Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019703.493ON1791797093e-96
Smik_16.4023.493ON1731794663e-59
YPR149W (NCE102)3.493ON1731794647e-59
Skud_16.4443.493ON1731794438e-56
CAGL0I10494g3.493ON1721804438e-56
NDAI0G009303.493ON1761794333e-54
NCAS0E008003.493ON1741794248e-53
CAGL0L08448g3.493ON1731794231e-52
Suva_16.4783.493ON1661794115e-51
KNAG0B008003.493ON1821833934e-48
KAFR0G037003.493ON1861773875e-47
TDEL0D056103.493ON1751793673e-44
NDAI0B058803.493ON1821833641e-43
ZYRO0D09966g3.493ON1781793518e-42
YGR131W (FHN1)3.493ON1741793473e-41
Suva_7.4193.493ON1741793457e-41
KNAG0A079503.493ON1821833458e-41
KLTH0F14850g3.493ON1711793403e-40
KLLA0D16280g3.493ON1691793324e-39
TPHA0D032803.493ON1841853283e-38
Smik_6.2273.493ON1741793264e-38
SAKL0F02750g3.493ON1701463265e-38
Kpol_1017.63.493ON1871893251e-37
Skud_7.4423.493ON1741793231e-37
Kwal_55.212383.493ON1701793222e-37
TBLA0D029603.493ON1891513199e-37
NCAS0F035603.493ON1831523101e-35
TBLA0C044903.493ON1861513068e-35
Ecym_12363.493ON1691792473e-26
AFR312W3.493ON1681462134e-21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01970
         (179 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   277   3e-96
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   184   3e-59
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   183   7e-59
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   175   8e-56
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   175   8e-56
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   171   3e-54
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   167   8e-53
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   167   1e-52
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   162   5e-51
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   155   4e-48
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   153   5e-47
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   145   3e-44
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   144   1e-43
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   139   8e-42
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   138   3e-41
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   137   7e-41
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   137   8e-41
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   135   3e-40
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   132   4e-39
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   130   3e-38
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   130   4e-38
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   130   5e-38
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   129   1e-37
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   129   1e-37
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   128   2e-37
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   127   9e-37
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   124   1e-35
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   122   8e-35
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   100   3e-26
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...    87   4e-21

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  277 bits (709), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 140/179 (78%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           MLGVADNILRLINAVF            NTQNGHHNSRVNYCMFACAFGLFFDSIYGICA
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFFQVLAWPLLLFTLD               VGIRAHSCGNQSYLDSNKIVRGSGQRCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQALVAFLYFSTAIFIAKMIMSCINLFQNGA            KKHATDVGGVPNISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  184 bits (466), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 115/179 (64%), Gaps = 6/179 (3%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML +ADNILR+IN +F            NTQ+  H+SRVNYCMFACA+G+F DS+YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQD-KHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF + LAWPL+LFTLD               VGIRAHSC N SY+DSNKI +GSG RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAFLYFS AIF+AK +MS  N+  NGA            K+  T   GVP ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGA-----FGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  183 bits (464), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 115/179 (64%), Gaps = 6/179 (3%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML +ADNILR+IN +F            NTQ+  H+SRVNYCMFACA+G+F DS+YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQH-RHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF + LAWPL+LFTLD               VGIRAHSC N SY+DSNKI +GSG RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAFLYFS AIF+AK +MS  N+  NGA            K+  T   GVP ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGA-----FGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  175 bits (443), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 94/179 (52%), Positives = 114/179 (63%), Gaps = 6/179 (3%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML  ADNILR+IN +F            NTQ+  ++SRVN+CMFA A+G+F DS+YG+ A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQD-RNSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFF+ LAWPL+LFTLD               VGIRAHSC N+SY+DSN I +GSG RCR+
Sbjct: 60  NFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAFLYFS AIF+AK +MS  N+  NGA            K+  T   GVP ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGA-----FGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  175 bits (443), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 95/180 (52%), Positives = 118/180 (65%), Gaps = 9/180 (5%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML VADN+LR++NAVF            NT+   H+SRVN+C+FA A+G+  DS+YGI A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRK-RHSSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLD-SNKIVRGSGQRCR 119
           NFF+ LAWPL+LF LD               VGIRAHSC N+ YL+   KIV+GSG RCR
Sbjct: 60  NFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +AQALVAF YFS AIF+AKMIMS +++  NGA            +KH T+V GVP+ISQV
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGA------FGAKLRRKHHTEV-GVPSISQV 172

