Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019803.494ON28328314840.0
NCAS0E007903.494ON32728112531e-175
NDAI0G009203.494ON29628712451e-174
Smik_6.2283.494ON28728312271e-171
Suva_7.4203.494ON28728312221e-171
CAGL0I10472g3.494ON28828712221e-171
YGR132C (PHB1)3.494ON28728412181e-170
KNAG0B007903.494ON28428312051e-168
TPHA0D032903.494ON28528511991e-167
Skud_7.4433.494ON28728411961e-167
TBLA0D029503.494ON28227511851e-165
Kpol_1017.53.494ON28328311811e-164
TDEL0D056203.494ON27927911771e-164
SAKL0F02728g3.494ON28227511711e-163
KLTH0F14872g3.494ON28028111641e-162
Kwal_55.212403.494ON28326211181e-155
ZYRO0D09900g3.494ON28328310911e-151
Ecym_12353.494ON28328210651e-147
AFR313C3.494ON28326910181e-140
KLLA0D16302g3.494ON2262139471e-130
NDAI0D025305.98ON3162417249e-95
TBLA0H022205.98ON3072317221e-94
YGR231C (PHB2)5.98ON3102347195e-94
ADL141W5.98ON3072317171e-93
NCAS0F006005.98ON3132317161e-93
Smik_16.755.98ON3102347162e-93
TPHA0A050905.98ON3102317152e-93
Skud_7.5655.98ON3102347134e-93
SAKL0G15510g5.98ON3082347125e-93
KLTH0C01672g5.98ON3072317091e-92
CAGL0L06490g5.98ON3132457092e-92
Kwal_27.127475.98ON3072317073e-92
KAFR0B042505.98ON3102317074e-92
Suva_7.5235.98ON3102347064e-92
KLLA0E15731g5.98ON3082317064e-92
Kpol_1050.615.98ON3102317049e-92
KNAG0A015805.98ON2882316968e-91
TDEL0G012105.98ON3092346943e-90
ZYRO0B15136g5.98ON3102316901e-89
KNAG0A013803.50ON61158702.5
ABL164C2.46ON36087666.8
KNAG0A074703.410ON18552647.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01980
         (283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   576   0.0  
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     487   e-175
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     484   e-174
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   477   e-171
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   475   e-171
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   475   e-171
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   473   e-170
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   468   e-168
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   466   e-167
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   465   e-167
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   461   e-165
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   459   e-164
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   457   e-164
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   455   e-163
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   452   e-162
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   435   e-155
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   424   e-151
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   414   e-147
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   396   e-140
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   369   e-130
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   283   9e-95
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   282   1e-94
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   281   5e-94
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   280   1e-93
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   280   1e-93
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   280   2e-93
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   280   2e-93
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   279   4e-93
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   278   5e-93
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   277   1e-92
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   277   2e-92
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   276   3e-92
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   276   4e-92
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   276   4e-92
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   276   4e-92
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   275   9e-92
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   272   8e-91
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   271   3e-90
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   270   1e-89
KNAG0A01380 Chr1 complement(43745..45580) [1836 bp, 611 aa] {ON}...    32   2.5  
ABL164C Chr2 complement(91563..92645) [1083 bp, 360 aa] {ON} Syn...    30   6.8  
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    29   7.6  

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/283 (100%), Positives = 283/283 (100%)

Query: 1   MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW 60
           MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW
Sbjct: 1   MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW 60

Query: 61  LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP 120
           LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP
Sbjct: 61  LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT 180
           SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT
Sbjct: 121 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT 180

Query: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR 240
           KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR
Sbjct: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR 240

Query: 241 LEASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283
           LEASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR
Sbjct: 241 LEASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  487 bits (1253), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/281 (83%), Positives = 263/281 (93%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           T+ +NV+T++A+P G+L T ++YSMYDVKGGSRGVIFDR+SGV+K VIGEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KA+IYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRPN+ ELP+IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLKSIVAQFDAAELITQREIVSQRI+ E+S RA+EFGI+LEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283
           ASKDIA+TL+ S NITYLPG +G  G++   PNSLLLNIGR
Sbjct: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  484 bits (1245), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 262/287 (91%), Gaps = 6/287 (2%)

