Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019603.492ON56356326770.0
KNAG0B008103.492ON7575855112e-55
NCAS0E008103.492ON6924963621e-35
YGR130C3.492ON8162822768e-25
Skud_7.4413.492ON8072672714e-24
Smik_6.2263.492ON8392712652e-23
Suva_7.4183.492ON8312682633e-23
Kpol_480.143.492ON6993472482e-21
TDEL0D056003.492ON7003142383e-20
TPHA0D042503.492ON6293142322e-19
NDAI0G009403.492ON6563372285e-19
CAGL0I10516g3.492ON8133572011e-15
SAKL0F02772g3.492ON7732671992e-15
ZYRO0D09988g3.492ON9942671932e-14
KLLA0D16236g3.492ON8713701699e-12
KLTH0F14828g3.492ON8362681618e-11
Kwal_55.212293.492ON7872931539e-10
TBLA0C044803.492ON8021011412e-08
KNAG0A079403.492ON275721186e-06
Ecym_12373.492ON7271841000.002
KAFR0G036903.492ON363107950.005
NCAS0F035503.492ON44181840.14
SAKL0G16720g4.300ON41391761.1
Smik_8.2425.88ON1168105761.3
AFR310C3.492ON62397751.5
Skud_8.2225.88ON1169116742.1
Ecym_53444.237ON1102152715.4
Kwal_55.201245.386ON1220171715.5
YHR158C (KEL1)5.88ON1164130698.5
NOTE: 1 genes in the same pillar as KAFR0C01960 were not hit in these BLAST results
LIST: NDAI0B05860

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01960
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...  1035   0.0  
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   201   2e-55
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   144   1e-35
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   110   8e-25
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   108   4e-24
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   106   2e-23
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   105   3e-23
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   100   2e-21
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    96   3e-20
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    94   2e-19
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    92   5e-19
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    82   1e-15
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    81   2e-15
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    79   2e-14
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    70   9e-12
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    67   8e-11
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    64   9e-10
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    59   2e-08
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    50   6e-06
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    43   0.002
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    41   0.005
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    37   0.14 
SAKL0G16720g Chr7 complement(1445248..1446489) [1242 bp, 413 aa]...    34   1.1  
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    34   1.3  
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    33   1.5  
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    33   2.1  
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    32   5.4  
Kwal_55.20124 s55 complement(259515..263177) [3663 bp, 1220 aa] ...    32   5.5  
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    31   8.5  

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/563 (94%), Positives = 534/563 (94%)

Query: 1   MFKTRSLADEAFDKLLSETTSVKTTDTAKKHQFLSKVNTNKSKENDDENKYNSPFRNNAP 60
           MFKTRSLADEAFDKLLSETTSVKTTDTAKKHQFLSKVNTNKSKENDDENKYNSPFRNNAP
Sbjct: 1   MFKTRSLADEAFDKLLSETTSVKTTDTAKKHQFLSKVNTNKSKENDDENKYNSPFRNNAP 60

Query: 61  SREQKKQLQDLKTAKFPLVSATSTYNTDTKDVYKDLDPKKNFARDIKFPSRLIDNENRQN 120
           SREQKKQLQDLKTAKFPLVSATSTYNTDTKDVYKDLDPKKNFARDIKFPSRLIDNENRQN
Sbjct: 61  SREQKKQLQDLKTAKFPLVSATSTYNTDTKDVYKDLDPKKNFARDIKFPSRLIDNENRQN 120

Query: 121 QILLDLKIKQDALDRLKDSLQVIDVEDLPRXXXXXXXXXXXXXPVPEQPSNNENITDKDA 180
           QILLDLKIKQDALDRLKDSLQVIDVEDLPR             PVPEQPSNNENITDKDA
Sbjct: 121 QILLDLKIKQDALDRLKDSLQVIDVEDLPRDDKEKGEEEKDSDPVPEQPSNNENITDKDA 180

Query: 181 LQDAYDLNSKAATKTDPDIVSHNYSVLNKNNLIDAKDMSIENKLFYLKPIHRKDYPKVQS 240
           LQDAYDLNSKAATKTDPDIVSHNYSVLNKNNLIDAKDMSIENKLFYLKPIHRKDYPKVQS
Sbjct: 181 LQDAYDLNSKAATKTDPDIVSHNYSVLNKNNLIDAKDMSIENKLFYLKPIHRKDYPKVQS 240

Query: 241 TTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLK 300
           TTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLK
Sbjct: 241 TTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLK 300

Query: 301 SEYNEKIKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRK 360
           SEYNEKIKSIQLEKFKT                VIQNKLVKNLMDSTATFSDNKVKILRK
Sbjct: 301 SEYNEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRK 360

Query: 361 TGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFK 420
           TGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFK
Sbjct: 361 TGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFK 420

Query: 421 LSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLELNEMDEQINSKLS 480
           LSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLELNEMDEQINSKLS
Sbjct: 421 LSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLELNEMDEQINSKLS 480

Query: 481 NLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTKLNDKIHNMQELHKNELK 540
           NLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTKLNDKIHNMQELHKNELK
Sbjct: 481 NLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTKLNDKIHNMQELHKNELK 540

Query: 541 NLTERHENSDTYSYVTEEQIQFQ 563
           NLTERHENSDTYSYVTEEQIQFQ
Sbjct: 541 NLTERHENSDTYSYVTEEQIQFQ 563

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  201 bits (511), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 167/585 (28%), Positives = 290/585 (49%), Gaps = 68/585 (11%)

Query: 7   LADEAFDKLLSE---TTSVKTTDTAKKHQFLSKVNTNKSKENDDENKYNSPFRNNAPSRE 63
           +A   +D+L+ E     S++++  + +   +S+ +  ++       +Y SPFR    ++ 
Sbjct: 1   MAIAGYDRLVQEHEDAVSLQSSGASSRGSRVSRGSFRRAIGTAATEEYVSPFRGGQLTKA 60