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  171 bits (433), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 111/179 (62%), Gaps = 3/179 (1%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML VADN+LRL+NA+F            NTQ GH NSR+NYCMF C + L  DS +GI A
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGH-NSRINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFF+ L++P +LFTLD                GIR+HSC NQSYLD NKI +GSG RCRE
Sbjct: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +QALVAF YFS  IF+ K+ MS I++ QNGA            +++     GVP+ISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA--FSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  167 bits (424), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 115/179 (64%), Gaps = 5/179 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           MLGVADN+LR++NAVF            NT+  H+NSR+NYCMF CA+ L  DSIYGI A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKT-HNNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFF +LA P L F LD                GIRAHSC ++ Y++SNKI +G   RCRE
Sbjct: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +QALVAF YFS AIF+AK+IMS IN+ QNGA            +++A ++ GVP+ISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGA---FTQHIGRRRRRNAAEI-GVPSISQV 174

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  167 bits (423), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 117/179 (65%), Gaps = 6/179 (3%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML V DN+LR++N VF             T++  H+SRVNYCMFA A+G+  DS+YG+ A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRD-RHSSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFF++LAWPL+LFTLD               VGIRAHSC N  Y ++NKI++GS +RCRE
Sbjct: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +QA VAF +FS AIF+AKMIMS +N+F NGA            +++  +V GVP++SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGA----FGTKFIRRRRNNAEV-GVPSVSQV 173

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  162 bits (411), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 109/179 (60%), Gaps = 13/179 (7%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML   DNILR+IN +F            NTQ+G+ +SR+NYCMFA A+ +  DS+YG+ A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGN-SSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFF+ LAWPL+LF+LD                 IRAHSC NQ+YL SN I +GSG RCRE
Sbjct: 60  NFFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAFLYFS AIF+AK +MS  N+  NGA            K+  T   GVP ISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGA-----FGSGSFSKRRRTGQVGVPTISQV 166

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  155 bits (393), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 104/183 (56%), Gaps = 5/183 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           MLGVADN+LRL+N  F            NTQ   H SRVNYCMFA A+G+  D +YG+ A
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQK-FHISRVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF++ LAWPL+LFTLD               VGIRAHSC N  Y + N I++GS  RCR 
Sbjct: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXX----XXXXXKKHATDVGGVPNI 176
           +QA  AF +FS  IFIAKM+MS INL  NGA                     +  GVP+I
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSI 179

Query: 177 SQV 179
           SQV
Sbjct: 180 SQV 182

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  153 bits (387), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 101/177 (57%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML +ADN LRL+N  F            NT+ GH+++RVNYCMFA AFG+  DSIYG+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NFF+ LAWP++LF  D               VGIRAH+C N++Y +SNKIVRGS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNIS 177
           AQA VAF YFS AIF+ K + S +     G             +K  +   GVP  S
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTS 177

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  145 bits (367), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 102/179 (56%), Gaps = 4/179 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LRL+N  F            ++++GH +SRVN+CMFA AFG+  DS YGI A
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGH-SSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           N ++V AWP++LF LD               VGIR HSC NQ YLDSN I +GS QRCR 
Sbjct: 60  NIWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAF YFS  IF+AKMIMS I +  NG             K       GVP ISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQV---GVPTISQV 175

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  144 bits (364), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 102/183 (55%), Gaps = 5/183 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML   DNILR+INA+F            NTQ  +++SR+N+CMFA AFGL  DS +G+  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQR-NNSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NFFQVLA-WPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119
           N F  LA WP+LLF  D               V IRAHSC N+ Y++SN I +GS  RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQN---GAXXXXXXXXXXXXKKHATDVGGVPNI 176
            +QA VAF YFS  IF+AKMIMS IN+  N   G+             +   +  GVP I
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 177 SQV 179
           SQV
Sbjct: 180 SQV 182

