Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019503.490ON1571577253e-99
KNAG0B008203.490ON2071681663e-14
KLTH0F14784g3.490ON1951921313e-09
Kpol_480.153.490ON2072001182e-07
Kwal_55.212263.490ON1961951173e-07
ZYRO0D10032g3.490ON2092021042e-05
TDEL0D055803.490ON193189952e-04
SAKL0F02816g3.490ON192191952e-04
NCAS0E008203.490ON202197860.004
KLLA0E04643g3.490ON221186760.11
TBLA0C044703.490ON222209720.37
TPHA0D042403.490ON20946700.54
Ecym_83178.631ON42366710.56
NDAI0G006702.288ON96872681.6
KNAG0D040804.196ON91667681.7
Kwal_23.37623.413ON61254672.0
Suva_10.4584.196ON89139672.2
YLR357W (RSC2)4.196ON88939672.3
Skud_12.4424.196ON89039672.3
Smik_12.4454.196ON89039672.3
KAFR0F039904.196ON86539663.1
NCAS0A022004.196ON89467654.2
KAFR0A062404.196ON81569645.5
NCAS0J011904.196ON90038636.9
CAGL0I10538g3.490ON20050627.3
NOTE: 7 genes in the same pillar as KAFR0C01950 were not hit in these BLAST results
LIST: Skud_7.440 Smik_6.225 YGR129W Suva_7.417 AFR308W Ecym_1239 NDAI0G00950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01950
         (157 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...   283   3e-99
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    69   3e-14
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    55   3e-09
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    50   2e-07
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    50   3e-07
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    45   2e-05
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    41   2e-04
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    41   2e-04
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    38   0.004
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    34   0.11 
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    32   0.37 
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    32   0.54 
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    32   0.56 
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...    31   1.6  
KNAG0D04080 Chr4 (735446..738196) [2751 bp, 916 aa] {ON} Anc_4.1...    31   1.7  
Kwal_23.3762 s23 (421874..423712) [1839 bp, 612 aa] {ON} YGR083C...    30   2.0  
Suva_10.458 Chr10 (800854..803529) [2676 bp, 891 aa] {ON} YLR357...    30   2.2  
YLR357W Chr12 (841331..844000) [2670 bp, 889 aa] {ON}  RSC2Compo...    30   2.3  
Skud_12.442 Chr12 (781501..784173) [2673 bp, 890 aa] {ON} YLR357...    30   2.3  
Smik_12.445 Chr12 (780386..783058) [2673 bp, 890 aa] {ON} YLR357...    30   2.3  
KAFR0F03990 Chr6 (779931..782528) [2598 bp, 865 aa] {ON} Anc_4.1...    30   3.1  
NCAS0A02200 Chr1 (412677..415361) [2685 bp, 894 aa] {ON} Anc_4.1...    30   4.2  
KAFR0A06240 Chr1 complement(1259298..1261745) [2448 bp, 815 aa] ...    29   5.5  
NCAS0J01190 Chr10 (206839..209541) [2703 bp, 900 aa] {ON} Anc_4....    29   6.9  
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    28   7.3  

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score =  283 bits (725), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 146/157 (92%), Positives = 146/157 (92%)

Query: 1   MEMDMANLREEFRDLRKKCREIKIENRKLISIASKPKTYSIREEEIGAXXXXXXXXXXXI 60
           MEMDMANLREEFRDLRKKCREIKIENRKLISIASKPKTYSIREEEIGA           I
Sbjct: 1   MEMDMANLREEFRDLRKKCREIKIENRKLISIASKPKTYSIREEEIGAEVSDEDEDDSEI 60

Query: 61  IKLLTKPLREFETEAHVAENKEDIDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYK 120
           IKLLTKPLREFETEAHVAENKEDIDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYK
Sbjct: 61  IKLLTKPLREFETEAHVAENKEDIDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYK 120

Query: 121 KGAQKRRRLKDTERGFINEQNKAFNLRLEKEKENGKK 157
           KGAQKRRRLKDTERGFINEQNKAFNLRLEKEKENGKK
Sbjct: 121 KGAQKRRRLKDTERGFINEQNKAFNLRLEKEKENGKK 157

