Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019403.489ON60960928470.0
KNAG0B008303.489ON60762210821e-140
NCAS0E008303.489ON6716967952e-96
Kpol_480.163.489ON6556797672e-92
TDEL0D055703.489ON6496747645e-92
ZYRO0D10054g3.489ON6646847297e-87
AFR307C3.489ON6506776781e-79
SAKL0F02838g3.489ON6546806739e-79
NDAI0G009603.489ON7007186645e-77
TPHA0D042303.489ON6526786599e-77
KLTH0F14762g3.489ON6506416459e-75
TBLA0C044603.489ON6985536349e-73
Smik_6.2243.489ON7055766322e-72
KLLA0E04665g3.489ON6476436091e-69
Suva_7.4163.489ON7135766094e-69
Skud_7.4393.489ON7135755701e-63
YGR128C (UTP8)3.489ON7135875525e-61
CAGL0I10560g3.489ON6787095481e-60
Kwal_55.212223.489ON3734005141e-58
Kwal_55.21225singletonOFF2151921503e-10
NDAI0G054001.260ON49096770.94
KLLA0B10736g7.525ON52572751.7
CAGL0B01331g3.1ON206124722.7
CAGL0I07381g3.76ON33935723.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01940
         (609 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...  1101   0.0  
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   421   e-140
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   310   2e-96
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   300   2e-92
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   298   5e-92
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   285   7e-87
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   265   1e-79
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   263   9e-79
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   260   5e-77
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   258   9e-77
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   253   9e-75
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   248   9e-73
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   248   2e-72
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   239   1e-69
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   239   4e-69
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   224   1e-63
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   217   5e-61
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   215   1e-60
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   202   1e-58
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...    62   3e-10
NDAI0G05400 Chr7 complement(1323284..1324756) [1473 bp, 490 aa] ...    34   0.94 
KLLA0B10736g Chr2 (941796..943373) [1578 bp, 525 aa] {ON} simila...    33   1.7  
CAGL0B01331g Chr2 (119648..120268) [621 bp, 206 aa] {ON} highly ...    32   2.7  
CAGL0I07381g Chr9 (713018..714037) [1020 bp, 339 aa] {ON} simila...    32   3.5  

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/609 (91%), Positives = 560/609 (91%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTPKLINSI 60
           MPSISQPFAITTVPKQ            LTANSNSLDVAISKYAVSKFVINPTPKLINSI
Sbjct: 1   MPSISQPFAITTVPKQSSTSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPTPKLINSI 60

Query: 61  PIPSNEVVTAFHDTVFATATVNQKYTLHLNGKKVPIQSKIMKLFSDESQTITILENGTIE 120
           PIPSNEVVTAFHDTVFATATVNQKYTLHLNGKKVPIQSKIMKLFSDESQTITILENGTIE
Sbjct: 61  PIPSNEVVTAFHDTVFATATVNQKYTLHLNGKKVPIQSKIMKLFSDESQTITILENGTIE 120

Query: 121 KYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISLYDINTMIELRNVANVQDIVDS 180
           KYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISLYDINTMIELRNVANVQDIVDS
Sbjct: 121 KYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISLYDINTMIELRNVANVQDIVDS 180

Query: 181 DFKSLDGKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAV 240
           DFKSLDGKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAV
Sbjct: 181 DFKSLDGKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAV 240

Query: 241 NSTIYALNLHLSSVISMSELLNLKWFKLIDNLSNQFVLGLSFNNENYKFELINLDLNSNF 300
           NSTIYALNLHLSSVISMSELLNLKWFKLIDNLSNQFVLGLSFNNENYKFELINLDLNSNF
Sbjct: 241 NSTIYALNLHLSSVISMSELLNLKWFKLIDNLSNQFVLGLSFNNENYKFELINLDLNSNF 300

Query: 301 GLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDKIIVDL 360
           GLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDKIIVDL
Sbjct: 301 GLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDKIIVDL 360

Query: 361 NKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNYPK 420
           NKAVKNPS               HYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNYPK
Sbjct: 361 NKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNYPK 420

Query: 421 TLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELSLD 480
           TLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELSLD
Sbjct: 421 TLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELSLD 480

Query: 481 ISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDXXXXXXXXXXXXXXXXXXGLFA 540
           ISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDED                  GLFA
Sbjct: 481 ISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDQQVSSQLFQLLSLIIDSIGLFA 540

Query: 541 LDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLIXXXXKSLHRKTLP 600
           LDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLI    KSLHRKTLP
Sbjct: 541 LDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLINNNNKSLHRKTLP 600

Query: 601 TYTVEHLDL 609
           TYTVEHLDL
Sbjct: 601 TYTVEHLDL 609

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  421 bits (1082), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 238/622 (38%), Positives = 371/622 (59%), Gaps = 33/622 (5%)

Query: 3   SISQPFAITTVPKQXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTPKLINSIPI 62
           SISQPF I  VP+Q            LT+N+N+LDVA+SKY++S+++INPTPKL+NS  I
Sbjct: 4   SISQPFTIANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNSKAI 63

Query: 63  PSNEVVTAFHDTVFATATVNQKYTLHLN-GKKVPIQSKIMKLFS----DESQ-TITILEN 116
           PSN  VTAF + V+AT + N+ + L+L+   ++P++S ++   S    DES  T  IL++
Sbjct: 64  PSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQD 123

Query: 117 GTIEKYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISLYDINTMIELRNVANVQD 176
           GT++KY           P KD+  VEFI+ +YAL+++  S +LY++  + ELR    +  
Sbjct: 124 GTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELRVSTTLHF 183

Query: 177 IVDSDFKSLDGKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCV 236
                 +   GK+YQF+   + F I+E++++  + ++ IPF++  +   ++FTVV D+ V
Sbjct: 184 EQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRV 243

Query: 237 VMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNLSN-QFVLGLSFNNEN--YKFELIN 293
            +A+ + IY L+LHL SV+S ++   LK  +LI    +  F + LS   ++     ++IN
Sbjct: 244 CLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGARDGSFAIALSHGPQDNAVSLDIIN 303

Query: 294 LDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNY 353
           L+L S   +KDSLGKGF  F+ +++S +  + L+ +            D+    + +F+Y
Sbjct: 304 LELGSR-SIKDSLGKGFATFMKERRSAESQVTLRPIL-----------DAGDKTKRSFDY 351

Query: 354 DKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDT 413
             I+  L  A K+P+                YTE DRF+++Q+FL++ + +IL+NY F+ 
Sbjct: 352 ASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEP 411

Query: 414 DGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIE 473
             + YP   TYLLTHPLFP   T++LL K ++ PRLYKQ IVTCPNLPL ELL + F IE
Sbjct: 412 S-SKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIE 470

Query: 474 NNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV-----TQDEDXXXXXXXXXX 528
           NNELSLD+SL++LQDYTKDSIK+++K LP+V++ NFI+FV       DE           
Sbjct: 471 NNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQL 530

Query: 529 XXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQS-SKLI 587
                   GLFALD ++L  ++ +I+    +A+ N+EL +LL++  +K S A  + SK +
Sbjct: 531 LSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYV 590

Query: 588 XXXXKSLHRKTLPTYTVEHLDL 609
                   +K  P Y V+HL++
Sbjct: 591 KT-----QKKVFPPYLVDHLEI 607

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  310 bits (795), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 240/696 (34%), Positives = 358/696 (51%), Gaps = 112/696 (16%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXLTAN-------SNSLDVAISKYAVSKFVINPT 53
           MPS+SQPF +T +PK             +  N       +N + + IS  +VS++++NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 54  PKLINSIPIPSNEVVTAFH--------DTVFATATV-NQKYTLHL------------NGK 92
           PKLI + PIPS  +VTA +        +  +  AT+ N+  TL+L            +G 
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120