Query: 2   STRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWL 61
           + +  N++TK+A+P GLL+T VDYSMYDVKGGSRGVIFDR+SGVK  V+GEGTHFLVPWL
Sbjct: 11  TQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWL 70

Query: 62  QKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPS 121
           QKA+IYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRPNV ELP+IYQNLGLDYDE+VLPS
Sbjct: 71  QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPS 130

Query: 122 IGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTK 181
           IGNEVLKSIVAQFDAAELITQREIVSQRI+ E+S RANEFG++LEDVSITHMTFG EFTK
Sbjct: 131 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTK 190

Query: 182 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRL 241
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRL
Sbjct: 191 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 250

Query: 242 EASKDIARTLSKSSNITYLPG-----GKGREGDEKTPPNSLLLNIGR 283
           EASKDIA+TL+ S N+TYLPG     G G +G   + PNSLLLNIGR
Sbjct: 251 EASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSS-PNSLLLNIGR 296

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  477 bits (1227), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/283 (81%), Positives = 260/283 (91%), Gaps = 2/283 (0%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R I+++TK+A+P G++ + + YSMYDVKGGSRGVIFDRI+GVK+ V+GEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KAIIYDVRTKPKSI+TNTGT+DLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLKSIVAQFDAAELITQREI+SQ+IRKE+S RANEFGIKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKT--PPNSLLLNIGR 283
           ASKDIA+TL+ SSN+ YLP      G+ ++   PNSLLLNIGR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  475 bits (1222), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/283 (81%), Positives = 259/283 (91%), Gaps = 2/283 (0%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R I+++TK+A+P GL+ + + YSMYDVKGGSRGVIFDRI+GVK+ V+GEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KAIIYDVRTKPKSI+TNTGT+DLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLKSIVAQFDAAELITQREI+SQ+IRKE+S RANEFGIKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERA+F+VEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKT--PPNSLLLNIGR 283
           ASKDIA+TL+ SSN+ YLP      G+ +    PNSLLLNIGR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  475 bits (1222), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/287 (81%), Positives = 262/287 (91%), Gaps = 4/287 (1%)

Query: 1   MSTRAINVV---TKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFL 57
           MS +A N V   TK+AIP G+ ++ + YSMYDV+GGSRGVIFDR+ GVK  V+GEGTHFL
Sbjct: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60

Query: 58  VPWLQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDER 117
           VPWLQKAIIYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP+V++LP IYQNLGLDYDER
Sbjct: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120

Query: 118 VLPSIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGA 177
           VLPSIGNEVLKSIVAQFDAAELITQREIVSQ+IR+E+S+RANEFGI+LEDVSITHMTFG 
Sbjct: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180

Query: 178 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLL 237
           EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAE ISKALS+VGDGLLL
Sbjct: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240

Query: 238 IRRLEASKDIARTLSKSSNITYLPGGK-GREGDEKTPPNSLLLNIGR 283
           IRRLEASK+IA+TL+ S+NITYLP    G + D+K  PN+LLLN+GR
Sbjct: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  473 bits (1218), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/284 (81%), Positives = 258/284 (90%), Gaps = 2/284 (0%)

Query: 2   STRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWL 61
           S + I+V+TK+A+P G++ + + YSMYDVKGGSRGVIFDRI+GVK+ V+GEGTHFLVPWL
Sbjct: 4   SAKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 62  QKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPS 121
           QKAIIYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPS 123

Query: 122 IGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTK 181
           IGNEVLKSIVAQFDAAELITQREI+SQ+IRKE+S RANEFGIKLEDVSITHMTFG EFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 182 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRL 241
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 242 EASKDIARTLSKSSNITYLPG--GKGREGDEKTPPNSLLLNIGR 283
           EASKDIA+TL+ SSN+ YLP     G   +    PNSLLLNIGR
Sbjct: 244 EASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  468 bits (1205), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 265/283 (93%), Gaps = 2/283 (0%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           ++AINV++K+AIP+GLL+ A DY+MYDVKGGSRGVIFDR+SGV++ V+GEGTHFLVPWLQ
Sbjct: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KAIIYDVR+KPKSI+TNTGTKDLQMVSLTLR+LHRP V+ELPRIYQ+LGLDYDERVLPSI
Sbjct: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLKSIVAQFDAAELITQRE+VSQRIR+E+S RA EFGI+LEDVSITHMTFGAEFTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERA+FLVEKAEQ RQASVIRAEGEAESAE ISKAL++VGDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLE 241