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 89/168 (52%), Gaps = 20/168 (11%)

Query: 3   MDMANLREEFRDLRKKCREIKIENRKLISIASKPKTYSIREEEIGAXXXXXXXXXXXI-I 61
           M +  LR++F+ L ++ + +++  RK  +   KPK YS++  E              + +
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVRIRKQQAEVEKPKVYSLQAAEPSVDGIDGAEVVDNVTV 94

Query: 62  KLLTKPLREFET-EAHVAENKEDI------DRL---TYNKEVMSLGKREKR-----DVES 106
           KLL  PLR+ E  EA   EN +D       DR+   TY KE+  LG++  R     +VE 
Sbjct: 95  KLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRKSTRGTYRDNVER 154

Query: 107 LVSEMNRISDERY--KKGAQKRR--RLKDTERGFINEQNKAFNLRLEK 150
           LV+ +N +S +RY  +K   KR+  R   +  G+INE+NK FN +L++
Sbjct: 155 LVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 47/192 (24%)

Query: 3   MDMANLREEFRDLRKKCREIKIENRKLI-------SIASKPKTYSIREEEIGAXXXXXXX 55
           MD+    +  ++L++K   + ++N++ I       S  +KP  YS++ EE  +       
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 56  XXXXIIKLLTKPLREFET-----------EAHVAENKEDIDRLTYNKEVMSLGKREKRDV 104
                 KLL   +++FE             + VA+  +D+ + TY+KEV  L K     V
Sbjct: 61  KE---AKLLQYSMKDFEQWQDKERRKSQKSSDVAKY-QDLAKFTYDKEVQQLRKNYTNKV 116

Query: 105 E-----------------------SLVSEMNRISDERYKKGAQK--RRRLKDTERGFINE 139
           E                       SL   +N+ ++ERY +  +K  R+ + DT  GFINE
Sbjct: 117 EKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINE 176

Query: 140 QNKAFNLRLEKE 151
           +NK FN ++E++
Sbjct: 177 KNKQFNDKIERQ 188

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 89/200 (44%), Gaps = 51/200 (25%)

Query: 1   MEMDMANLREEFRDLRKKCREIKIENRKLISI-------ASKPKTYSIREEEIGAXXXXX 53
           M M++    EEF+ L++K  +I IENRKL+          SKPKTYS+  EE+       
Sbjct: 1   MNMEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSM--EELAEDDTVN 58

Query: 54  XXXXXXIIKLLTKPLREFE----------TEAHVAENKED----IDRLTYNKEVMS---- 95
                   +LL   +RE+E             HV ++  +    I + TY+K++      
Sbjct: 59  TGTVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQ 118

Query: 96  ------------------LGK----REKRDVESLVSEMNRISDERYKKGAQKRRRLKDTE 133
                              GK      K+ ++ L  ++N+ + ERY +  QKR++  D  
Sbjct: 119 KSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQN 178

Query: 134 R--GFINEQNKAFNLRLEKE 151
               +INE+NK FN +LE++
Sbjct: 179 ENYSYINEKNKEFNDKLERQ 198

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 88/195 (45%), Gaps = 53/195 (27%)

Query: 3   MDMANLREEFRDLRKKCREIKIENR-------KLISIASKPKTYSIR----EEEIGAXXX 51
           MD++   +  ++L++K  ++ ++N+       K++S + KP  YS+     EEEI     
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 52  XXXXXXXXIIKLLTKPLREFET-------EAHVAENK---EDIDRLTYNKEVMSLGK--- 98
                     KLL   + E+E         +H  E     +D+ + TY+KEV  L K   
Sbjct: 61  EAN-------KLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDG 113

Query: 99  --------------------REKRDVESLVSEMNRISDERYKKGAQK--RRRLKDTERGF 136
                                +++ V  LV  +N+ +DERY +  +K  R+    T  G+
Sbjct: 114 NRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGY 173