Query: 64  QKKQLQDLKTAKFPLVSATSTYNT-DTKDV-YKDLDPKKNFARDIKFPSRLIDNENRQNQ 121
            KKQLQ  +T KFP VSATS YN+ +T+++ +  +   +  ARDI FP  L++NE+RQ  
Sbjct: 61  SKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFPEYLLENEDRQRL 120

Query: 122 ILLDLKIKQDALDRLKDSLQVID----------------VEDLPRXXXXXXXXXXXXXPV 165
           IL DL+ ++  L  L+    V+D                +E + R             P 
Sbjct: 121 ILKDLEKREQTLLHLQRCQSVLDRTCKPAKEEKRKELKAIEPVKRDTTNRFAIDYDFVP- 179

Query: 166 PEQPSNNE----NITD---KDALQDAYDLNSKAATKTDP--DIVSHNYS--VLN--KNNL 212
           P  P+  E    +++D   ++ ++DA  +    A   D   D   ++Y   VLN  +N L
Sbjct: 180 PVDPTQEEKDEIDVSDPIVREYIRDARGIPRAEANGGDASGDASGYDYDRDVLNIEQNQL 239

Query: 213 IDAKDMSIENKLFYLKPIHRKDYPK-----------------VQSTTESKF---PVASPE 252
           +DA+ M+++N++ + KP+     PK                 V  +T+ +    PV +P+
Sbjct: 240 VDAQQMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQ 299

Query: 253 ----NKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIK 308
                 E ++KL     +S  V++K+ +D KV+   +  YQ +Q +K  K   EY +K+ 
Sbjct: 300 ATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLA 359

Query: 309 SIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQK 368
            +   K                   VI+N+ +K L DS ATF+D+KVK+L +   +KLQK
Sbjct: 360 QVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQK 419

Query: 369 LNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRN 428
           L +LKF++QK+ L++ E N + +EK   + +++    +L  I + LDA+LFKLSQ N + 
Sbjct: 420 LQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQ 479

Query: 429 ENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLELNE---------MDEQINSKL 479
           + +  +I  L  +K  L  EID+ ++ K + D +   LE  +         + + I  KL
Sbjct: 480 DKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKL 539

Query: 480 SNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTKL 524
            +L ++KQEI  E+LK+  +TN++     E +      +D NTK 
Sbjct: 540 DSLAVVKQEISGERLKLIGITNEMERARAERERIWNEKLDSNTKF 584

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  144 bits (362), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 136/496 (27%), Positives = 247/496 (49%), Gaps = 25/496 (5%)

Query: 22  VKTTDTAKKHQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSA 81
           V TT +  + Q   K+  +++K   D   Y SPFR    +      +Q+ KT +FP VSA
Sbjct: 47  VSTTSSTTQKQPKKKIAASEAKAMSD---YASPFR----AEYSNVNVQNEKTRRFPTVSA 99

Query: 82  TSTYN--TDTKDVYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS 139
           TS Y      +  +  +   +NFA+DI FP+ L +NE RQ   LL L+ K+  L  L+DS
Sbjct: 100 TSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDS 159

Query: 140 LQVIDVEDLPRXXXXXXXXXXXXXPVPEQPSNNENITDKDALQDAYDLNSKAATKTDPDI 199
             +ID+                   + E    + NI++ +   D  D    +A   +  +
Sbjct: 160 QNIIDLTKKQEPKKAPTPVASTTEEIDEATFPHSNISE-EINPDYEDEEQSSAQNNEQLV 218

Query: 200 VSHNYSVLNKNNLIDAK-DMSIENKL-FYLKPIHRKDYPKVQSTTESKFPVASPENKETV 257
           +  +   ++  N+++   D ++   + F L   ++K   + ++  +   PVASP N+E +
Sbjct: 219 LVQSEEEIHTPNVVEPPIDPALAPMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEI 278

Query: 258 VKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSIQLEKFKT 317
           VK      +SK VYDKI++D + + +++  Y+  Q  K      EY + ++ +  +  + 
Sbjct: 279 VKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSEL 338

Query: 318 XXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQKLNELKFLNQ 377
                           V+  +LVK + D      ++K+KI  +T Q+KL+KL+E + +  
Sbjct: 339 NDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLN 398

Query: 378 KRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRNENLEHEINK 437
               +++  + +  EK+  ++ ++    ++  I  ELDAKLFK+SQ N+   NL+++I+ 
Sbjct: 399 DNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDA 458

Query: 438 LQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQINSKLSNLNLIKQ 487
           L S+K  L DEI   + K +H D + K +E          LN++D +IN  L+ + ++KQ
Sbjct: 459 LTSQKNNLQDEI--AKNKNIH-DSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQ 515

Query: 488 EIINEKLKISKLTNDL 503
           E  NEK++++++T  L
Sbjct: 516 ENANEKVQLAEITKKL 531

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  110 bits (276), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 158/282 (56%), Gaps = 16/282 (5%)

Query: 236 PKVQSTTESKF-----PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQN 290
           P   ST +SK      PVA+PEN E +VK      +SK VYDKI +D K++  ++   + 
Sbjct: 382 PTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRA 441

Query: 291 DQLNKLNKLKSEYNEKIKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATF 350
            + +K +    EY EK++ +Q +  +                 V +N+LVK ++D  A  
Sbjct: 442 KEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEH 501

Query: 351 SDNKVKILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEI 410
           ++ K+ IL+ T  +K QKL E   +  K+  ++ E + +N EK + +  FN    +L+ +
Sbjct: 502 NNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNL 561

Query: 411 LQELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDD-------DS 463
            Q+LDA++FK++Q N++   +++EI+ L+ KK+ L+ + +  E KKLH  +       ++
Sbjct: 562 SQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTE--ENKKLHEKNVQVLESVEN 619

Query: 464 KQL--ELNEMDEQINSKLSNLNLIKQEIINEKLKISKLTNDL 503
           K+   ++N++D QI+S L+ + +IKQE  NEK ++S +T  L
Sbjct: 620 KEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRL 661