Query: 243 ASKDIARTLSKSSNITYLP--GGKGREGDEKTPPNSLLLNIGR 283
           ASK+IARTLS+SSN+TYLP  G  G+ G E    N+LLLNIGR
Sbjct: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  466 bits (1199), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/285 (77%), Positives = 259/285 (90%), Gaps = 2/285 (0%)

Query: 1   MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW 60
           MST+ ++ + K+A+P G+ ++ + Y+MYDVKGGSR VIFDR+SGVK+ VIGEGTHFL PW
Sbjct: 1   MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW 60

Query: 61  LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP 120
           LQKAI++DVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP+V +LP IYQNLGLDYDERVLP
Sbjct: 61  LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT 180
           SIGNEVLK+IVAQFDAAELITQREIVS +IR+E+S R+NEFGIKLEDVSITHMTFG EFT
Sbjct: 121 SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT 180

Query: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR 240
           KAVEQKQIAQQDAERA+FLVE+AEQERQA+VIRAEGEAESAE ISKAL++ GDGLLLIRR
Sbjct: 181 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRR 240

Query: 241 LEASKDIARTLSKSSNITYLPGGKGREGDEKTP--PNSLLLNIGR 283
           LEASK+IA+TLS+SSN+TYLP G    G+ ++   PNSLLLN+GR
Sbjct: 241 LEASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  465 bits (1196), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 232/284 (81%), Positives = 259/284 (91%), Gaps = 2/284 (0%)

Query: 2   STRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWL 61
           ++R I+V+TK+A+P G++ T + Y+MYDVKGGSRGVIFDRI+GVK+ V+GEGTHFLVPWL
Sbjct: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 62  QKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPS 121
           QKAIIYDVRTKPKSI+TNTGT+DLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123

Query: 122 IGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTK 181
           IGNEVLKSIVAQFDAAELITQREI+SQ+IRKE+S RANEFGIKLEDVSITHMTFG EFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 182 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRL 241
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 242 EASKDIARTLSKSSNITYLPG--GKGREGDEKTPPNSLLLNIGR 283
           EASKDIA+TL+ SSN+ YLP        GD    PNSLLLNIGR
Sbjct: 244 EASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/275 (80%), Positives = 251/275 (91%), Gaps = 2/275 (0%)

Query: 9   VTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYD 68
           + K+AIP G+ ++ +DYSMYDVKGGSR VIFDRI GVK+AV+GEGTHFLVPWLQK++I+D
Sbjct: 10  LAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFD 69

Query: 69  VRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLK 128
           +RTKPK+I+TNTGT+DLQMVSLTLRLLHRP++V+LP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 70  IRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLK 129

Query: 129 SIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQI 188
           SIVAQFDAAELITQREIVSQRIRKE++HRANEFGI+LEDVSITHMTFG EFTKAVEQKQI
Sbjct: 130 SIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 189

Query: 189 AQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIA 248
           AQQDAERA+FLVEKAEQERQASVIRAEGEAESAE IS+AL + GDGLLLIRRLE SK+IA
Sbjct: 190 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIA 249

Query: 249 RTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283
            TL+ S ++TYLPGG  +   E    NSLLLN+GR
Sbjct: 250 ETLAGSPHVTYLPGGGNQA--EDASKNSLLLNLGR 282

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  459 bits (1181), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/283 (78%), Positives = 255/283 (90%), Gaps = 3/283 (1%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           ++ I+ V K+A+P G++++ + +SMYDVKGGSR VIFDRISGVK+ +IGEGTHFL+PWLQ
Sbjct: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KAIIYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP+VV+LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
            NEVLK+IVAQFDAAELITQRE+VS RIR E+  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VE KQIAQQDAERA+FLVEKAEQERQA+VIRAEGEAESAE ISKAL + GDGLLLIRRLE
Sbjct: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241

Query: 243 ASKDIARTLSKSSNITYLPGGKG--REGDEKTPPNSLLLNIGR 283
           ASK+IA TLS+SSN+TYLP G G  R G + T PN+LLLN+GR
Sbjct: 242 ASKEIAATLSQSSNVTYLPNGHGNARGGSDGT-PNTLLLNLGR 283