Query: 93  KVPIQSKIMKLFSDESQ-------------TITILENGTIEKYDSNL-----IKSTYKTP 134
             P  S +   F  ++               I +L+NG I+ YD  L     I   Y   
Sbjct: 121 SAPSDSSVTSEFKIKADDHVVDIKILNKKKIIVVLKNGKIQTYDFELKLLNSINMAYN-- 178

Query: 135 HKDLVNVEFIES--------KYALLISQN---SISLYDINTMIELRNVANVQ--DIVDSD 181
                NV F+E          + L   +N    + L+ IN  IE  N + ++    +  +
Sbjct: 179 -----NVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILEN 233

Query: 182 FKSLDGKL-YQFNQ--KLS--KFDIWEISSMTIVNIITIPFINDVEKD--VVSFTVVDDN 234
           F   + K  YQF +  KL+  K  ++ +        IT+P I D+++   VVSF  +  N
Sbjct: 234 FPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPN 293

Query: 235 CVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLID--------NLSNQFVLGLS---FN 283
            +++ VN+ IY L+L  +S++S  EL +LK F+L+         N +    +G+S    +
Sbjct: 294 RILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGS 353

Query: 284 NENYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDS 343
           N     EL+N+D+ ++  +KDSLGK F+       +E     LKSLF     DE+ ++D 
Sbjct: 354 NPTSSLELLNVDVGTS-TIKDSLGKSFQT----SSTENNVQSLKSLFD----DENDYSDK 404

Query: 344 DSDVEHTFNYDKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIE 403
              V++ FNY+KI  +L  +  + +               +YTE DRF+ N +FL ++I+
Sbjct: 405 KKQVKN-FNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIID 463

Query: 404 LILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLG 463
           LI + +K       YPKT TYLLT PLFP+  TK LL +    PRL+KQAIVTCPNLPL 
Sbjct: 464 LIFETFK-----EEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLN 518

Query: 464 ELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDE----DX 519
           ELLA+LFTI N ELSLDISLR+LQDYT+DSIK+++K LPK+++ NFIEF+  +E    D 
Sbjct: 519 ELLAELFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDT 578

Query: 520 XXXXXXXXXXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSS 579
                            GLFALD  +L R+S +I+E+  +A+ N+EL HLLDY+      
Sbjct: 579 TNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYS---NVL 635

Query: 580 ARQSSKLIXXXXK------SLHRKTLPTYTVEHLDL 609
           A ++ K +    K       L  + LP Y+VE+LDL
Sbjct: 636 AYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  300 bits (767), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 228/679 (33%), Positives = 358/679 (52%), Gaps = 94/679 (13%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXL------TANSNSLDVAISKYAVSKFVINPTP 54
           MPS SQPF +  +PK             L      +  SN + + IS   +S+++INPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 55  KLINSIPIPSNEVVTAFHDTVFATAT-------------VNQKYTLHL------------ 89
            L+ ++PIPS   VTA +   F + T              N+ +TL++            
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYAT 120

Query: 90  -NGKKVPIQSKI-------MKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVN 140
             G+ V   S+        +K+   E   + +L+NG I+ YD  L +  +    + D+  
Sbjct: 121 SGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISF 180

Query: 141 VEFIES---KYALLIS-----QNSISLYDINT-----MIELRN-VANVQDIVDSDFKSLD 186
           VE  E    ++A+++S     + S  LY++ T     + EL + +    D+ +S      
Sbjct: 181 VEHFEEDGKQFAIILSNIEGKKISFKLYELFTNDKTSINELSSTILEDADLGESQICYQF 240

Query: 187 GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246
           GK+Y+  +   +  I+ +    +   I +PFI   + DV+SF+ + +N +++ VN+ IY 
Sbjct: 241 GKIYRLFE--DRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYL 298

Query: 247 LNLHLSSVISMSELLNLKWFKLIDNL----------SNQFVLGLSFNNENY---KFELIN 293
           L+L  +S+++  +L ++K ++L+ ++          S    +G+S  N        E+IN
Sbjct: 299 LDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVIN 358

Query: 294 LDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNY 353
           +D+ S   LKDSLGK F+   V     K+ + L+SLF  DE    ++   +   + +F+Y
Sbjct: 359 VDVGSG-TLKDSLGKSFQVANV-----KKNIPLQSLFPEDET---IYAKGE---QKSFDY 406

Query: 354 DKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDT 413
             I+ +L     + +               +YTE DRF+ +Q FL+ V++LI   +K D 
Sbjct: 407 KNILQELQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKD- 465

Query: 414 DGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIE 473
               YP+ LT+LLTHPLFP+S T+NLL KFR  PRL+KQA+VTCPNLPL ELLA+LFTI 
Sbjct: 466 ----YPRALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTIT 521

Query: 474 NNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV--TQDEDXXXXX-XXXXXXX 530
           N EL LDISLR+LQDYT+DSIK+++K L KVDI+NFIEFV  T  ED             
Sbjct: 522 NGELCLDISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVIDTDSEDKSQFNPQLFQLLS 581

Query: 531 XXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLIXXX 590
                 GLFAL+ + L ++S +I+ +  VA++N+ L HLLD N  K+S+  Q++      
Sbjct: 582 LVLDASGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQAND----- 636

Query: 591 XKSLHRKTLPTYTVEHLDL 609
              L  K+L  Y+VE+L+L
Sbjct: 637 QNVLQTKSLSAYSVEYLEL 655

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  298 bits (764), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 224/674 (33%), Positives = 343/674 (50%), Gaps = 90/674 (13%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXLTA------NSNSLDVAISKYAVSKFVINPTP 54
           MPS+SQ F +  +P+             L         SN + + IS+ A+S++V+NPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 55  KLINSIPIPSNEVVTA---------------FHDTVFATATVNQKYTLHLNGK------- 92
           KL+ SIPIPS  +VTA                      T  V  K +   NG        
Sbjct: 61  KLVLSIPIPSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLK 120

Query: 93  -KVPIQSKIMKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFI------ 144
            KV  Q+  + +   +   + +L+NG I+ YD  L +  +    + D+   +F       
Sbjct: 121 VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAND 180

Query: 145 ---------ESKYALLISQNSISLYDINTMIELRNVANVQD--IVDSDFKSLDGKLYQFN 193
                    E K    + + S+  Y+   + EL ++  ++D  +  S      G+LY+  
Sbjct: 181 FLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSII-LEDFSLATSKICYQSGRLYRLI 239

Query: 194 QKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYALNLHLSS 253
               +  ++ +    +V  +T+P +     DV+S   +  N +++  ++ IY LNL  +S
Sbjct: 240 GH--EVLVYALPQCQLVQAVTLPMVQGA--DVISMKPISSNRILVTADNKIYLLNLTHNS 295

Query: 254 VISMSELLNLKWFKLI----------DNLSNQ--FVLGLS---FNNENYKFELINLDLNS 298
           ++   EL +LK F+L+           +L NQ  FV+G+      N     E++N+D+ +
Sbjct: 296 ILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGT 355

Query: 299 NFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDKIIV 358
              LKDSLGKGF        +E  + VLK LFS ++ +     D D+  EH F++++I  
Sbjct: 356 G-TLKDSLGKGF-----TVSNEPISQVLKPLFSDEDNEA---EDEDNKFEH-FDFNQIYQ 405

Query: 359 DLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNY 418
            L K  ++ S               HYTE DRF+ ++ FL+ V+ LILQN++       Y
Sbjct: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-----EEY 460