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 86/153 (56%), Gaps = 11/153 (7%)

Query: 1   MFKTRSLADEAFDKLLSETTSVKTTDTAKK----HQFLSKVNTNKSKENDDENKYNSPFR 56
           +F      D+ F +L++++++      A +    +QFL KV +N+ K  ++   + SPFR
Sbjct: 2   LFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEE---WVSPFR 58

Query: 57  NNAPSREQ--KKQLQDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARDIKFPSRL 112
            +A +  Q  +   +D K  KFP VSATS Y+    KD+ YK++      A+DI+FP+ L
Sbjct: 59  QDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYL 118

Query: 113 IDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
             NE RQ Q+L +L++K+  L  LK   ++ D+
Sbjct: 119 TQNEERQYQLLTELELKEKHLKYLKKCQKITDL 151

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  108 bits (271), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 148/267 (55%), Gaps = 13/267 (4%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           PVA+PEN E +VK      +SK VYDKI +D KV+  ++   +  +  K +   + Y+E+
Sbjct: 389 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSER 448

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           ++ +Q +  +                 V +N+LVK ++D     ++ K+ I + T  +K 
Sbjct: 449 LQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKN 508

Query: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426
           QKL E   +  K+  ++ E + +N  K + +  FN    +L+ + Q+LDA++FK++Q N+
Sbjct: 509 QKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 568

Query: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476
           +   +++EI+ LQ KK+ L+ + +  E KKLH + + + LE          +N++D Q++
Sbjct: 569 KQSKVQNEIDALQKKKEDLIAQTE--ENKKLH-ERNVQTLESVENKEYLPQINDIDNQVS 625

Query: 477 SKLSNLNLIKQEIINEKLKISKLTNDL 503
           + L+ + +I+QE  NEK ++S +T  L
Sbjct: 626 TLLNKMTIIRQENANEKTELSAITKRL 652

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 89/153 (58%), Gaps = 11/153 (7%)

Query: 1   MFKTRSLADEAFDKLLSETTS----VKTTDTAKKHQFLSKVNTNKSKENDDENKYNSPFR 56
           +F T    ++ F +L++++++     +     K +QFL KV +N+ K  ++   + SPFR
Sbjct: 2   LFNTNRQDEDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEE---WVSPFR 58

Query: 57  NNAPSREQKKQL--QDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARDIKFPSRL 112
            +A SR Q  +L   D K  KFP VSATS Y+    KD+ YK++      A+DI+FP+ L
Sbjct: 59  QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYL 118

Query: 113 IDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
             NE RQ Q+L +L++K+  L  LK+  ++ D+
Sbjct: 119 TKNEERQYQLLTELELKEKHLKYLKECQKITDL 151

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 145/271 (53%), Gaps = 21/271 (7%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           PVA+PE  E +VK      +SK VYDKI +D KV+  ++   +  +  K +    EY EK
Sbjct: 421 PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK 480

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           ++ +Q +  +                 V +N+LVK ++D  A  ++ K+ I + T  +K 
Sbjct: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN 540

Query: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426
           QKL E   +  K+  ++ + + +N EK + + +FN    +L+ + Q+LDA++FK++Q N+
Sbjct: 541 QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL 600

Query: 427 RNENLEHEINKLQSKKQTLLDE--------------IDSIEYKKLHPDDDSKQLELNEMD 472
           +   ++ EI+ L+ KK  L+ +              ++S+E ++  P       ++N++D
Sbjct: 601 KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLP-------QINDID 653

Query: 473 EQINSKLSNLNLIKQEIINEKLKISKLTNDL 503
            QI++ L+ + +IKQE  NEK ++S +T  L
Sbjct: 654 NQISTLLNEMTIIKQENANEKTQLSAITKRL 684

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 87/146 (59%), Gaps = 12/146 (8%)

Query: 9   DEAFDKLLSETTSVKTTDTAKK----HQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQ 64
           D+ F +L+++++    +  A++    +QFL KV +N+ K  ++   + SPFR +A + +Q
Sbjct: 10  DDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEE---WISPFRQDALASKQ 66

Query: 65  ---KKQLQDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARDIKFPSRLIDNENRQ 119
              +  ++D K  KFP VSATS Y+    KD+ YK++      A+DI+FP+ L  NE RQ
Sbjct: 67  NNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQ 126

Query: 120 NQILLDLKIKQDALDRLKDSLQVIDV 145
            Q+L +L++K+  L  LK   ++ D+
Sbjct: 127 YQLLTELELKEKHLQYLKKCQKITDL 152

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 151/268 (56%), Gaps = 15/268 (5%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           PVA+PEN E +VK      +SK VYDKI +D K++  ++V  +  +  K +   +EY EK
Sbjct: 412 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEK 471

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           ++ +Q +  +                 V +N+LVK ++D     ++ K+ I + T  +K 
Sbjct: 472 LQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKK 531

Query: 367 QKLNEL-KFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDN 425
           QKL E  + LN++ N ++ E + +N EK + +  FN    +L+ + Q+LDA++FK++Q N
Sbjct: 532 QKLEEKNEVLNKQTN-VKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQIN 590

Query: 426 IRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQI 475
           ++    ++EI+ L+ +K+ L+ + +  E KKLH + + + LE          +N++D QI
Sbjct: 591 LKQSKAQNEIDNLEKQKKDLITQTE--ENKKLH-EKNVEVLESVENKEYLPQINDIDTQI 647

Query: 476 NSKLSNLNLIKQEIINEKLKISKLTNDL 503
           ++ L+ + +I+QE  NE+  +S +T  L
Sbjct: 648 STLLNQMTIIRQENANERTHLSAITKKL 675

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (56%), Gaps = 9/151 (5%)