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  457 bits (1177), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/279 (78%), Positives = 254/279 (91%), Gaps = 2/279 (0%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R +  + ++AIP G++++ V YSMYDV+GGSR VIFDR+SGV+K V+GEGTHFLVPWLQ
Sbjct: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KAI+YD+RTKPK I+TNTGTKD+QMVSLTLR+LHRP+V++LPRIYQNLGLDYDERVLPSI
Sbjct: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLK+IVAQFDAAELITQRE+VSQRIR E+SHRA+EFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERA+FLVEKAEQ R+ASVIRAEGEAESAE ISKAL+R GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241

Query: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNI 281
           ASK+IA+TL+ SSNITYLPG     G+ +   NSLLLNI
Sbjct: 242 ASKEIAQTLAASSNITYLPGKA--HGNTEGSQNSLLLNI 278

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  455 bits (1171), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/275 (78%), Positives = 250/275 (90%)

Query: 9   VTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYD 68
           + ++A+P G+  +A+ YSMYDVKGG+R VIFDR+SGV++ VIGEGTHFLVPWLQ+AI+YD
Sbjct: 8   LARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYD 67

Query: 69  VRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLK 128
           VRTKPK+I+TNTGTKDLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 68  VRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLK 127

Query: 129 SIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQI 188
           +IVAQFDAAELITQREIVSQRIRKE+S RA EF I+LEDVSITHMTFG EFTKAVEQKQI
Sbjct: 128 AIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQI 187

Query: 189 AQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIA 248
           AQQDAERA+FLVE+AEQERQA+VIRAEGEAESA+ ISKALS+ GDGLLLIRRLEASK+IA
Sbjct: 188 AQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIA 247

Query: 249 RTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283
           +TL+ SSN+TYLP       +++  PNSLLLN+GR
Sbjct: 248 QTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  452 bits (1164), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/281 (77%), Positives = 252/281 (89%), Gaps = 2/281 (0%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R  + + K+A+P GL  +A+ YSMYDVKGGSR VIFDR+SGV++ V+GEGTHFLVPWLQ
Sbjct: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KA++YDVRTKPK+I+TNTGTKDLQMVSLTLR+LHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLK+IVAQFDAAELITQRE VSQRIR+E+S RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERAR++VE AEQERQASVIRAEGEAESAE ISKAL++ GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283
           ASK+IA+TL+ SSN+TYLP        E+  PNSLLLN+GR
Sbjct: 242 ASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  435 bits (1118), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/262 (78%), Positives = 241/262 (91%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R  + + K+A+P GL  +A+ YSMYDVKGGSR VIFDR+SGV++ V+GEGTHFL+PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KA+++DVRTKPK+I+TNTGTKDLQMVSLTLR+LHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLKSIVAQFDAAELITQRE VSQRIR+E+S RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VEQKQIAQQDAERARF+VE AEQERQASVIRAEGEAESAE ISKAL++ GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 243 ASKDIARTLSKSSNITYLPGGK 264
           ASK+IA+TL+ SSN+TYLP  +
Sbjct: 242 ASKEIAKTLANSSNVTYLPSNQ 263

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  424 bits (1091), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 214/283 (75%), Positives = 249/283 (87%), Gaps = 1/283 (0%)

Query: 1   MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW 60
           MS+R    V K+AIP G++ + + YSMYDV+GGSR VIFDR+SGV++ V+GEGTHFLVPW
Sbjct: 1   MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW 60

Query: 61  LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP 120
           LQKA+IYDVRTKPKSI+TNTGTKD+QMVSLTLR+LHRP V++LP IYQNLGLDYDERVLP
Sbjct: 61  LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT 180
           SIGNEVLK+IVA++DAAELITQRE+VS  IR E+S+RA+EF I+LEDVSITHMTFG EFT
Sbjct: 121 SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT 180

Query: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR 240
           KAVE KQIAQQDAERA+FLVEKAEQ R+ SVIRAEGEAE+AE ISKAL++ GDGLLLIRR
Sbjct: 181 KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRR 240