Query: 419 PKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELS 478
           PK LT+LLTHPLFPV  T  LL + RE PRL+KQAIVTCPNLPL ELL++LF+IEN ELS
Sbjct: 461 PKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELS 520

Query: 479 LDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDXXXXXXXXXXXXXXXX---X 535
           LDISLR+LQDYT D IK++++ L K+D++NFIEFV    D                    
Sbjct: 521 LDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDS 580

Query: 536 XGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLIXXXXKSLH 595
            GLFALD  +L R++++I E+  +A++NS+L HLLD   + +  A+  +  +        
Sbjct: 581 IGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGST----- 635

Query: 596 RKTLPTYTVEHLDL 609
           R+ +P YTVE+LDL
Sbjct: 636 REAVPKYTVEYLDL 649

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  285 bits (729), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 217/684 (31%), Positives = 345/684 (50%), Gaps = 95/684 (13%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXL------TANSNSLDVAISKYAVSKFVINPTP 54
           MPSI QPF ++ +P+             L      + NSN + + IS+ A+S++++NPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 55  KLINSIPIPSNEVVTAFHDTVFA---------------------TATVNQKYTLHLNGK- 92
           KL+++I IPS  VV+A      A                        V+    L  +G  
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120

Query: 93  -----KVPIQSKI--MKLFSDESQTITILENGTIEKYDSNLIK-STYKTPHKDLVNVEFI 144
                K+ + SK+  +K+  D    + +LE+G I+ YD  L K S+    ++++  V + 
Sbjct: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180

Query: 145 E---SKYALLIS---QNSISL-------YDINTMIELRNVANVQ----DIVDSDFKSLDG 187
                 +  ++S    N +         +D      ++ ++       ++  S      G
Sbjct: 181 SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG 240

Query: 188 KLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYAL 247
           KLYQ     S    + +    +V    +P I D     VS   V  N +++ VN+ +Y L
Sbjct: 241 KLYQLEG--STIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLL 298

Query: 248 NLHLSSVISMSELLNLKWFKLIDNL--------------SNQFVLGLS---FNNENYKFE 290
           +L  SSV+S   L + K F+L+ +               +    +G++    NN     E
Sbjct: 299 DLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALE 358

Query: 291 LINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHT 350
           +IN+D+ +   LKDSLGK F++      ++ +T  L+ LFS DE+D   + DSD  V   
Sbjct: 359 VINVDVGTG-TLKDSLGKSFQSI-----NDSKTHNLQPLFSDDESDAGDNADSDEVV--A 410

Query: 351 FNYDKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYK 410
           F Y+ I  +L+K  K+ S               HYT+ +RF+ +Q+FL+KV+ LIL +  
Sbjct: 411 FAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDS-- 468

Query: 411 FDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLF 470
           FD +   YP+ LT+LLTHPLFP   T+ LL +FR  PRL+KQAIVTCPNLPL +LL++LF
Sbjct: 469 FDQE---YPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELF 525

Query: 471 TIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDXXXXXXXXXXX- 529
           +I N EL LDISLR+LQD+T D IK+++K L KVD+ NF+ F+   +D            
Sbjct: 526 SINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYEL 585

Query: 530 ----XXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSK 585
                      GLFALD  +L R+S++I+E+  +A++N+ L +LLD     ++  R ++ 
Sbjct: 586 FQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLD----TRNKNRGATG 641

Query: 586 LIXXXXKSLHRKTLPTYTVEHLDL 609
            +    ++   +TLP YTVE+L+L
Sbjct: 642 SLAGSSRA-KEQTLPKYTVEYLEL 664

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  265 bits (678), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 205/677 (30%), Positives = 327/677 (48%), Gaps = 97/677 (14%)

Query: 1   MPSISQPFAITTVPK------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTP 54
           M  I+QPF +  +PK                   L   SN++ V +S  ++S++VINPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 55  KLINSIPIPSNEVVTAFHDTVFATATVNQKYTLHLNGK---------------------- 92
           KL+ +IPIPS  VVT       +       Y L  NGK                      
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120

Query: 93  ------KVPIQSKIMK--LFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEF 143
                 K  ++ ++++  + S   + + +L+ G I+ YD  L +  +    + ++  VE+
Sbjct: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180

Query: 144 I------ESKYALLISQN---SISLYDINTMIELRNVANVQDIVDSDFKSLDGKL-YQFN 193
                  +  + L   QN      L+ +N   E   +  +  ++  DF   + K+ YQF 
Sbjct: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFG 240

Query: 194 QKL----SKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYALNL 249
           +      SK  ++ +    + + + +PF+   + D VS   +  N +++   + I+ L+L
Sbjct: 241 KLYRLVDSKMYVYSLPHFQLSHCVPLPFVR--KDDQVSLQAISTNRLLLTCCNKIFLLDL 298

Query: 250 HLSSVISMSELLNLKWFKLIDNL---------SNQ-FVLGLS---FNNENYKFELINLDL 296
             ++++   EL N+K+F+L+            SN+ F +G+S    +N +   +++ + +
Sbjct: 299 LHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAV 358

Query: 297 NSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDKI 356
            +   LKDSLGKGF +        + T  LK LF  D+           D     ++  I
Sbjct: 359 GTG-TLKDSLGKGFLS-----GEHRRTEALKPLFGTDD-----------DESPNIDFAAI 401

Query: 357 IVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTDGN 416
           + +L      P                +YTE DRF+ N +FLA +++ I     F T  +
Sbjct: 402 LAELTSRT-TPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHI-----FATFAD 455

Query: 417 NYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNE 476
            +PK L YLLTHPLFP S TK LLPK +  PRL+KQA+VTCPNLPL ELL +LFT+ N+E
Sbjct: 456 EFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDE 515

Query: 477 LSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQD-----EDXXXXXXXXXXXXX 531
           LSLD+SLRVLQ++TK+ IK+ I+ L +VD+ NF+ FV +D     E              
Sbjct: 516 LSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSL 575

Query: 532 XXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLIXXXX 591
                GL AL+ DIL R+S FI+ +  VA Q  ELL+LL+ + +K+     S   +    
Sbjct: 576 VIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNS---VTRLD 632

Query: 592 KSLHRKTLPTYTVEHLD 608
           +S    T+P Y+VE+LD
Sbjct: 633 ESPVAATIPLYSVEYLD 649

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  263 bits (673), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 216/680 (31%), Positives = 335/680 (49%), Gaps = 99/680 (14%)

Query: 1   MPSISQPFAITTVPKQX------XXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTP 54
           M SISQPF +T +PK                   LT ++N +++ +S  ++S+++INPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 55  KLINSIPIPSNEVVTAF---------HDT----VFATATV-NQKYTLH------------ 88
           KL++++ IPS  +VTA           DT    V+  A V N+ +TL+            
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120

Query: 89  ------LNGKKVPIQSKI--MKLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVN 140
                     KV I+ K+  +K+F      I +L+NG ++ +D  L      +      N
Sbjct: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQL--KLLHSADISYGN 178

Query: 141 VEFIESKYALLISQNSISLYDIN------TMIELRN------VANVQDIVDSDFKSLDGK 188
           +  ++     ++    I L D+N       + E+ +      +  +  ++   F   + K
Sbjct: 179 ISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSK 238

Query: 189 -LYQFNQKLS----KFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNST 243
             YQF +  +    K  I+ +    + N I +PF+    ++VVSF  +  N  ++ V++ 
Sbjct: 239 TFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFV--THENVVSFKPISTNRALLTVDNR 296