Query: 1   MFKTRSLADEAFDKLLSETTSVKTTDTA--KKHQFLSKVNTNKSKENDDENKYNSPFRNN 58
           +F T    D+ F +L++++++         K +QFL KV +N+ K  +D   + SPFR +
Sbjct: 2   LFNTSRQEDDPFTQLINQSSAQNQQVQQQEKPYQFLQKVVSNEPKGKED---WVSPFRQD 58

Query: 59  APSREQKKQL--QDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARDIKFPSRLID 114
           A S  Q  +L   D K  KFP VSATS Y+    +D+ YK++      A+DIKFP+ L  
Sbjct: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118

Query: 115 NENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
           NE RQ Q+L +L++K+  L  LK   ++ D+
Sbjct: 119 NEERQYQLLTELELKEKHLKYLKKCQKITDL 149

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 98/347 (28%), Positives = 174/347 (50%), Gaps = 33/347 (9%)

Query: 244 SKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEY 303
           SK P++SPEN E V+K      +SK VYDK+++D  V+ +++   +  +  K    K+EY
Sbjct: 353 SKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEY 412

Query: 304 NEKIKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQ 363
            + +  IQ +                    V++ +LVKN++D T T +D+K KI ++T  
Sbjct: 413 EDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETEL 472

Query: 364 LKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQ 423
           +KL+KLN  +    K+  IR+E   ++ E+     +FN  N  LNEI  +LDAK+  +  
Sbjct: 473 MKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRA 532

Query: 424 DNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLEL----------NEMDE 473
            N +  ++E E+ KL   K  +  E +  + +++H ++     +L          NE+D 
Sbjct: 533 KNQQKLDIEQEMAKLNISK--MELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDN 590

Query: 474 QINSKLSNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDE------NTKLNDK 527
           +I  +L  L+ IK+E I E  +++ LT  L  + I  +NE +R+ +E        KL  +
Sbjct: 591 EIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENE-IRLKNEKLKREQEQKLQKQ 649

Query: 528 IHNMQELHKNELKNLTERHE--------------NSDTYSYVTEEQI 560
           +  ++  H  EL  + +++E              ++  Y YVTEE++
Sbjct: 650 LAELKAKHNEELLEIQKKYEKKMAQQPKAVELPTDNSLYEYVTEEEV 696

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 28  AKKHQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLK-TAKFPLVSATSTYN 86
           ++ H  L KV +      D   +Y SPFR+  PS  Q       K   +FP VSA+S ++
Sbjct: 20  SRSHSMLKKVVSR-----DHNVEYVSPFRD--PSNVQAANYAKAKKMERFPTVSASSHFS 72

Query: 87  TDTKD--VYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS 139
             + +   YK++      A+DI FPS LI NE RQ  I+ DL++K+  L  L++S
Sbjct: 73  RMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNS 127

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 155/314 (49%), Gaps = 28/314 (8%)

Query: 252 ENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSIQ 311
           EN E VVK   G  ++K +YDKI    + ++++I KY+ D+  K +  ++E N KI S++
Sbjct: 346 ENPEHVVKTKDGY-LTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 312 LEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQKLNE 371
            +  +                 V +N+L +   + T      K ++ + T  +K QKL+E
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 372 LKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRNENL 431
              +  K+  +++E + +N+EK+  +         + E+   +DAK+  L + N++ +N 
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 432 EHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQINSKLSN 481
           + EINKLQ +K   +D +D IE   L   ++ K +E          LNE+D QI+  L  
Sbjct: 525 QEEINKLQQQK---VDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQ 581

Query: 482 LNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTK-------------LNDKI 528
           L  I+Q   NE+ ++S +T  L+ + +E++ E L++  EN +             L  K 
Sbjct: 582 LTTIRQHCANERTELSAITKKLDKERLEHE-EKLKLEAENRRRKEEDLLGKQRKELEAKA 640

Query: 529 HNMQELHKNELKNL 542
              +E H+ E++ L
Sbjct: 641 QEAREKHEQEMQKL 654

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 48  ENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTY-NTDTKDV-YKDLDPKKNFARD 105
           E  Y SPFR+     ++    Q  +T +FP  SA S Y N   +++ YK +   +  A+D
Sbjct: 37  ERDYVSPFRDE----QEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKD 92

Query: 106 IKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS 139
           I FP  L + E +Q ++L +L++K+  L  LKD 
Sbjct: 93  ISFPVYLEEIEKKQLELLRELEVKEAHLRYLKDC 126

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 164/314 (52%), Gaps = 15/314 (4%)

Query: 248 VASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKI 307
           VASPEN E +V+      +SK VYD++ ++ K++ +++  +   +  K N  K EY +K+
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 308 KSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQ 367
             +Q +                    +++ +LVKN++D  + ++ +K K++++T  +KLQ
Sbjct: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434

Query: 368 KLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIR 427
           K+N  + L  K+  ++ E   +N EK++    +N  N +L  +   LD K+ K+   N  
Sbjct: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494

Query: 428 NENLEHEINKLQSKKQTLLDEI-DSIEYKKLHPDDDSK-------QLELNEMDEQINSKL 479
           N  ++ +I  LQ KK  L +EI D  E  KL+ D   K          LNE+DEQI +K 
Sbjct: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554

Query: 480 SNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTK------LNDKIHNMQE 533
             L +IK E I+E  ++S LT  L  + I ++NE +++ +E  K      L  K+  +QE
Sbjct: 555 DKLAIIKNETISENNQLSILTKKLEEERIAHENE-IKMKNEKMKREQDELLQKKLTELQE 613

Query: 534 LHKNELKNLTERHE 547
            H  E+  + ++++
Sbjct: 614 KHNEEMAEIQKKYQ 627

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (55%), Gaps = 7/113 (6%)

Query: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYN--TDTK 90
           FL++  + KS+  +    Y SPFRN   +  +    + LK  KFP  SATS +N     +
Sbjct: 23  FLTRHISRKSENTE----YISPFRNPQDTV-RSNYAKSLKEKKFPTTSATSNFNKMVPGE 77