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  139 bits (351), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 102/179 (56%), Gaps = 1/179 (0%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DNILR +N  F             ++   HNSRVN+CMFA AFG+  DS YGI A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           N F   A+P++LF LD               VGIR HSC N+ YLDSNKI +GS  RCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA+VAF YF+  IF+ KM+MS ++L  NGA            +    +V GVP ISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANV-GVPTISQV 178

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  138 bits (347), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 100/179 (55%), Gaps = 5/179 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML  ADN++R+INAVF             TQ   H+SRVN+CMFA  +GL  DS+YG  A
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQT-KHSSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF+  L +P +L  LD               VGIR HSC N++YL+ NKI++GS  RC +
Sbjct: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +QA VAF YFS  +F+ K+ ++ + + QNG             ++ A    G+P ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGG----FGSNTGFSRRRARRQMGIPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  137 bits (345), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 103/179 (57%), Gaps = 5/179 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML VADNI+R+INA+F            ++Q   H+SRVN+CMFA A+GL  DS YG  A
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQT-KHSSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           N +  L +P+++F LD               VGIR HSC N++YLD+NKI +GSG RC +
Sbjct: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           A+A V F YFS  +F+ K+++S   + QNG             ++ A    G+P ISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGG----FGFGNSFGRRRARRQMGIPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  137 bits (345), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 107/183 (58%), Gaps = 5/183 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML +AD  LRL+N VF            NTQ+GH +SR+NYCMF  A+G+  DS YG+ A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGH-SSRINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF++ L+WPLLL  LD               VGIRAHSC N +Y + NKIV+GS  RCR+
Sbjct: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNG----AXXXXXXXXXXXXKKHATDVGGVPNI 176
           AQA VAF +FS AIF+AK IMS +N+F NG    A            K+      GVPNI
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179

Query: 177 SQV 179
           S V
Sbjct: 180 STV 182

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  135 bits (340), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 93/179 (51%), Gaps = 8/179 (4%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LR +N  F             T   H+N +VN+ +F  AFGL FDS+Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF   LAWPLL+   D               V IR HSC NQ YLDSN + +GS  RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAFLYFS  IF+AK+ +S +NL   GA                T   GVP ISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGA--------FGAGSSRRTGNVGVPTISQV 171

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  132 bits (332), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 94/179 (52%), Gaps = 10/179 (5%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LR +N VF             TQ+ H +SRVN+ +FA  FG+ FDS+Y + A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQD-HSSSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF   LAWP++L +LD               VGIR  SC N S+   NKI  GS  RCR+
Sbjct: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA   FLYFS AIF+ K I+S +N   +GA                T V GVP ISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGA--------FGTSSNRKTQV-GVPTISQV 169

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  130 bits (328), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 98/185 (52%), Gaps = 7/185 (3%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           MLG+ADNILR +N  F             TQN  H+SRVNYC+F   F L  D+ YG  A
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQN-QHSSRVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NFFQV-LAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119
           N +   LAWP++LF  D               VG R HSC NQSYLDSN I +GS  RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVG-----GVP 174
           +AQA  AF YFS  IF+AK+IMS INLF NGA                         GVP
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVP 179

Query: 175 NISQV 179
           NISQV
Sbjct: 180 NISQV 184

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  130 bits (326), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML  ADN++R+INAVF            +TQ   H+SRVN+CMF  A+GL  DS+YG  A
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQ-AKHSSRVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF+  L +P +L  LD               VGIR HSC N++YL+ NKI + S  RC +
Sbjct: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +QA VAF YFS  +F+ K+ ++     QNG             ++ A    GVP ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGG----FGFNSGFGRRRARRQLGVPTISQV 174

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  130 bits (326), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 83/146 (56%), Gaps = 1/146 (0%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LRL+N  F             TQ+  H+ RVN+ +F  AF L  DS Y + A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQD-EHSPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           N F   AWP+LL T D               VGIR HSC N+SYL SN I +GS  RCR+
Sbjct: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINL 146
           AQA VAFLYFS  IF+ K+++S IN+
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINV 145

