP--KEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPF 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 67  NPPAIR-----MLTPNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFM 115

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YILA    + +++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLMVENPPPYILARP--NENNILEWHYIITGPADTPYFEGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MVTPNGRFRENTRLCLSMSDYHPNTWNPSWSVSTILNGLLSFM 115

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 5/107 (4%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           R+L+E +           +     +DD  +T W  TI GP HS   N  + L I+    Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIECGPNY 68

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILDT--NWSPVFNIQYIV 106
           P   P  KF    +  P V+ +TG++      T  +W   +N++ I+
Sbjct: 69  PDHPPTIKFI-SKINLPCVDSKTGQVTPSTFHTLRDWKRAYNMETIL 114

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 11/115 (9%)

Query: 3   SRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYP 62
            R+ KEYK       Q+I A    + D++  W   I GP  +P+ +  +   +  P  YP
Sbjct: 8   KRLTKEYKAIIENPPQFINAQP--NEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYP 65

Query: 63  LTTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
              P  +     M  PN  F E   +C+ + D     W+P +++  I+  ++  +
Sbjct: 66  FKPPAIR-----MITPNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFM 115

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 11/116 (9%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KEYK        +I+A    + D++  W   I GP  +P+    +   +  P  Y
Sbjct: 7   QKRLTKEYKSMVENPPPFIIAQP--NEDNILEWHYVITGPPDTPYEGGQYHGTLVFPSDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
           P   P  +     M  P+  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 65  PFKPPAIR-----MVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILTGLLSFM 115

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        Y+ A    + D++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLTKEYKLIVENPPPYVTARP--NEDNILEWHYVITGPPETPYEGGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILDTN---WSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D +   W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MVTPNGRFKENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFM 115

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK      + YILA    + +++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLSKEYKLIIENPTPYILARP--NENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPF 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILDTN---WSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D +   W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFM 115

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 31  LTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLD 90
           +T W  TI GP HS   N  + + I+    YP   P   F    +  P V+  TGE+  +
Sbjct: 38  MTRWNGTILGPPHSNHENRIYSVSIECGPKYPDEPPTITF-ISKINLPCVDQSTGEVNKE 96

Query: 91  ILDT--NWSPVFNIQYIV 106
             +T  +W  ++N++ I+
Sbjct: 97  KFNTLKDWKRLYNMETIL 114

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           R+L+E +           +     +DD  +T+W  TI GP HS  +N  + L I+   +Y
Sbjct: 9   RLLEELEKGEKGMGPESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIECGPSY 68

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQ--YIVEAIVWLLNE 115
           P   P  KF         +N    +    ++  +++P+ N +  Y +E I+  L +
Sbjct: 69  PDEPPTLKF------ISKINLNCVDSATGVVKPDFNPIKNWKRSYTMETILLELRK 118

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK      + +I+A    +  ++  W   I GP  SP+    +   +  P  YP 
Sbjct: 9   RLTKEYKMMNENPTPFIMARP--NEANILEWHYIINGPPDSPYFEGQYHGTLTFPSDYPY 66

Query: 64  TTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----MITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 11/116 (9%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KEYK        +I+A    + +++  W   I GP  +P+    +   +  P  Y
Sbjct: 7   QKRLTKEYKMMVENPPPFIIARP--NEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
           P   P  +     M  PN  F E   +CL + D     W+P +++  I+  ++  +
Sbjct: 65  PYKPPAIR-----MITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
          (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 35.4 bits (80), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 31 LTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEI 87
          +T+W  TI GP HS  AN  + L I+    YP   P  KF    +  P V+  TGE+
Sbjct: 1  MTYWNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFI-SRVNLPCVDVNTGEV 56

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPL 63
           R+ KEYK        YI+A+   + +++  W   I GP  +P+    +   +  P  YP 
Sbjct: 9   RLSKEYKMIMENTPPYIIAVP--NDENILEWHYVITGPPDTPYEGGQYHGTLHFPPEYPF 66

Query: 64  TTPICKFEPFAMPHPNVNFET-GEICLDILD---TNWSPVFNIQYIVEAIVWLL 113
             P  +     +  PN  F+    +CL + D     W+P +++  I+  ++  +
Sbjct: 67  KPPAIR-----ISTPNGRFKQHTRLCLSMSDYHPDTWNPSWSVATILNGLLSFM 115

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 11/113 (9%)

Query: 2   ESRILKEYKDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           + R+ KEYK        +I+A    + D++  W   I GP  +P+    +   +  P  Y
Sbjct: 7   QKRLSKEYKSMVENPPPFIIAQP--NEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDY 64

Query: 62  PLTTPICKFEPFAMPHPNVNF-ETGEICLDILD---TNWSPVFNIQYIVEAIV 110
           P   P  +     M  P+  F E   +CL + D     W+P +++  I+  ++
Sbjct: 65  PFKPPAIR-----MVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILTGLL 112

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 5/120 (4%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           R+L+E +           +      DD  +T+W  TI GP HS   N  + + I+    Y
Sbjct: 11  RLLEELEKGEKGLGPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAIECGANY 70

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILDT--NWSPVFNIQYIVEAIVWLLNEPNFK 119
           P   P+ KF    +  P V+  TGE+  D   T  +W   + ++ ++  +   +  P  K
Sbjct: 71  PDEPPLIKFVS-KINLPCVDQTTGEVKHDQFHTLRDWKRSYTMETLLLDLRKEMGTPTNK 129

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 4/106 (3%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           R+L+E +           +     +DD  +T W  TI GP HS   N  + L ID    Y
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNY 68

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIV 106
           P + P   F    +  P VN  TGE+  D     +W   + ++ ++
Sbjct: 69  PDSPPKVTFI-SKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLL 113

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 35.8 bits (81), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 5/107 (4%)

Query: 4   RILKEYKDSRSLQSQYILALDPISTDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTY 61
           R+L+E +           +     +DD  +T+W  TI GP HS   N  + + I+    Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECGPNY 68

Query: 62  PLTTPICKFEPFAMPHPNVNFETGEICLDILDT--NWSPVFNIQYIV 106
           P   P  KF    +  P V+  TGE+   +  T  +W   + ++ ++
Sbjct: 69  PDEPPKIKFV-SKVNVPCVDSTTGEVKSSVFHTLRDWKRAYTMETLL 114

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 35.8 bits (81), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 28  TDD--LTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETG 85
           +DD  +T W  TI GP HS   N  + + I+   +YP   P  KF    +  P VN  TG
Sbjct: 33  SDDITMTKWNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKF-VSKINLPCVNSTTG 91

Query: 86  EICLDILDT--NWSPVFNIQYIV 106
           E+  +   T   W   + ++ ++
Sbjct: 92  EVVKEKFHTLKEWKRSYTMETVL 114

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,431,785
Number of extensions: 818138
Number of successful extensions: 2197
Number of sequences better than 10.0: 266
Number of HSP's gapped: 1999
Number of HSP's successfully gapped: 266
Length of query: 151
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 51
Effective length of database: 42,014,799
Effective search space: 2142754749
Effective search space used: 2142754749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)