Query: 91  DVYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVI 143
             Y  L      A+DI+FP  L+DNE RQ Q+L++L+IK+  L  L+ S +V+
Sbjct: 78  MGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 97/337 (28%), Positives = 179/337 (53%), Gaps = 27/337 (8%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           P A+P +KE +VK      +SK +YD++++D + ++QY+  Y+ +   K +    EY  +
Sbjct: 228 PKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENE 287

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           +KS+  +   +                ++  +LVK + D  +  +D+K+KI  +T  +K 
Sbjct: 288 LKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKR 347

Query: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426
           +K++E   + +  + +  E + +N EK+     FN    ++  I ++LDAKLFK+ Q NI
Sbjct: 348 EKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINI 407

Query: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDD-------DSKQL--ELNEMDEQINS 477
              NL+++I+ L ++K  L  EI++ ++   H ++       D+KQ   +LN +D QIN 
Sbjct: 408 TQMNLQNKIDGLNNEKLGLTKEIEANKF--THANNVETIENVDNKQYLPKLNNIDSQIND 465

Query: 478 KLSNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTK-------------L 524
            L+ L LIKQE  NEK+++S+LT  L  + ++++ E L++  E  K             L
Sbjct: 466 LLNQLTLIKQENANEKIQLSELTQKLEKERMDHE-EKLKLDAEERKRQEENLLGKQREEL 524

Query: 525 NDKIHNMQELHKNELKNLTERHEN--SDTYSYVTEEQ 559
             K +++Q  H+ E+ NL   +E   +D  S + E+Q
Sbjct: 525 EQKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQ 561

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/357 (24%), Positives = 173/357 (48%), Gaps = 36/357 (10%)

Query: 234 DYPKVQSTTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQL 293
           D P +   ++  FP+A+PEN E + K      +SK +YDK+ +D   + +++  ++  + 
Sbjct: 405 DVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEK 464

Query: 294 NKLNKLKSEYNEKIKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDN 353
            K +    EYN +++ +Q E                    V +N LVK + +     ++ 
Sbjct: 465 AKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQ 524

Query: 354 KVKILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQE 413
           K KI ++T  +K QK+ + K +  K  +++ E   +N  K   +  F+    ++  + Q+
Sbjct: 525 KNKIFKETENIKNQKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQ 584

Query: 414 LDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE------ 467
           LDAK+ K++Q  ++ +  + EI KL+++K+    +ID+   KK H ++  K +E      
Sbjct: 585 LDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAA--KKEH-EEGQKVVESYENKE 641

Query: 468 ----LNEMDEQINSKLSNLNLIKQEIINEKLKISKLTNDLNLQ----------------- 506
               ++ +D QI+  L+ L +IKQE  NE+ ++SK+T +L  +                 
Sbjct: 642 YLPKIHTIDNQISELLNELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERER 701

Query: 507 ----LIENKNENLRIMDENTKLN--DKIHNMQELHKNELKNLTERHENSDTYSYVTE 557
               L+E +   L    E  K    +++  M+E ++NEL N+ ++ E+ +T   V E
Sbjct: 702 QEKNLLEKQRLELEEKAEQQKREHEEQVRKMKEQYENELNNVKKQKESLETEKLVEE 758

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 55/94 (58%), Gaps = 8/94 (8%)

Query: 54  PFRNNAPSREQKKQLQDLKTAKFPLVSATST-YNTDTKDV-YKDLDPKKNFARDIKFPSR 111
           PF N     +  KQ+      KFP VSATS   N D K++ +K LD     A+DIKFP  
Sbjct: 107 PFTNKPAYNKNAKQM------KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVY 160

Query: 112 LIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
           L +NE RQ  IL +L++K+  L  LKDS ++ID+
Sbjct: 161 LTENEFRQQTILKELELKEGKLQYLKDSQKIIDL 194

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 135/267 (50%), Gaps = 14/267 (5%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           P+A+P++ E +V+   G  +SK +YDK+E+D +V+   +  +  +Q +K +  + EYN+K
Sbjct: 350 PLATPQDPEYIVRTDKGY-MSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDK 408

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           +  +Q +  +                 V +++L K ++D  AT   +K  I ++T  +K 
Sbjct: 409 LTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKT 468

Query: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426
           QK+ E   +  K   ++ E   +NV K      FN     L+++  +LD+K+ K+ + N 
Sbjct: 469 QKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELND 528

Query: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476
           +   +   I +L  KK  L  E ++ + ++LH  + +  LE          +N +D Q+ 
Sbjct: 529 KQMEITGLIAELNQKK--LEIETETRDAEELH-KESTGILESIKNKEYLPKINAIDSQVA 585

Query: 477 SKLSNLNLIKQEIINEKLKISKLTNDL 503
           + L +L LIKQE  N+K + + +T  L
Sbjct: 586 TLLGSLTLIKQENANQKTEFAAITKRL 612

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 68/113 (60%), Gaps = 5/113 (4%)

Query: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTKDV 92
           FL KV TNK KE ++++ Y+SPFR    S+++    +++K  KFP VSATS   +     
Sbjct: 28  FLRKVVTNKKKEEEEKD-YSSPFR----SQQELIAAKNVKAKKFPTVSATSGTASAADLG 82

Query: 93  YKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
           YK +D  K  A+DI  P  L + + +Q + L  L+ K++ L  LKDS +++DV
Sbjct: 83  YKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 135/267 (50%), Gaps = 13/267 (4%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           P+A+PEN E +VK      +SK VYDK++++   + +++ ++ + +  +  + + +Y+ +
Sbjct: 488 PLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNR 547

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           ++ ++ E  K                 +   +L K  ++ST  + + K  I  +T  ++ 
Sbjct: 548 LEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQD 607

Query: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426
           QK  E   +  ++  +++E   +N EKD+    F      L +    LDAK++ L     
Sbjct: 608 QKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQ 667