Query: 244 IYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGLSF---NNENYKFEL 291
           IY L+L  ++++S  EL ++K F+L+            +    +G+S    NN     ++
Sbjct: 297 IYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDI 356

Query: 292 INLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTF 351
           +N+++ S   LKDS+ KGF   L    +E+   VL SLF   + + D    S       F
Sbjct: 357 VNINVGSG-TLKDSMSKGF---LTQDATEE---VLNSLFDEQDDELDEDGTSQ------F 403

Query: 352 NYDKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKF 411
           +Y++I+ +L KA                    +YTE DRF  +Q FL KV+ LI +N+  
Sbjct: 404 DYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENF-- 461

Query: 412 DTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFT 471
                 YP+ LTYLLTHPLFP      LL KF+E PRL++QAIVTCPNLPL  LL +LFT
Sbjct: 462 ---NKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFT 518

Query: 472 IENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDXXXXXXXX----X 527
           + N+EL LD+SLR+LQD+TKDSIK+ IK + KVDI NFI FV  ++D             
Sbjct: 519 VINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQ 578

Query: 528 XXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLI 587
                    GLFALD + L  +  FI  +  + +QN ELL+LLD   +K +S   S    
Sbjct: 579 LLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYS-- 636

Query: 588 XXXXKSLHRKTLPTYTVEHL 607
                S   + LP+Y+VE+L
Sbjct: 637 --ASSSTTEQALPSYSVEYL 654

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  260 bits (664), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 236/718 (32%), Positives = 358/718 (49%), Gaps = 127/718 (17%)

Query: 1   MPSISQPFAITTVPK-------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPT 53
           MPS+SQPF +T +PK                        +N + + +S  A+S+++INPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 54  PKLINSIPIPSNEVVTAF----------HDTVFATATV-NQKYTLHLNGKKVPIQSKIMK 102
           PKLI + PIPS  +VTA           ++ V+    V N+ YTL L  K     S  M+
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATME 120

Query: 103 L-----------FSDE---------------------SQTITILENGTIEKYDSNL-IKS 129
                         DE                        + +LENG I+ ++S+L + +
Sbjct: 121 DDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLN 180

Query: 130 TYKTPHKDLVNVEFIE------SKYALLIS------QNSISLYDIN--TMIELRNVANVQ 175
           T K  +K   NV+F+E        +   I       +  I L+ IN  + IEL +     
Sbjct: 181 TVKINYK---NVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQINNDSAIELNS----- 232

Query: 176 DIVDSDFKSLDGKL-YQFNQ--KLSKFD--IWEISSMTIVNIITIPFINDVEKDVVSFTV 230
            I+  +F   + K  YQF +  KL+  +  ++ +    + +  TIP I   +  +VS   
Sbjct: 233 -IIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI-KTDDQIVSMKP 290

Query: 231 VDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLI--------DNLSNQFVLGLSF 282
           +  N +++ +N+ IY L+L  +S++S  EL +LK  +L+        +N +    +G+S 
Sbjct: 291 ISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVST 350

Query: 283 N---NENYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDL 339
               N     E+IN+D+ SN  LKDSLGK F+N  +  Q +  T  LK LF     D + 
Sbjct: 351 KFGVNPTSSLEIINVDVGSN-TLKDSLGKCFQNLNLQNQIQISTQALKPLF-----DPNT 404

Query: 340 HNDSDSDV------EHTFNYDKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLV 393
             D D D+      +  FNYD+I+  L++   +                 HYTE DRF+ 
Sbjct: 405 DGDKDDDLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIY 464

Query: 394 NQDFLAKVIELILQNYKFDTDG-----NNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPR 448
           N +F  K+I+LI +  KF +       N YPKTLT+LLTHPLFP+  T++LL +F   PR
Sbjct: 465 NHEFFLKLIDLIFE--KFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPR 522

Query: 449 LYKQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRN 508
           L+KQAIVTCPNLPL ELL +L TI+NNELSLDISLR+LQDY+KDSIK++++ LP+++I N
Sbjct: 523 LFKQAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIEN 582

Query: 509 FIEFVTQDE--DXXXXXXXXXXXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSEL 566
           FI+F+  DE  D                  GLFAL  +IL  +S +I+ +  + ++N+EL
Sbjct: 583 FIDFILNDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTEL 642

Query: 567 LHLLDYN---------PSKQSSARQSSKLIXXXXKSL------HRKTLPTYTVEHLDL 609
            +L+D N          +  SSA  S+        S        ++ LP Y+V++L+L
Sbjct: 643 WYLIDSNNNIFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  258 bits (659), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 211/678 (31%), Positives = 354/678 (52%), Gaps = 95/678 (14%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXL------TANSNSLDVAISKYAVSKFVINPTP 54
           MPS+SQPF +  +PK             L      T +SN + + +S  AVS++VINPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 55  KLINSIPIPSNEVVTAFHDTVFATA-------------TVNQKYTLHLNGKKV------P 95
            +  ++PIPS   VTA +   +  A              VN+K TLH+  K V       
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120

Query: 96  IQSKIMKLFS-------------DESQTITI-LENGTIEKYDSNL-IKSTYKTPHKDLVN 140
            QS  ++ ++              E +TI + L NG I+ +D  L + ++  T + ++  
Sbjct: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180

Query: 141 VE-FIESK--YALLIS-----QNSISLYDI----NTMIELRNVANVQDIV--DSDFKSLD 186
            E F+E+K  +A+++S     + S  LY++     T I+  +   ++DI   DS      
Sbjct: 181 SEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQF 240

Query: 187 GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246
           GKLY+  +  ++  ++ +    +V+ IT+P I+  +   +SF  V +N +++ V++ I+ 
Sbjct: 241 GKLYRLYK--NQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298

Query: 247 LNLHLSSVISMSELLNLKWFKLI--------DNLSNQFVLGLSFNNENYKFELINLDL-N 297
           L+L   + ++   L ++K F+L+        D  +N   + +  + +N    +  L++ N
Sbjct: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIIN 358

Query: 298 SNFG---LKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYD 354
           +N G   LKDSLG  F     D     ++ +L+ LF+         +D++    H F Y+
Sbjct: 359 ANVGTGTLKDSLGNSF-----DVSKSFKSNILQPLFT---------DDANLVKRHDFKYE 404

Query: 355 KIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTD 414
            I+  L+    +                 +YT+ +RF+ +  FL+ VI+LI +N++    
Sbjct: 405 AILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ---- 460

Query: 415 GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIEN 474
              YP  LT+LLTHPLFP+  TKNLL K RE PRL+KQA+VTCPNLP+ ELL +LF+I N
Sbjct: 461 -KEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITN 519

Query: 475 NELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV---TQDEDXXXXXXXXXXXXX 531
            ELS+DISLR+LQDYTKDSIK ++K L K+DI+NFI+FV     +E+             
Sbjct: 520 GELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSL 579

Query: 532 XXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLIXXXX 591
                GLF+++  +L ++S +I+++  + +++++L HL+D    K+++  Q+S       
Sbjct: 580 VLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEI 639

Query: 592 KSLHRKTLPTYTVEHLDL 609
           K+     L  Y+VE+L+L
Sbjct: 640 KA-----LTAYSVEYLEL 652

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  253 bits (645), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 196/641 (30%), Positives = 331/641 (51%), Gaps = 94/641 (14%)

Query: 1   MPSISQPFAITTVPK------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTP 54
           MPSISQPF +T +PK                   LT  +N+++V +S  AVS+++INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 55  KLINSIPIPSNEVVTAF-------------HDTVFATATVNQKYTLHLNGK--------- 92
           KL+ + PI S  VV+A               + +      N+ Y+L    K         
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120