Query: 241 LEASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283
           LEASKDIA+TL+ SSN+TYLP  +   G E T   SLLLN+GR
Sbjct: 241 LEASKDIAQTLANSSNVTYLPSQQSGGGQEGT-SQSLLLNLGR 282

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  414 bits (1065), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 196/282 (69%), Positives = 245/282 (86%), Gaps = 1/282 (0%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R +  +  +A+P G+ + A    +YDV+GG+R VIFDR+SGV++ V+GEGTHFL+PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           KA+IYDVRTKPK+I+TNTGTKDLQ+V+LTLR+LHRP+V+ LP+IYQ LGLDYDERVLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLK+IVAQFDAAELITQRE+VSQ+IR+E++ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242
           VE+KQIAQQ++ERA++LV+ AEQER A+VIRAEG+AE+AE ISKAL++ GDGLL+IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 243 ASKDIARTLSKSSNITYLP-GGKGREGDEKTPPNSLLLNIGR 283
           ASK IA+TL+ SSNITYLP   KG   D    P+SLLLN+GR
Sbjct: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  396 bits (1018), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/269 (73%), Positives = 238/269 (88%), Gaps = 2/269 (0%)

Query: 15  PSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPK 74
           P  L  +AV +SMYDV+GG+R +IFDRISGVK  V+GEGTHFL+PWLQKAII+DVRTKP+
Sbjct: 17  PIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPR 76

Query: 75  SISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQF 134
           +I+TNTGTKDLQMVSLTLR+LHRP+V+ L RIY+ LG DYDERVLPSIGNEVLK+IVAQF
Sbjct: 77  NIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQF 136

Query: 135 DAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAE 194
           +A+ELITQRE+VSQ+IR E++ RA+EF I+LEDVSITHMTFG EFTKAVEQKQIAQQ+++
Sbjct: 137 NASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESD 196

Query: 195 RARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKS 254
           RA+F+VE+AEQER+A+VIRAEGEAE+AE ISKAL + GDGLL+IRRLEASK IA TL+ S
Sbjct: 197 RAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANS 256

Query: 255 SNITYLPGGKGREGDEKTPPNSLLLNIGR 283
            N+TYLP  KG+  D    PNSLLLN+GR
Sbjct: 257 PNVTYLP-SKGQAADSGA-PNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  369 bits (947), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 172/213 (80%), Positives = 200/213 (93%)

Query: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62
           +R  +V+ ++AIP GL ++A+ YSMYDV+GG R VIFDR+ GV++AVIGEGTHFLVPWLQ
Sbjct: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61

Query: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122
           K+I++DVRTKPK+I+TNTGTKDLQMVSLTLR+LHRP+V++LP+IYQNLG+DYDERVLPSI
Sbjct: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121

Query: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182
           GNEVLK+IVAQFDAAELITQREIVSQRIR E+S RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181

Query: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAE 215
           VEQKQIAQQDAERARFLVEKAEQER+A+VIRAE
Sbjct: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  283 bits (724), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 186/241 (77%), Gaps = 4/241 (1%)

Query: 16  SGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKS 75
           S +LL +   ++++V GG R +++ RISGV   +  EGTHF +PW++  IIYDVR KP++
Sbjct: 55  SAMLLNS---ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRN 111

Query: 76  ISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFD 135
           +++ TGTKDLQMV++T R+L RPNV +LP IY+ LG DYDERVLPSI NEVLK++VAQF+
Sbjct: 112 VASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 171

Query: 136 AAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAER 195
           A++LITQRE VS+ IR+ +  RAN F I L+DVSIT MTF  EFT AVE KQIAQQDA+R
Sbjct: 172 ASQLITQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQR 231

Query: 196 ARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSS 255
           A F+V+KA QE+Q  V+RA+GEA+SAE I  A+ +  D + L +RL+ +++IAR L+KS 
Sbjct: 232 AAFVVDKARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSP 290

Query: 256 N 256
           N
Sbjct: 291 N 291

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  282 bits (722), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           S+++V GG R +++ R+SGV   +  EGTHF++PWLQ  IIYDVR KP+++++ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP++  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA +F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ SKDIA+ L+ SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  281 bits (719), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 133/234 (56%), Positives = 184/234 (78%), Gaps = 1/234 (0%)