Query: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476
           ++   + +I++L  KK  L  E+ +  +K+ H   ++K +E          ++E+D++I+
Sbjct: 668 KHTKTQAQIDELSHKKAVLEKEMAA--HKETHA-KNTKAVEKHANKEYLPKVHEIDDKIS 724

Query: 477 SKLSNLNLIKQEIINEKLKISKLTNDL 503
           + L  L++IKQE  NEKLK+  +T  L
Sbjct: 725 NLLGELSVIKQESANEKLKLGSITKKL 751

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 59/99 (59%), Gaps = 8/99 (8%)

Query: 49  NKYNSPFRNNAPSRE-QKKQLQDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARD 105
            ++ SPFR  +  ++ +K++LQ     +FP VS  S ++    K++ Y+ +      A+D
Sbjct: 67  GEFASPFRLESNEKDAEKRRLQ-----RFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121

Query: 106 IKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVID 144
           I+FP  L +NE RQ+Q+L +++I++  L  +K+S  V D
Sbjct: 122 IQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHD 160

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 165/370 (44%), Gaps = 39/370 (10%)

Query: 164 PV-PE-QPSNNENITDKDALQDAYDLNSK--AATKTDPDI-----VSHNYSVLNKNNLID 214
           PV PE +PS  E +   +A Q+A  + ++   A    PDI     V    S  NK     
Sbjct: 346 PVDPEAEPSPEEAV---EAFQEAEAIATENPEAISPPPDINSAPRVPFTPSGANKAGTAA 402

Query: 215 AKDMSIENKLFYLKPIHRKDYP----KVQSTTESK-------FPVASPENKETVVKLTSG 263
           A      + LF L    R   P    KV +   +         PVA+PE+ E +V+   G
Sbjct: 403 ATSGIAASGLFAL--FKRSKKPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRTQEG 460

Query: 264 KKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSIQLEKFKTXXXXXX 323
             +SK VYDK+++D   +   +  Y  +Q  +      EY EKI+SIQ E  +       
Sbjct: 461 Y-VSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQ 519

Query: 324 XXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQKLNELKFLNQKRNLIR 383
                     + Q +  + L+++     + K  + ++T ++K Q +++ +        ++
Sbjct: 520 VRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQ 579

Query: 384 REANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRNENLEHEINKLQSKKQ 443
            E + + + KD            + E+  ELD K   L++   + +    EI  L+ +K 
Sbjct: 580 SEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKA 639

Query: 444 TLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQINSKLSNLNLIKQEIINEK 493
            L  EI   E ++LH  + SK +E          +NE++ +I+S L++L LI+QEI N+K
Sbjct: 640 RLEQEIK--EAQELHQQNVSK-IESIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQK 696

Query: 494 LKISKLTNDL 503
           ++ S +T  L
Sbjct: 697 VEFSSVTRRL 706

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 27/126 (21%)

Query: 33  FLSKVNTNKSKEND--DENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTK 90
            L +V T + +  +  D+N+Y+SPFR    + E+ ++ + ++  KFP +S  +       
Sbjct: 41  ILKRVTTKQQQHQEELDDNEYHSPFR----TAEETQRARQVRQEKFPTLSQGAVQ----- 91

Query: 91  DVYKDLDPKKNF-----------ARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS 139
                LDP++             A+DI  PS L D E  Q   L  L+ K+  L   + S
Sbjct: 92  -----LDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKS 146

Query: 140 LQVIDV 145
            +++D+
Sbjct: 147 QKIVDL 152

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 124/268 (46%), Gaps = 22/268 (8%)

Query: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306
           PVASP + E +VK   G  +SK +YD +E++  ++ + +  Y  +   K     +EY ++
Sbjct: 376 PVASPNDPEFIVKFDKGY-MSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDR 434

Query: 307 IKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366
           + S++ +  +                 + + KL   ++D  A  S +K  I ++T  +K 
Sbjct: 435 LTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKA 494

Query: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426
            K+ E + +  K+  ++ E   +   +             ++E+  ELDAKL  + + N 
Sbjct: 495 AKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNT 554

Query: 427 RNENLEHEINKLQSKKQTLLDE--------------IDSIEYKKLHPDDDSKQLELNEMD 472
           +   L+  I+ LQ +K  L+ E              ++SIE K+  P       +LN +D
Sbjct: 555 QQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLP-------KLNAID 607

Query: 473 EQINSKLSNLNLIKQEIINEKLKISKLT 500
            +I+  L++L ++KQE  N K + + ++
Sbjct: 608 TKISELLTSLTVVKQETANHKTEFAAVS 635

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 67/114 (58%), Gaps = 10/114 (8%)

Query: 33  FLSKVNTNKSKENDDENKYNSPFRNNAP-SREQKKQLQDLKTAKFPLVSATSTYNTDTKD 91
           FL KV    SKE + ++ YNSPFR +   +  QK+++Q     KFP VSA+ + ++ +  
Sbjct: 27  FLHKVV---SKEQE-QSAYNSPFRTSQSLAAAQKRKMQ-----KFPTVSASVSAHSSSDM 77

Query: 92  VYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
            YK +D  +  A+DI  P  L  N+ RQ + L  L+ K+DAL   KDS +++DV
Sbjct: 78  GYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 137/293 (46%), Gaps = 24/293 (8%)

Query: 228 KPIHRKDYPKVQSTT----------ESKFPVASPENKETVVKLTSGKKISKYVYDKIEHD 277
           KP + KD P+V   T          +   PVASP++ E +VK   G  +SK +YD +E++
Sbjct: 319 KPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGY-MSKALYDTLEYE 377

Query: 278 TKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSIQLEKFKTXXXXXXXXXXXXXXXXVIQN 337
             V+ Q + +Y  +  +K +    EY + + S++ +  +                 +   
Sbjct: 378 EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA 437

Query: 338 KLVKNLMDSTATFSDNKVKILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYK 397
           +L   +++S A  S+ K  I ++T   K  K++E   +  K++ ++ E   +  ++    
Sbjct: 438 ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497

Query: 398 TNFNYINCSLNEILQELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKL 457
                +   ++E+  +LD+K   + + N +   ++  I+ L+ +K TL+   D+    +L
Sbjct: 498 ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLV--ADATAADEL 555

Query: 458 HPDDDSKQLE----------LNEMDEQINSKLSNLNLIKQEIINEKLKISKLT 500
           H + +   LE          +N +D QI+  LS+L L+KQE  N+  + + ++
Sbjct: 556 H-NSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVS 607

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTKDV 92
           FL KV T   KE +D   Y+SPFR +    E +K+    K  +FP VSA+S  N+  +  
Sbjct: 26  FLRKVVT---KEQEDAT-YSSPFRTSQSQVEAQKR----KVQRFPTVSASSGGNSSAEMG 77

Query: 93  YKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
           +K +D  +  A+DI  P  L  N+ RQ + L  L+ K+D+L   KDS +++ V
Sbjct: 78  FKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKV 130

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 50  KYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTY-NTDTKDV-YKDLDPKKNFARDIK 107
           +Y SPFR+          L+  K  ++P +SATS Y N   +D+ YK++ P    A+DI 
Sbjct: 55  QYKSPFRDTQTPSNMNVALKK-KNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIP 113

Query: 108 FPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDVEDL 148
           FP  LI+NE RQ+++   L  K+  LD L+ S ++I VE +
Sbjct: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVEPI 154

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 77  PLVSATSTYNTDTKD--VYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALD 134
           P+ +  S+YNT   +   YK   PKK +AR+I FP+ L +NE RQ  IL DL  K+  LD
Sbjct: 14  PISNPHSSYNTLKPEELGYKQKFPKK-YAREIHFPAELTENEMRQRAILQDLDEKEQHLD 72

Query: 135 RLKDSLQVIDVE 146
            LK S +V+ ++
Sbjct: 73  HLKKSQRVVYID 84

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 61/136 (44%), Gaps = 6/136 (4%)

Query: 235 YPKVQSTTESKF--PVASPENKETVV--KLTSG--KKISKYVYDKIEHDTKVNDQYIVKY 288
           Y +     E++F  PVA+PE  E VV  K  +G  K  SK ++D I+ D   ++ +++  
Sbjct: 107 YSEYGQCNEAEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSR 166

Query: 289 QNDQLNKLNKLKSEYNEKIKSIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTA 348
           +    ++      EYN+++  +  +                    + +N+L K  +  T 
Sbjct: 167 EGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQ 226

Query: 349 TFSDNKVKILRKTGQL 364
            F+  K KI ++T +L
Sbjct: 227 QFTAEKNKIYKETERL 242

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 79/184 (42%), Gaps = 3/184 (1%)

Query: 249 ASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIK 308
           A+PE+ E +V LT    +SK +YD++E++ +++ + +     +   K       Y EK+ 
Sbjct: 323 ATPEDPEFIV-LTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 309 SIQLEKFKTXXXXXXXXXXXXXXXXVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQK 368
           S+  E  +                  I+  L +NLMD  A   + K  +L++    K  K
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 369 LNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRN 428
           + E   +N+K   +  E   +   +   K         +  +  ELDA+L +L   N+ +
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGEL--QNVSD 499

Query: 429 ENLE 432
           E  E
Sbjct: 500 EQTE 503

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 20/121 (16%)

Query: 33  FLSKVNTNKSKENDDE--------NKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATST 84
           F+ KV  ++    DD          +Y SPFR++    E ++ ++DLK   FP     ST
Sbjct: 31  FVKKVTNHRKASEDDGTQGNVEGGGEYVSPFRDDKAVAEAER-IRDLK---FPTTGHHST 86

Query: 85  YNTDTKDVYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVID 144
                       D  K  A+DI  P      + +Q + L +L +K++ L+ L++S +++D
Sbjct: 87  VRVK--------DNVKRKAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVD 138

Query: 145 V 145
           V
Sbjct: 139 V 139

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 50  KYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYN------TDTKDVYKDLDPKKNFA 103
           KY SPFR N  +      +++ K AK+ + +  S +N         K +  D   +K  A
Sbjct: 38  KYQSPFRRNI-NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRK-IA 95

Query: 104 RDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS--LQVIDVEDL 148
           +DI FP  L +NE  Q   L +LK K++ L  LKDS  L  ID +D+
Sbjct: 96  KDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDI 142

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 229 PIHRKDYPKVQSTTESKFPVASPENKETVVKLT--SGKKISKYVYDKIEHDTKVNDQYIV 286
           P  ++ + +  +    K+P+A+P+N E +V+LT    K +SK  YD++      +D ++ 
Sbjct: 162 PTEQEQFHRGMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLK 221

Query: 287 KYQNDQLNKLNKLKSEYNEKI 307
            Y  + +   N+    Y ++I
Sbjct: 222 SYNAENMANYNQRHQWYQKQI 242

>SAKL0G16720g Chr7 complement(1445248..1446489) [1242 bp, 413 aa]
           {ON} similar to uniprot|Q06410 Saccharomyces cerevisiae
           YLR423C ATG17 Protein that interacts with and is
           required for activation of Apg1p protein kinase involved
           in autophagy but not in the Cvt (cytoplasm to vacuole
           targeting) pathway
          Length = 413

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 429 ENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLELNEMD--EQINSKLSNLNLIK 486
           ENL HE+   QS+    +  +D  EYK L  ++ S+  +    D    +++KL  + +IK
Sbjct: 86  ENLVHEMEHWQSEILQKVQVLDRTEYK-LSKEEGSRLGDFISRDNLHTLDAKLKEVPVIK 144

Query: 487 QEIINEKLKISKLTNDLNLQLIENKNENLRI 517
            +I N K++   + N +  QL+EN+ E LR+
Sbjct: 145 GQIENIKVQYHSMVNKVRDQLLENRLEKLRL 175