Query: 93  ---------KVPIQSKI--MKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVN 140
                    KV +  +I  +K+F D    + +L +G I+ +D  L ++ +  + +K++  
Sbjct: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180

Query: 141 VEFIES----KYALLIS-----QNSISLYDINTMIELRNVANVQDIVDSDFKSLDGKL-Y 190
           V+   S    +Y  L+S     + S  L++I           +  ++  +    D ++ Y
Sbjct: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240

Query: 191 QFNQ----KLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246
           QF Q      +   I+ +        I +PF+    + ++SF  +  N  ++  ++ I+ 
Sbjct: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPFL--APESIISFKPISTNRALLTSDNKIFL 298

Query: 247 LNLHLSSVISMSELLNLKWFKLIDN--------LSNQFV-LGLSF---NNENYKFELINL 294
           L+L  ++++S  E+ ++K F+L++         L+N+ + LG+S    +N +   ++IN+
Sbjct: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINI 358

Query: 295 DLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYD 354
           D+ +   L+DS+GKGF +       E ++  L+ L S         ND+++     FNYD
Sbjct: 359 DVGTG-TLRDSMGKGFMS------RENKSQHLQPLIST-------LNDTEA---AEFNYD 401

Query: 355 KIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTD 414
           +I+ +L+KA  N                 +YT++DRF+ +++FL  V  LI +++K    
Sbjct: 402 RILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK---- 457

Query: 415 GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIEN 474
            + YPK LTYLLT+PLFPVS T NLL K ++ PRL+KQAIVTCPNL L EL+ +LFT+ N
Sbjct: 458 -SEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVIN 516

Query: 475 NELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVT----QDEDXXXXXXXXXXXX 530
           +EL LD+SLR+LQD+ KDSIKE IK   K+D+ NFI FV     +++             
Sbjct: 517 DELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLS 576

Query: 531 XXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLD 571
                 GLFAL+ ++L +++ +I+++  V K+N EL +L++
Sbjct: 577 LVLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVE 617

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  248 bits (634), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 193/553 (34%), Positives = 298/553 (53%), Gaps = 53/553 (9%)

Query: 92  KKVPIQSKI--MKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVE-FIESK 147
           K + + SK+  +K+F +    + +L+NG ++ +D +L +KS+    + D+  V+ F ESK
Sbjct: 164 KTIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESK 223

Query: 148 YALLI---------SQNSISLYDINTMIELRNVANVQDIVDSDFKSLDGKL-YQFNQ--- 194
              L+         S     LY +    +   V+ +   +  DF     KL YQF +   
Sbjct: 224 QNFLLILSNIDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYR 283

Query: 195 -KLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYALNLHLSS 253
              S+  ++ +    ++  I++  I     DV S   V +N +V+A+N+ +Y ++    S
Sbjct: 284 LTGSELFVYSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRS 343

Query: 254 VISMSELLNLKWFKLIDNLS--------NQFVLGLSFNN---ENYKFELINLDLNSNFGL 302
           +++  E  ++K F+L+ + +            +G+S  +        ELIN+++ S   L
Sbjct: 344 ILAEREFTHVKTFQLLQSATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSG-TL 402

Query: 303 KDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADE-DLHNDSDSDVEH--TFNYDKIIVD 359
           KDSLGKG       K SE     LK LF  DE DE  L      D+ +  +FN++KI+ D
Sbjct: 403 KDSLGKGVSK----KLSEGSHSDLKPLF--DENDEKSLIGTPVHDISNVKSFNFNKILAD 456

Query: 360 LNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNYP 419
           L K+    S               HYTE DRF+ +QDF+A  I+LI +  KFDT+   +P
Sbjct: 457 L-KSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFK--KFDTE---FP 510

Query: 420 KTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELSL 479
           K  T+LLTHPLFP+ LT  LL K ++ PRL+KQAIVTCPNLPL ELL  LFT++N EL+L
Sbjct: 511 KAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTL 570

Query: 480 DISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV---TQDEDXXXXXXXXXXXXXXXXXX 536
           DISLRVLQDY+++ +K++IK L  VDI NFIEF+   T +E                   
Sbjct: 571 DISLRVLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEIQTNTPQLFQLLSLVLDSI 630

Query: 537 GLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLIXXXXKSLHR 596
           GLFAL   +L R+SN+INE+  +A+++SEL HLLD + + +       K +       ++
Sbjct: 631 GLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIG-----NK 685

Query: 597 KTLPTYTVEHLDL 609
           +TL  Y+V++LD+
Sbjct: 686 ETLSVYSVDYLDI 698

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 1  MPSISQPFAITTVPKQXXXXXXXXXXXXL-------TANSNSLDVAISKYAVSKFVINPT 53
          MPS+SQPF +  +PK             L       T ++N + + IS   +S+++INPT
Sbjct: 1  MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 54 PKLINSIPIPSNEVVTA 70
          PKL+ +I IPS   VTA
Sbjct: 61 PKLLFNIAIPSTNNVTA 77

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  248 bits (632), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 200/576 (34%), Positives = 308/576 (53%), Gaps = 81/576 (14%)

Query: 89  LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVNVEFIES 146
           L+  K+  ++K+M  K+ +  +  I IL+NG IE YD  L     K  H    ++ +   
Sbjct: 156 LSQYKIKAKAKVMSIKIDTKNNLIIAILQNGLIEFYDFKL-----KLLHS--FDISYDNL 208

Query: 147 KYALLISQNSIS-------LYDINTMIELRNVANVQDIVDSDFKSLD------------- 186
           KYA   ++N I        L D     +L  + + ++  +S  K L              
Sbjct: 209 KYAKWFTENGIEFIFVLCPLQDDKVCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSK 268

Query: 187 -----GKLYQFNQKLSKFDIWEISSMTIVNIITIPFIN--DVEKDVVSFTVVDDNCVVMA 239
                GKLY+ N+   K  ++ +    +  +I +P IN  D E D++SF  V  N V++ 
Sbjct: 269 LCYQFGKLYKLNK--GKIYVYSLPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLT 326

Query: 240 VNSTIYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGLSFNNE---NY 287
           VN+ +Y L+L   S +   EL ++K F+L++           S    +G+S  N      
Sbjct: 327 VNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEKSHSSKTIAIGISTKNGANPTS 386

Query: 288 KFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKE--TLVLKSLFSADEADEDL--HNDS 343
             E+IN+D+ +N  LKDSLGK F       Q+EK+  +++LK LF  +E  E++   N+ 
Sbjct: 387 SLEIINIDVGTN-TLKDSLGKSF-------QAEKKDSSVILKPLFDDEEVTENMVKRNNI 438

Query: 344 DSDVE-HTFNYDKIIVDLNKAVKNP-SXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKV 401
           D D+   TF YD+IIV L+    N  +               HYTE DRF+ +  FL KV
Sbjct: 439 DGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEEHYTEKDRFISDLVFLNKV 498

Query: 402 IELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLP 461
           ++LI + +    +GN+YPKTLT+LLTHPLFP+  T+NLL   R+ PRL+KQAIVTCPNLP
Sbjct: 499 LDLIFEKF----NGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQPRLFKQAIVTCPNLP 554

Query: 462 LGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDE---- 517
           L ELL +LF+I N EL LDIS R+LQD+T+DSIK+++K L K+DI+NFIEF+T  E    
Sbjct: 555 LNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTSTENDNS 614

Query: 518 ----DXXXXXXXXXXXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYN 573
               +                  GLF+L+  +L  ++++I+++  +A++N+EL +L+D  
Sbjct: 615 LEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVKIAERNTELWNLIDIK 674

Query: 574 PSKQSSARQSSKLIXXXXKSLHRKTLPTYTVEHLDL 609
            S+          +     S  ++ LPTYT+E+LD+
Sbjct: 675 SSQHGFTN-----LAFESASSQKQALPTYTMEYLDI 705

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 1  MPSISQPFAITTVPK-------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPT 53
          MPS+SQPF +  +PK                       ++N++ + IS  +VS+++INPT
Sbjct: 1  MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 54 PKLINSIPIPSNEVVTA 70
          PKLI   PIPS  ++TA
Sbjct: 61 PKLIFDYPIPSTNIITA 77

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  239 bits (609), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 197/643 (30%), Positives = 319/643 (49%), Gaps = 101/643 (15%)

Query: 1   MPSISQPFAITTVPK------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTP 54
           M SISQPF ++ +PK                   L+ ++N +++ IS  ++S+++INPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 55  KLINSIPIPSNEVVTAF-------HDTVFATATVNQKYT-LHLNGK-------------- 92
           KL+ ++PIPS  +VTA        +  V+      +K + LHL  K              
Sbjct: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEI 120

Query: 93  ----KVPIQSKI--MKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFIE 145
               K  ++S++  +K++S   + + IL NG I+ +D  L + +T    + D+  V+F +
Sbjct: 121 TSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQ 180

Query: 146 SK------------------YALL-ISQNSISLYDINTMIELRNVANVQDIVDSDFKSLD 186
                               Y L  +   S+S  ++N++I L N       +  +F    
Sbjct: 181 DGQGNDFFFVLCQLSDEKICYKLFQVRSESVSCIELNSII-LENYTLENAKLCFEF---- 235

Query: 187 GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246
           GKLY      ++  I+++  + +   I +PFI+  +  VVS   V  N V++  ++TIY 
Sbjct: 236 GKLYVLKNS-NELSIYQLPHLQLQTSIQLPFIS--KDAVVSIKPVSSNRVLLTADNTIYL 292

Query: 247 LNLHLSSVISMSELLNLKWFKLIDNL-------SNQFVLGLSFNNENYK-----FELINL 294
           ++L  ++++   +L N+K  +L+           N+  + L    +N        ++IN+
Sbjct: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINI 352

Query: 295 DLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYD 354
           D+ +   LKD++GKGF    + KQ +K    L+ LF     D+D+   S        +Y+
Sbjct: 353 DVGTG-TLKDAMGKGF----MVKQKQK----LQKLFEESNEDDDVELPSP-------DYE 396

Query: 355 KIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVIELILQNYKFDTD 414
           +II  L+   K                  +YT+ DRFL + D L ++I+ +  N+K    
Sbjct: 397 RIIKQLH-ICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK---- 451

Query: 415 GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIEN 474
            + YPK LTYLLTHPLFP    K LL K + +PRL+KQAIVTCPN+PL +LL +LF I N
Sbjct: 452 -DEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITN 510

Query: 475 NELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV----TQDEDXXXXX-XXXXXX 529
            EL  DI+LRVLQDY K+SIK  I+ + K+DI NF++ +      D D            
Sbjct: 511 AELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLM 570

Query: 530 XXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDY 572
                  GLFALD + L ++S+F++ +  V  QN ELLHL ++
Sbjct: 571 SLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEH 613

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  239 bits (609), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 194/576 (33%), Positives = 314/576 (54%), Gaps = 80/576 (13%)

Query: 89  LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFIE 145
           L+  K+  + K+M  K+ +  S  I +L+NG +E YD  L +  +Y   + +L       
Sbjct: 163 LSQYKIKTKDKVMNIKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNL------- 215

Query: 146 SKYALLISQNS-------ISLYDINTMIELRNVANVQDIVDSDFKSLD------------ 186
            KYA   ++N          L D     +L  +++ +    S  K L             
Sbjct: 216 -KYAKWFTENGTEFVFVLCPLEDDKVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESS 274

Query: 187 ------GKLYQFNQKLSKFDIWEISSMTIVNIITIPFIND--VEKDVVSFTVVDDNCVVM 238
                 GKLY+ NQ   K  ++ +    +  II +P IN    E D++SF  V  N +++
Sbjct: 275 KFCYQFGKLYKLNQ--GKIHVYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILL 332

Query: 239 AVNSTIYALNLHLSSVISMSELLNLKWFKL-----IDNLSNQ----FVLGLSFNNE---N 286
            VN+TIY L+L   S+++  EL +++ F+L     ID+  +Q      +G+S  N     
Sbjct: 333 TVNNTIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPT 392

Query: 287 YKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDL--HNDSD 344
              E+IN+D+ +N  LKDSLGK F+      +++  ++VLK LF  +   +++   ND D
Sbjct: 393 SSLEIINIDVGTN-TLKDSLGKSFQ----IGKNDTSSVVLKPLFDDENVADNMVKRNDID 447

Query: 345 SDVE-HTFNYDKIIVDLNKAVKNP--SXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKV 401
            ++   TF YD+II  ++ A+KN   +               HYTE DRF+ + +FL +V
Sbjct: 448 GNISVPTFQYDEIIKKIS-ALKNNDVASFDDIFFKDLKVKEEHYTEKDRFISDSEFLNRV 506

Query: 402 IELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLP 461
           ++LI + +    +GN+YPK LT+LLTHPLFP++ T NLL + R+ PRL+KQAIVTCPNLP
Sbjct: 507 LDLIFEKF----NGNDYPKALTFLLTHPLFPLNRTHNLLSRLRDQPRLFKQAIVTCPNLP 562

Query: 462 LGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQ-DEDXX 520
           L ELL +LF+I N EL LDIS R+LQD+T+DSIK+++K L K+DI+NFI+F+T  DED  
Sbjct: 563 LNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQNFIDFITNTDEDST 622

Query: 521 XXXXXXXXXXXXXX-------XXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYN 573
                                  GLF+L+  +L  ++++I+++  +A++N+EL +L++  
Sbjct: 623 LENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLASYIDKQVEIAERNTELWNLVETK 682

Query: 574 PSKQSSARQSSKLIXXXXKSLHRKTLPTYTVEHLDL 609
            S+      +S       ++  ++ LPTYT+E+L++
Sbjct: 683 GSQHGFTNMNSD-----SRTSQKQALPTYTMEYLEI 713

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 1  MPSISQPFAITTVPKQXXXXXXXXXXXXLTAN-------SNSLDVAISKYAVSKFVINPT 53
          MPS+SQPF + T+PK             +          +N++ + IS  ++S+++INPT
Sbjct: 1  MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 54 PKLINSIPIPSNEVVTA 70
          PKL    PIPS  ++TA
Sbjct: 61 PKLTFDYPIPSTNIITA 77

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  224 bits (570), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 193/575 (33%), Positives = 299/575 (52%), Gaps = 79/575 (13%)

Query: 89  LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVNVEFIES 146
           L+  K+  ++K+M  K+ +  S  I +L+NG IE YD  L K  Y        ++ +   
Sbjct: 164 LSQHKIKTKAKVMNIKIDAKNSLIIAVLQNGLIEFYDLKL-KLLYS------FDISYDNL 216

Query: 147 KYALLISQNSISLYDINTMIELRNVANVQDIVDSDFKSLD-------------------- 186
           KYA   ++N      +   +E   V   + +  SDF+S D                    
Sbjct: 217 KYAKWFTENGTDFVFVLCPLEDDKVC-YKMLELSDFESKDNSPIKELSSTIIEGFSFESS 275