Query: 137 INEQNKAFNLRLEKE 151
           INE+NK FN +LE++
Sbjct: 174 INEKNKQFNDKLERQ 188

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 87/202 (43%), Gaps = 59/202 (29%)

Query: 2   EMDMANLREEFRDLRKKCREIKIENRKLISIAS-------KPKTYSIREEEIGAXXXXXX 54
           +MD+    ++F  L+KK  EI +ENRKL++  S       KP+ Y +   E         
Sbjct: 10  QMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDK 69

Query: 55  XXXXXIIKLLTKPLREFE---------TEAHVAENKEDIDRLTYNKEVMSL--------- 96
                  +L+   ++++E         T    + N +D+ + TY+KE+  L         
Sbjct: 70  HGN----QLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNR 125

Query: 97  ----------------GKREKRD----VESLVSEMNRISDERYKKGAQKRRRLK------ 130
                           GK   +D    V+ L  +M++ + ERY+    +RR ++      
Sbjct: 126 YTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEA---RRREMERSNVQN 182

Query: 131 -DTERGFINEQNKAFNLRLEKE 151
             +  G+INE+NK FN +L+++
Sbjct: 183 ASSGGGYINEKNKQFNEKLDRQ 204

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 89/189 (47%), Gaps = 42/189 (22%)

Query: 3   MDMANLREEFRDLRKKCREIKIENRKLI-------SIASKPKTYSIRE-EEIGAXXXXXX 54
           MD+ ++   F+DL+K+  ++ I+ RK+        S+  KPK YS+ +  E+G       
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 55  XXXXXIIKLLTKPLREFETEAHVAENKE---------DIDRLTYNKEV----MSLGKR-- 99
                 +KL+   +RE+E      + KE         ++ + +Y K++     + G R  
Sbjct: 61  ERRR--LKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRVV 118

Query: 100 ---------------EKRDVESLVSEMNRISDERY--KKGAQKRRRLKDTERGFINEQNK 142
                          +++ V  L +++ + + ER+  +K   ++   + T  G+INE+NK
Sbjct: 119 KISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKNK 178

Query: 143 AFNLRLEKE 151
            FNL+L+++
Sbjct: 179 QFNLKLDRQ 187

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 85/191 (44%), Gaps = 48/191 (25%)

Query: 3   MDMANLREEFRDLRKKCREIKIENRK-------LISIASKPKTYSIREEEIGAXXXXXXX 55
           MD+ +L  + + L++K  ++ ++NRK           + KPK YS+ E+E          
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEEDT 60

Query: 56  XXXXIIKLLTKPLREFET---------EAHVAENKEDIDRLTYNKEV--------MSLGK 98
                 KLL   ++++E          +     +++D+ + TY+KE+        ++ GK
Sbjct: 61  RG----KLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGK 116

Query: 99  ---------------REKRDVESLVSEMNRISDERY---KKGAQKRRRLKDTERGFINEQ 140
                           +K+ +E L   +N+ +  RY   KK A+K      T  GFIN++
Sbjct: 117 VTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS--STTGGFINDK 174

Query: 141 NKAFNLRLEKE 151
           NK FN +L ++
Sbjct: 175 NKQFNEKLSRQ 185

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 84/197 (42%), Gaps = 44/197 (22%)

Query: 3   MDMANLREEFRDLRKKCREIKIENRKL-------ISIASKPKTYSIREEEIGAXXXXXXX 55
           +D+     + ++L++K ++  IENR L       I  + KP+ Y++++++          
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 56  XXXXIIKLLTKPLREFE---------TEAHVAENKEDIDRLTYNKEVMSLG--------- 97
               + KL+   LR++E              + + + +   +Y+K V +L          
Sbjct: 62  ADDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTTT 121

Query: 98  -----------------KREKRDVESLVSEMNRISDERYKKGAQK-RRRLKDTE-RGFIN 138
                            + EK+ V  L   + + +++RY    +K   R KD+   G+IN
Sbjct: 122 EREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYIN 181

Query: 139 EQNKAFNLRLEKEKENG 155
           E+NK FN +L++E   G
Sbjct: 182 ERNKHFNEKLDRESRYG 198

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 42/186 (22%)