Query: 23  VDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGT 82
           ++ ++++V GG R +++ RI GV   +  EGTHF+ PWL   IIYDVR KP+++++ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 142
           KDLQMV++T R+L RP+VV+LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEK 202
           RE VS+ IR+ +  RA++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           A QE+Q  V+RA+GEA+SAE I +A+ +  D + L +RL+ ++DIA+ L+ S N
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  280 bits (717), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           S+++V GG R +++ R+SGV+++V GEGTHF++PWL+  ++YDVR+KP+++S+ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR  +  RA+ F I L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q+ +++A+GEA+SAE I +A+ +  D + L +RL+ +++IA  L+ S N
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  280 bits (716), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           S+++V GG R +++ RISGV   +  EGTHF++PW++  IIYDVR KP+++++ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RPNV  LP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  R++ F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V+RA+GEA+SAE I +A+ +  D + L +RL+ +++IA  L+KS N
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPN 288

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  280 bits (716), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 131/234 (55%), Positives = 184/234 (78%), Gaps = 1/234 (0%)

Query: 23  VDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGT 82
           ++ ++++V GG R +++ RI GV   +  EGTHF+ PWL   I+YDVR KP+++++ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 142
           KDLQMV++T R+L RP+VV+LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEK 202
           RE VS+ IR+ +  RA++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           A QE+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ ++DIA+ L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  280 bits (715), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 131/231 (56%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           ++++V GG R +++ RI GV   +  EGTHF++PW++  +IYDVR KP+++++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RPNV +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR  +  RA +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +KDIA  L+KS N
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPN 287

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  279 bits (713), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 133/234 (56%), Positives = 181/234 (77%), Gaps = 1/234 (0%)

Query: 23  VDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGT 82
           V+ ++++V GG R +++ RI GV   +  EGTHF+ PWL   IIYDVR KP+++++ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 142
           KDLQMV++T R+L RP+V +LP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEK 202
           RE VS+ IR+ +  RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           A QE+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ ++DIA+ L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPN 286

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  278 bits (712), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 131/234 (55%), Positives = 185/234 (79%), Gaps = 1/234 (0%)

Query: 23  VDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGT 82
           V+ ++++V GG R +++ R+ G+++ +  EGTHF VPWL+  I+YDVR KP+++++ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 83  KDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 142
           KDLQMV++T R+L RP V +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEK 202
           RE VS+ IR+ +  RA++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 203 AEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           A QE+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +++IA  LSKS N
Sbjct: 235 ARQEKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPN 287

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  277 bits (709), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           S+++V GG R +I+ R++GV+  +  EGTHF +PW +  I+YDVR KP+++++ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RPNV +LP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +++IA  LS+S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPN 286

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  277 bits (709), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 187/245 (76%), Gaps = 3/245 (1%)

Query: 12  LAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRT 71
           L + +G L    + ++++V GG R +++ RI GV + +  EGTH ++PW++  I+YDVR 
Sbjct: 47  LVLGAGALF--FNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRA 104

Query: 72  KPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIV 131
           KP+++++ TGTKDLQMV++T R+L RPNV +LP IY+ LG DYDERVLPSI NEVLK++V
Sbjct: 105 KPRNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVV 164

Query: 132 AQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQ 191
           AQF+A++LITQRE VS+ IR  +  RA+ F I L+DVSIT+MTF  EFT+AVE KQIAQQ
Sbjct: 165 AQFNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQ 224

Query: 192 DAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTL 251
           DA+RA F+V+KA QE+Q  V++A+GEA+SAE I  A+ +  D + L +RL+ +KDIA+ L
Sbjct: 225 DAQRAAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKIL 283

Query: 252 SKSSN 256
           + S N
Sbjct: 284 ANSPN 288

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  276 bits (707), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           S+++V GG R +++ R++GV+  +  EGTHF +PWL+  I+YDVR KP+++++ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP+V +LP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA++F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +++IA  LS S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPN 286

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  276 bits (707), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 131/231 (56%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           S+++V GG R +++ RI+GV   +  EGTHF++PWL+  I+YDVR KP+++++ TGTKDL
Sbjct: 56  SLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGTKDL 115

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 116 QMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 175

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA++F I L+DVSIT MTF  EFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 176 VSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 235

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +++IAR L+ S N
Sbjct: 236 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPN 285