Query: 187 ------GKLYQFNQKLSKFDIWEISSMTIVNIITIPFIN--DVEKDVVSFTVVDDNCVVM 238
                 GKLY+ NQ   K  ++ +    +  II +P IN  + E D++SF  V  N +++
Sbjct: 276 KLCYQFGKLYKLNQ--GKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILL 333

Query: 239 AVNSTIYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGLSFNNE---N 286
            VN+ IY L+L   S+++  EL ++K F+L+ +          S    +G+S  N     
Sbjct: 334 TVNNIIYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPT 393

Query: 287 YKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDL--HNDSD 344
              E+IN+D+ +N  LKDSLGK F+   V K     +++LK LF  ++   ++   ND D
Sbjct: 394 SSLEIINIDVGTN-TLKDSLGKSFQ---VGKNDA--SVILKPLFDDEDVTNNMVKRNDID 447

Query: 345 SDVE-HTFNYDKIIVDLNKAVKNP-SXXXXXXXXXXXXXXXHYTEADRFLVNQDFLAKVI 402
            ++    F+YD++I  L+    N  +               HYTE DRF+ +  FL KV+
Sbjct: 448 GNINVPIFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVL 507

Query: 403 ELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPL 462
           +LI   +     GN+YPK LT+LLTHPLFP++ T  LL   R+ PRL+KQAIVTCPNLPL
Sbjct: 508 DLIFLKF----GGNDYPKALTFLLTHPLFPLNRTHGLLSLLRDQPRLFKQAIVTCPNLPL 563

Query: 463 GELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDXX-- 520
            ELL +LF+I N EL LDIS RVLQD+T+DSIK+++K L K+DI+NFIE +T  E+    
Sbjct: 564 NELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEEDGPL 623

Query: 521 ------XXXXXXXXXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNP 574
                                 GLF+L+  +L  ++ +I+++  +A++N+EL +L+D   
Sbjct: 624 EGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKG 683

Query: 575 SKQSSARQSSKLIXXXXKSLHRKTLPTYTVEHLDL 609
           S+   A  SS        +  ++ LP Y +E+LD+
Sbjct: 684 SQHGFATLSSG-----STTSQKQALPAYAMEYLDI 713

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 1  MPSISQPFAITTVPK-------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPT 53
          MPS+SQPF + T+PK                       ++N++ + IS  ++S+++INPT
Sbjct: 1  MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 54 PKLINSIPIPSNEVVTA 70
          PKL    PIPS  V+TA
Sbjct: 61 PKLTFDYPIPSTNVITA 77

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  217 bits (552), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 296/587 (50%), Gaps = 86/587 (14%)

Query: 82  NQKYTLH---LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNLIKSTYKTPHK 136
           N+ YT     L+  K+  ++K+M  K+ +  S  I IL+NG IE +D       +K    
Sbjct: 154 NKAYTGSDEFLSQYKIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFD-------FKLTLL 206

Query: 137 DLVNVEFIESKYALLISQNS-------ISLYDINTMIELRNVANVQDIVDSDFKSLD--- 186
              ++ +   KYA   ++N          L D     +L  + +      S  K L    
Sbjct: 207 HSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESSPIKELSSTI 266

Query: 187 ---------------GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEK--DVVSFT 229
                          GKLY+ NQ   K  I+ +    +  +I  P ++ +    D++SF 
Sbjct: 267 IEGFSFENSKLCYQFGKLYKLNQ--GKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQ 324

Query: 230 VVDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGL 280
            V  N V++ VN+ IY L+L   S +S  EL ++K F+L+ +          S    +G+
Sbjct: 325 PVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGI 384

Query: 281 SFNNE---NYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADE 337
           S  N        E+IN+D+ +N  LKDSLGK F+       +   +++LK LF   + ++
Sbjct: 385 STKNGPNPTSSLEIINIDVGTN-TLKDSLGKSFQ-----VGNNDSSVILKPLFDDKDIND 438

Query: 338 ------DLHNDSDSDVEHTFNYDKIIVDLNKAVKNP-SXXXXXXXXXXXXXXXHYTEADR 390
                 D+  DS   V H    +++I  L+    N  +               HYTE DR
Sbjct: 439 KRVKCNDVSGDSSVPVLHC---NEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDR 495

Query: 391 FLVNQDFLAKVIELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLY 450
           ++ +  FL KV++LI   +     GN+YPKTLT+LLTHPLFP+S T+NLL   R+ PRL+
Sbjct: 496 YISDPGFLNKVLDLIFGKFS----GNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLF 551

Query: 451 KQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFI 510
           KQAIVTCPNLPL ELL +LF+I N EL LDIS R+LQD+T+DSIK+++K L K+D++NFI
Sbjct: 552 KQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFI 611

Query: 511 EFVTQ-DEDX-------XXXXXXXXXXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQ 562
           EF+T   ED                         GLF+L+  +L  ++ +I+++  +A++
Sbjct: 612 EFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAER 671

Query: 563 NSELLHLLDYNPSKQSSARQSSKLIXXXXKSLHRKTLPTYTVEHLDL 609
           N+EL +L+D    +   A  +         +  ++ LPTYT+E+LD+
Sbjct: 672 NTELWNLIDTKGFQHGFASST-----FDNGTSQKRALPTYTMEYLDI 713

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 1  MPSISQPFAITTVPK-------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPT 53
          MPS+SQPF + T+PK                       ++N++ + IS  ++S+++INPT
Sbjct: 1  MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 54 PKLINSIPIPSNEVVTA 70
          PKL    PIPS  ++TA
Sbjct: 61 PKLTFDYPIPSTNIITA 77

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  215 bits (548), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 209/709 (29%), Positives = 345/709 (48%), Gaps = 131/709 (18%)

Query: 1   MPSISQPFAITTVPKQXXXXXXXXXXXXL------TANSNSLDVAISKYAVSKFVINPTP 54
           MPS+SQPF +  +PK             +      T +SNS+ + IS  ++SK+VI PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 55  KLINSIPIPSNEVVTAFH----------------------DT-----------------V 75
           +LI ++PIPS  +V+A +                      DT                  
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 76  FATATVNQKYTLHLNGKKV----------------PIQSKIMKLFSDESQTITIL--ENG 117
           +A +  N+ +TL+   ++V                  + +I+ +  D    + ++  E G
Sbjct: 121 YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG 180

Query: 118 TIEKYDSNL-IKSTYKTPHKDLVNVEFIES---KYALLIS-----QNSISLYDINTMIEL 168
            ++ YD  L + ++  TP++D+  V+  E    +Y LLIS     + ++ LY+++T  E 
Sbjct: 181 LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVST--EE 238

Query: 169 RNVANVQDIVDSDFKSLDGKL-YQFNQKLSKF----DIWEISSMTIVNIITIPFINDVEK 223
           + V  +   +  +F   D  L YQF +    F    +++ I S+ + + + IPF++++E 
Sbjct: 239 KKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIED 298

Query: 224 D--VVSFTVVDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNLSNQ------ 275
              ++S   +  N V++ V + IY L+L   S++S  E+ ++K F+++    N+      
Sbjct: 299 KNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSESK 358

Query: 276 --FVLGLS---FNNENYKFELINLDLNSNFGLKDSLGKGF--RNFLVDKQSEKETLVLKS 328
               LG+S     N     E+IN+D+ SN  LKDSLGK F  RN  +  Q       LK+
Sbjct: 359 LTLALGISTKNGQNPTSALEIINIDVGSN-SLKDSLGKSFLRRNNQIQGQ-------LKN 410