Query: 4   DMANLREEFRDLRKKCREIKIENRKLISIA-----SKPKTYSIREE-EIGAXXXXXXXXX 57
           D+  + ++ + LRK+  E+ I N+K I IA     S+ + YS+ ++ E  A         
Sbjct: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAI-IAEEKKNSERRVYSMADDGEDKARSNKSEPED 96

Query: 58  XXIIKLLTKPLREFETEAHVAENK----------EDIDRLTYNKEVMSL----------- 96
              IKL    +RE+E      +N           + I + +Y KEV +L           
Sbjct: 97  P--IKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGG 154

Query: 97  ----GKREKRD----VESLVSEMNRISDERY---KKGAQKRRRLKDTERGFINEQNKAFN 145
               GK +  D    VE +V+++N  S +RY   K+   K+ ++ + + GFIN++NK FN
Sbjct: 155 ITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKI-NLDDGFINDKNKRFN 213

Query: 146 LRLEKE 151
            +L  E
Sbjct: 214 AKLNSE 219

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 79/209 (37%), Gaps = 61/209 (29%)

Query: 4   DMANLREEFRDLRKKCREIKIENRKLIS-------IASKPKTYSIREE----EIGAXXXX 52
           D+  L   ++ L++K    +I N+  ++         +KPK YS+ +E    E+      
Sbjct: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62

Query: 53  XXXXXXX---IIKLLTKPLREFE----------TEAHVAENKEDIDRL------TYNKEV 93
                     I KL+   LRE++          TE+      + I+ L      TY+K++
Sbjct: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122

Query: 94  MSLGKR-------------------------------EKRDVESLVSEMNRISDERYKKG 122
             L K                                +K  VE LV+ +   SD  YK  
Sbjct: 123 RKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHL 182

Query: 123 AQKRRRLKDTERGFINEQNKAFNLRLEKE 151
            ++R+    T  G +N +N+ FN +L +E
Sbjct: 183 GERRKNYSTTLSGHVNTKNQEFNEKLTRE 211

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
          YGR129W
          Length = 209

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 3  MDMANLREEFRDLRKKCREIKIENRKLISI-------ASKPKTYSI 41
          MDM +L +EF+ L+K+  +  IE+RK +           KPK YSI
Sbjct: 1  MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSI 46

>Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar to
           Ashbya gossypii ACR097W
          Length = 423

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 82  EDIDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFINEQN 141
           +D D +T +K V S+G    + + SL    N+I+D R+   +  +R L  ++ G++   +
Sbjct: 60  QDGDLVTLSKNVGSVGSVNLKPITSLKGHNNKITDFRWS--SDSKRVLSASQDGYMLLWD 117

Query: 142 KAFNLR 147
            A  L+
Sbjct: 118 AATGLK 123

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 86  RLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFINEQNKAFN 145
           +L + +  +S+  R++R  + +   +N+  D++ +      + ++  +R FI+E +KA+N
Sbjct: 728 QLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLH-FKPMRPPQRHFIHELSKAYN 786

Query: 146 LRLEKEKENGKK 157
           L  E +    K+
Sbjct: 787 LYCESQDPEPKR 798

>KNAG0D04080 Chr4 (735446..738196) [2751 bp, 916 aa] {ON} Anc_4.196
           YLR357W
          Length = 916

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFI-----N 138
           +DRL Y  EVM  G      V+ +V +   I   RY++G      +K     F+     N
Sbjct: 459 VDRLFYKNEVMKTGHYRDSPVDDVVGKCYVIHFTRYQRGDPD---VKPEGPLFVCEFRYN 515

Query: 139 EQNKAFN 145
           E +K FN
Sbjct: 516 EADKVFN 522

>Kwal_23.3762 s23 (421874..423712) [1839 bp, 612 aa] {ON} YGR083C
           (GCD2) - translation initiation factor eIF2B, 71 kDa
           (delta) subunit; translational repressor of GCN4 protein
           [contig 254] FULL
          Length = 612