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 61/105 (58%), Gaps = 12/105 (11%)

Query: 431 LEHEINKLQSKKQTL----LDEIDSIEYKK----LHPDDDSKQLELNEMDEQINSK---L 479
           LE E+ +L+S+  T     +D++DS+  +     L  D+ S + ++NE++E +NSK   +
Sbjct: 809 LETELWQLKSQNSTGTAKEIDQLDSVRLQSKCEILEADNHSLEDKVNELEELVNSKFLDM 868

Query: 480 SNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTKL 524
            NLN I Q + NE++K  +L  D   +L E + E+  +M EN +L
Sbjct: 869 ENLNEIVQ-LQNERIKSLELEPDYKEKLEELQIEHENLMRENERL 912

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 16/97 (16%)

Query: 49  NKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTKDVYKDLDPKKNFARDIKF 108
           ++Y SPFR+     E         T KFP    T T+ T+           +    DI  
Sbjct: 54  DEYYSPFRDAIAVEEAHGS----GTLKFP---TTGTHVTEEA---------RRRVPDIDE 97

Query: 109 PSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145
           P RL   + RQ Q L +L++K+  L   K+S +++DV
Sbjct: 98  PKRLSTVDERQRQQLQELELKEGQLRLYKESQKIVDV 134

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 65/116 (56%), Gaps = 19/116 (16%)

Query: 431 LEHEINKLQSKKQTL----LDEIDSIEYKK----LHPDDDSKQLELNEMDEQINSKLSN- 481
           LE E+ +L+S+  T     +DE+DS+  +     L  D+ S + ++NE+++ +NSK  N 
Sbjct: 814 LETELWRLKSQSSTGTAKEMDELDSVRLQSKCEILEADNHSLEDKVNELEDLVNSKFLNM 873

Query: 482 --LNLIKQEIINEKLKISKLTNDLNLQL----IENKN---ENLRIMDENTKLNDKI 528
             LN I Q   NE++K  +L  D   +L    IE++N   EN R+ DE+ + ++ I
Sbjct: 874 ESLNAIVQ-FQNERIKSIELEPDYKEKLEKLQIEHENLSRENERLRDESMRQSEDI 928

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 76/152 (50%), Gaps = 15/152 (9%)

Query: 412 QELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDD--SKQLELN 469
           QE++ K+ +L    IR E  EHE+ K + + + L +E   +E      DD   S + ++ 
Sbjct: 344 QEVEKKMSELHDCQIRYEEAEHELGKFKHQHEVLKEERQKVERGIASLDDSLRSHKHQVQ 403

Query: 470 EMDEQINSKLSN---LNLIKQEIINEKLKISKLTNDLNLQLIENKNENLR-----IMDEN 521
           ++++++   L     L +I++  I+EK+K  K     NL  +E+K +  +     I  + 
Sbjct: 404 QLEKELADALGGNKELMVIEKNQIDEKIKRLK----ENLPPLEDKYQQCKERESEISHQR 459

Query: 522 TKLNDKIHNMQELHKNELKNLTERHENSDTYS 553
             +N ++     + K E++ L +R ++ D YS
Sbjct: 460 NTVNYQLQKSINIKKQEIRELNQR-DSRDVYS 490

>Kwal_55.20124 s55 complement(259515..263177) [3663 bp, 1220 aa]
           {ON} YDR335W (MSN5) - member of major facilitator
           superfamily, involved in pheromone response [contig 153]
           FULL
          Length = 1220

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 81/171 (47%), Gaps = 23/171 (13%)

Query: 352 DNKVKILRKTGQLKLQKLNELK-FLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEI 410
           DN V   +K  ++  Q  +E + F +  R  IR    +I+  +  +  +++++N  LN  
Sbjct: 423 DNHVS--KKFAEIDFQSTSEFQSFCSTYRKRIRDIIRLISCVQLDF--SYDWLNARLNAY 478

Query: 411 LQELDAKLFKLSQDNIRNENLEHEINK-LQSKKQTLLDEI---DSIEYKKLHPDDDSKQL 466
                       Q  + ++ L+H+    L S  Q ++ E      I +K   PD  +  +
Sbjct: 479 FSS------SYGQQVLSSQFLDHKTEPYLSSLSQLMVVECFINGCIRWKIWFPDSPAYNV 532

Query: 467 ELNEM---DEQINSKLSNLNL-----IKQEIINEKLKISKLTNDLNLQLIE 509
           +LNE+    E ++ +L  LNL     +K++I N  L ++ L +++ L+L+E
Sbjct: 533 KLNEILAKIETLSDQLIALNLREPLLLKKQIQNFALFLTMLKDNVLLKLLE 583

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 74/130 (56%), Gaps = 19/130 (14%)

Query: 431 LEHEINKLQSKKQTL----LDEIDSIEYKK----LHPDDDSKQLELNEMDEQINSK---L 479
           LE E+ +L+S+K +     +DE+DS+  +     L  D+ S + ++NE++E +NSK   +
Sbjct: 808 LETELWQLKSQKNSGTTKEIDELDSVRLQSKCEILEADNHSLEDKVNELEELVNSKFLDI 867

Query: 480 SNLNLIKQEIINEKLKISKLTNDLNLQL----IENKN---ENLRIMDENTKLNDKIHNMQ 532
            NLN + Q   NEK+K  +L  +   +L    IE++N   EN R+ +E+ + N+ I N  
Sbjct: 868 ENLNEVIQ-FQNEKIKSLELEPNYKEKLEELQIEHENLSRENERLKNESKQHNEDIINNV 926

Query: 533 ELHKNELKNL 542
             + ++L +L
Sbjct: 927 ANYSSQLGSL 936

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,124,052
Number of extensions: 3375814
Number of successful extensions: 25279
Number of sequences better than 10.0: 1751
Number of HSP's gapped: 25483
Number of HSP's successfully gapped: 2570
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)