Query: 329 LFSADEADEDLHNDSDSDVEHTFNYDKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEA 388
           LF   E   +L          + N+ +I+  L  A  +                  +TE 
Sbjct: 411 LFP--EPKYELP---------SINFPEILGKLKNA-NSAEKFDETFFNLLNIKEEMFTEN 458

Query: 389 DRFLVNQDFLAKVIELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPR 448
            RFL +Q FLA V++LI     ++    + P++L +LLTHPLFP      LL K + + R
Sbjct: 459 SRFLNDQRFLASVLDLIFTKIDYN---KSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSR 515

Query: 449 LYKQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRN 508
           L+KQAIVTCPNLPL ELL +LFTI+N+EL +DIS+R+LQDYTKD+IKE+IK L +V + N
Sbjct: 516 LFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVEN 575

Query: 509 FIEFVTQDEDXXXXXXXXXX--------XXXXXXXXGLFALDMDILGRISNFINEKTLVA 560
           F+ F+ +  +                          GLF L+  IL ++S+ I ++  +A
Sbjct: 576 FMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIA 635

Query: 561 KQNSELLHLLDYNPSKQSSARQSSKLIXXXXKSLHRKTLPTYTVEHLDL 609
           ++N EL +++D   +K  S ++SS         L   +   Y VE++D+
Sbjct: 636 ERNVELWNIMD---AKMLSVKKSS---STAASKLAENSQTPYIVEYIDI 678

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  202 bits (514), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 138/400 (34%), Positives = 218/400 (54%), Gaps = 43/400 (10%)

Query: 226 VSFTVVDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLI-------DNLSNQFVL 278
           +SF  +  N  ++  ++ +Y L+L  ++++S  E  ++K F+L+       ++ SN   +
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 279 GLSF-----NNENYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSAD 333
            +       N      +++N+D+ +   LKDS+GKGF +      S+ +    +SL    
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTG-TLKDSMGKGFLS------SKTKVQCPQSL---- 109

Query: 334 EADEDLHNDSDSDVEHTFNYDKIIVDLNKAVKNPSXXXXXXXXXXXXXXXHYTEADRFLV 393
                L   +D++V+   NY +I+ DL K   N                 +YT++DRFL 
Sbjct: 110 -----LGTPNDTEVQE-HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLN 163

Query: 394 NQDFLAKVIELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQA 453
           +Q+FL   ++LI +N++     + YPK LTYLLTHPLFP++ T +LL K ++ PRL+KQA
Sbjct: 164 DQEFLGNSLKLIFENFQ-----SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQA 218

Query: 454 IVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV 513
           IVTCPNLPL +LL +LFT+ N+EL LD+SLR+LQD++KDSIK  IK   KVD+  FI FV
Sbjct: 219 IVTCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFV 278

Query: 514 TQ---DEDXXXXX-XXXXXXXXXXXXXGLFALDMDILGRISNFINEKTLVAKQNSELLHL 569
                DED                   GLFAL+ + L ++SN+I+ +  V KQN +L +L
Sbjct: 279 MNENVDEDRVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNL 338

Query: 570 LDYNPSKQSSARQSSKLIXXXXKSLHRKTLPTYTVEHLDL 609
           +D    K    +  +  +     S+    +  Y+VE L+L
Sbjct: 339 VDERNFKNILGQHHADSL-----SVGEGAITAYSVEQLEL 373

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 54/192 (28%)

Query: 1   MPSISQPFAITTVPK------QXXXXXXXXXXXXLTANSNSLDVAISKYAVSKFVINPTP 54
           MPSISQPF +T +PK                   LT  +N ++V IS  A+S++VINPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 55  KLINSIPIPSNEVVTAF----------------HDTVFATATVNQKYTLHLNGKKVPI-- 96
           KL+ ++PI S  VVTA                 H+ +      N+ +++    K +P   
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPSAA 120

Query: 97  ------------------QSKIMKLFSDESQTITILENGTIEKYDSNL-----IKSTYKT 133
                             Q+  +K+F      + +L +G I+ +D +L     I S+Y  
Sbjct: 121 TDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYG- 179

Query: 134 PHKDLVNVEFIE 145
                 NV+F++
Sbjct: 180 ------NVQFVQ 185

>NDAI0G05400 Chr7 complement(1323284..1324756) [1473 bp, 490 aa]
           {ON} Anc_1.260
          Length = 490

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 6/96 (6%)

Query: 100 IMKLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISL 159
           + KLF D+ +T+  L    +EKY   L+        +D ++ EF   + AL + ++   L
Sbjct: 309 LFKLFRDDKETLIKLMKDILEKYAPTLVALQTGMIKEDYISEEFYFQRVALDL-ESLTEL 367

Query: 160 YDINTMIELRNVANVQDIVDSDFKSLDGKLYQFNQK 195
           Y    M+  R    ++ + D +F SL G    FN+K
Sbjct: 368 YTCTPMMIWRRTGEIRFVSD-EFSSLTG----FNKK 398

>KLLA0B10736g Chr2 (941796..943373) [1578 bp, 525 aa] {ON} similar
           to uniprot|Q06214 Saccharomyces cerevisiae YPR169W JIP5
           Nucleolar protein of unknown function exhibits a
           physical interaction with Bre1p
          Length = 525

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 201 IWEISSMTIVNIIT-IPFINDVEKDVVSFTVVDDNCVVMAV-NSTIYALNLHLSSVISMS 258
           +W+     +V+ +T IP   +   D V  +  DDNCV     N  +Y +N+ L  VI + 
Sbjct: 299 VWKPKKNDLVDQVTRIPICKNESVDCVISSFQDDNCVYCGCSNGNVYKVNVKLGKVIEIR 358

Query: 259 ELLNLKWFKLID 270
           +  ++     ID
Sbjct: 359 KHSSIDEVSFID 370

>CAGL0B01331g Chr2 (119648..120268) [621 bp, 206 aa] {ON} highly
           similar to uniprot|Q12517 Saccharomyces cerevisiae
           YOL149w DCP1 mRNA decapping enzyme
          Length = 206

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 15/124 (12%)

Query: 118 TIEKYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISLYDINTMIELRNVANVQDI 177
            I +YD  + +  + TPH  +   +    ++A L  Q  +++Y       LR++ N QD 
Sbjct: 25  VIGRYDPKIKQLLFHTPHASVYKWDIERDEWAKLEYQGVLAIY-------LRDIGNGQDF 77

Query: 178 V---DS--DFKSLDGKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVD 232
           +   DS  D   L G + Q N+   +  +  +S   I N   I  +N +  D  S  +V 
Sbjct: 78  LPPQDSTMDASVLAGSMTQGNENYGQGLM--LSGRDIYNYGLI-ILNRLNPDNFSMGIVP 134

Query: 233 DNCV 236
           +N V
Sbjct: 135 NNVV 138

>CAGL0I07381g Chr9 (713018..714037) [1020 bp, 339 aa] {ON} similar
           to uniprot|Q12239 Saccharomyces cerevisiae YOL107w
          Length = 339

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 25/35 (71%), Gaps = 1/35 (2%)

Query: 253 SVISMSELLNLKWFKLIDNLSNQFVLGLSFNNENY 287
           + I +S L+++KW+K+I NL N  VLG SF  +N+
Sbjct: 76  TAIILSNLIDIKWWKIITNLLN-LVLGGSFIEKNW 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,251,090
Number of extensions: 2927948
Number of successful extensions: 12434
Number of sequences better than 10.0: 101
Number of HSP's gapped: 12822
Number of HSP's successfully gapped: 109
Length of query: 609
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 494
Effective length of database: 40,294,809
Effective search space: 19905635646
Effective search space used: 19905635646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)