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 90  NKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFINEQNKA 143
           NKE+  L KREK    S   E + IS E+ ++ A ++R  K ++R    +QN A
Sbjct: 41  NKELKELKKREKAAKRSAQKEASGISIEKQQQQAVQKREKKQSQR---EQQNSA 91

>Suva_10.458 Chr10 (800854..803529) [2676 bp, 891 aa] {ON} YLR357W
           (REAL)
          Length = 891

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKG 122
           +DRL Y  EVM  G+     V +LV +   I   RY++G
Sbjct: 461 VDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRG 499

>YLR357W Chr12 (841331..844000) [2670 bp, 889 aa] {ON}
           RSC2Component of the RSC chromatin remodeling complex;
           required for expression of mid-late sporulation-specific
           genes; involved in telomere maintenance
          Length = 889

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKG 122
           +DRL Y  EVM  G+     V +LV +   I   RY++G
Sbjct: 460 VDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRG 498

>Skud_12.442 Chr12 (781501..784173) [2673 bp, 890 aa] {ON} YLR357W
           (REAL)
          Length = 890

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKG 122
           +DRL Y  EVM  G+     V +LV +   I   RY++G
Sbjct: 461 VDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRG 499

>Smik_12.445 Chr12 (780386..783058) [2673 bp, 890 aa] {ON} YLR357W
           (REAL)
          Length = 890

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKG 122
           +DRL Y  EVM  G+     V +LV +   I   RY++G
Sbjct: 461 VDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRG 499

>KAFR0F03990 Chr6 (779931..782528) [2598 bp, 865 aa] {ON} Anc_4.196
           YLR357W
          Length = 865

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKG 122
           +DRL Y  EVM  G+     +E +V +   I   R+++G
Sbjct: 420 VDRLFYKNEVMKTGQYRDHPIEDIVGKCYVIHFTRFQRG 458

>NCAS0A02200 Chr1 (412677..415361) [2685 bp, 894 aa] {ON} Anc_4.196
           YGR056W
          Length = 894

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFI-----N 138
           +DRL Y  EVM  G+     V+ +VS+   +   R+++G      +K     F+     N
Sbjct: 455 VDRLFYKNEVMKTGQYRDNLVKDIVSKCFVVHFTRFQRGDPA---VKVDGPLFVCEFRYN 511

Query: 139 EQNKAFN 145
           E +KAFN
Sbjct: 512 ESDKAFN 518

>KAFR0A06240 Chr1 complement(1259298..1261745) [2448 bp, 815 aa]
           {ON} Anc_4.196 YLR357W
          Length = 815

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 84  IDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERG--FI---- 137
           +DR+ Y  EVM  G+     ++ ++ +   I   R+++G      LKD   G  F+    
Sbjct: 393 VDRIFYKNEVMKTGQYRDHLIDDIIDKCYVIHFTRFQRGDP---VLKDDVTGPLFVCEFR 449

Query: 138 -NEQNKAFN 145
            NE +K FN
Sbjct: 450 YNENDKVFN 458

>NCAS0J01190 Chr10 (206839..209541) [2703 bp, 900 aa] {ON} Anc_4.196
           YGR056W
          Length = 900

 Score = 28.9 bits (63), Expect = 6.9,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 85  DRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKG 122
           DRL Y  EVM  G+     +E +VS    +   RY++G
Sbjct: 446 DRLFYRNEVMKTGQYRDHSIEDIVSGCYVVHFTRYQRG 483

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
          {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
          YGR129w
          Length = 200

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 7/50 (14%)

Query: 3  MDMANLREEFRDLRKKCREIKIENRKLISIAS-------KPKTYSIREEE 45
          M++ +  E+ + L+K  ++IKI NR L+   +       KP+ YS+ ++E
Sbjct: 1  MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDE 50

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,107,093
Number of extensions: 579002
Number of successful extensions: 2820
Number of sequences better than 10.0: 158
Number of HSP's gapped: 2780
Number of HSP's successfully gapped: 169
Length of query: 157
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 57
Effective length of database: 42,014,799
Effective search space: 2394843543
Effective search space used: 2394843543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)