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  129 bits (325), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 103/189 (54%), Gaps = 12/189 (6%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML +ADNI+R IN  F             T+ GH +SRVNYCMF   F +  DS YGI A
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGH-SSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  NFFQV-LAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119
           N +    AWP++LF  D               VGIR HSC N++Y+D+NKI++GS  RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVG-------- 171
           +AQA +AF YFS  IF  K++MS INL  NGA            + H  ++G        
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLSNGA-MGFSTPSIGRRRHHTANIGVPGASSPQ 178

Query: 172 -GVPNISQV 179
            GVPNISQV
Sbjct: 179 VGVPNISQV 187

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  129 bits (323), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML  ADN++R+++AVF             TQ  + +SRVN+CMFA A+GL  DS YG  A
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQT-NGSSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF+  L +P +L  LD               VGIR HSC N++YL+ N I +GS  RC +
Sbjct: 60  NFWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           +QA VAF YFS  +F+ K+ +S   + QNG             ++ A    GVP ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGG----FGFNTGYGRRRARRQMGVPTISQV 174

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  128 bits (322), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 99/179 (55%), Gaps = 9/179 (5%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LR  N VF             T++ ++N +VN+ +FA AFGL FD++Y I A
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRD-NNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF   LAWPLL+   D               V IR HSC N  Y+D+NK+ +GS  RCR+
Sbjct: 60  NFISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
           AQA VAFLYF+  +F+ K+ +S +N+F  GA             + + +V GVP ISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGA-------FSTSSGRKSANV-GVPTISQV 170

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  127 bits (319), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 86/151 (56%), Gaps = 1/151 (0%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN+ R+ N  F            NT++GHH+SRVNYCMF  A+GL  DS YGI A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NFF-QVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119
           N   +  A+P +LF  D               VGIR HSC N+ Y   N I++GS +RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNG 150
           EAQA +AF YFS  +F+ K++++ +  F  G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGG 151

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  124 bits (310), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/152 (48%), Positives = 92/152 (60%), Gaps = 2/152 (1%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML   DN LR  N +F            +TQN H +SRVNYCMFA AFGL  DS +G+ A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQN-HGSSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NFFQVLA-WPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119
           N    L+ WP++LF  D               VGIR HSC N+ YL+SNKI++GSG RCR
Sbjct: 60  NLIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGA 151
            +QA VAF YF+  +F+AKMIMS I++  NGA
Sbjct: 120 VSQAAVAFFYFAAFVFLAKMIMSAISMASNGA 151

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  122 bits (306), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 85/151 (56%), Gaps = 1/151 (0%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML    N+LR+IN  F             ++   H+ RVNYCMFA  F L  DS Y I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NFFQ-VLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119
           NF+    AWP+LL++ D               VGIR HSC N+ YL SNKI +GS +RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNG 150
            AQA +AF YFS  I++ +++ S + +++NG
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENG 151

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 99.8 bits (247), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 85/179 (47%), Gaps = 10/179 (5%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LR  N +F            N QN  H SRVN+ +F   F L FDS+Y + A
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF   LAWP+LL T D                 I  HSC N  +L  N I  G   RCR+
Sbjct: 60  NFISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAXXXXXXXXXXXXKKHATDVGGVPNISQV 179
            QA   FL+FS  IF+AK ++S +N+   GA            +K     GGVP ISQV
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGA------FSSGSGRKTG---GGVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score = 86.7 bits (213), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 71/146 (48%), Gaps = 1/146 (0%)

Query: 1   MLGVADNILRLINAVFXXXXXXXXXXXXNTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60
           ML + DN LR +N VF            + Q   H SRVN+ +F   F L  DS Y I A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSH-SRVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NFFQVLAWPLLLFTLDXXXXXXXXXXXXXXXVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120
           NF    AWP++   LD                 I AHSC N+ +LD N I   S  RCR+
Sbjct: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 AQALVAFLYFSTAIFIAKMIMSCINL 146
            QA   FL+FS  IF+AK + S +N+
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNI 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.141    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,860,406
Number of extensions: 352031
Number of successful extensions: 774
Number of sequences better than 10.0: 32
Number of HSP's gapped: 717
Number of HSP's successfully gapped: 32
Length of query: 179
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 77
Effective length of database: 41,785,467
Effective search space: 3217480959
Effective search space used: 3217480959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)