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  276 bits (706), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 130/234 (55%), Positives = 183/234 (78%), Gaps = 1/234 (0%)

Query: 23  VDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGT 82
           V+ ++++V GG R +++ R++GV   +  EGTHF+ PW+   IIYDVR KP+++++ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 142
           KDLQMV++T R+L RP+V +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEK 202
           RE VS+ IR+ +  RA+ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           A QE+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ ++DIA+ L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPN 286

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  276 bits (706), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 127/231 (54%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           ++++V GG R +++ RI+GV+  +  EGTHF++PW++  ++YDVR KP+++S+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RPNV  LP IY+ LG+DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA  F I L+DVSIT+MTF  EFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  +++A+GEA+SAE I +A+ +  D + L +RL+ +++IA  LS+S N
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPN 287

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  275 bits (704), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           ++++V GG R +++ RI GV   +  EGTHF++PWL+  ++YDVR KP+++++ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP+V +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ + +RA  F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +++IA  L+KS N
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPN 289

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  272 bits (696), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 129/231 (55%), Positives = 180/231 (77%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           ++++V GG R +++ RI GV   +  EGTHF++PWL+  I+YDVR KP+++++ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP+V +LP +Y+ LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA+ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A GEA+SAE I +A+ +  D + L +RL+ +K+IA  L+ S N
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPN 264

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  271 bits (694), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 183/234 (78%), Gaps = 1/234 (0%)

Query: 23  VDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGT 82
           ++ ++++V GG R +++ RI GV   +  EGTH ++PWL+  ++YDVR KP+++++ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 83  KDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 142
           KDLQMV++T R+L RPNV +LP IY+ LG DY ERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEK 202
           RE VS+ IR+ +  RA+ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 203 AEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           A QE+Q  V++A+GEA+SAE I +A+ +  D + L +RL+ +++IA+ L++S N
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPN 288

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  270 bits (690), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 127/231 (54%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 26  SMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPKSISTNTGTKDL 85
           ++++V GG R +++ RI GV   +  EGTH L+PW +  ++YDVR KP+++++ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 86  QMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 145
           QMV++T R+L RP+V +LP IY+ LGLDYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 146 VSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAERARFLVEKAEQ 205
           VS+ IR+ +  RA+ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 206 ERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKSSN 256
           E+Q  V++A+G+A+SAE I +A+ +  D + L +RL+ +++IA+ LS+S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPN 289

>KNAG0A01380 Chr1 complement(43745..45580) [1836 bp, 611 aa] {ON}
           Anc_3.50 YOL122C
          Length = 611

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 5   AINVVTKLAIPSGLLLTAVDY--SMYDVKGGSRGVIFDRI--SGVKKAVIGEGTHFLV 58
           A+N++ K+ +P+G+ +T +D    M+  K GS  + F ++   GV   VIG    F +
Sbjct: 214 ALNILIKVPLPAGVAITVIDVFTVMFGYKPGSSSIKFVKMFEYGVATLVIGVCICFAI 271

>ABL164C Chr2 complement(91563..92645) [1083 bp, 360 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL226C
           (GCS1) and YNL204C (SPS18)
          Length = 360

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 44/87 (50%), Gaps = 9/87 (10%)

Query: 143 REIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQ------QDAERA 196
           + + S  +  E    A +FG K ++ S + ++  + +TK ++Q+ + Q      QD++ +
Sbjct: 269 QHLQSSELSAEAQRAAQQFGQKFQETSSSGISAFSRWTKNLQQQYVQQSPGAPDQDSQYS 328

Query: 197 RFLVEKAEQERQASVIRAE---GEAES 220
           R       + +  S +RA+   GEA++
Sbjct: 329 RLFDSLESRSKDHSQLRAQKKGGEADT 355

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 9/52 (17%)

Query: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAE-SAECISKALSRV 231
           KAV+QK++AQQDA RA+       +ER  SV +A  +AE +A+ IS A+S +
Sbjct: 43  KAVKQKKLAQQDAARAK-------KERLTSV-QAFLQAELAADPISTAVSEM 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,762,474
Number of extensions: 972855
Number of successful extensions: 3197
Number of sequences better than 10.0: 65
Number of HSP's gapped: 3293
Number of HSP's successfully gapped: 65
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)