Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019303.487ON31331316700.0
NDAI0G009703.487ON3323328301e-110
NCAS0E008403.487ON3363178141e-107
CAGL0I10582g3.487ON3193217611e-100
YGR127W3.487ON3123227452e-97
Skud_7.4383.487ON3133237364e-96
Smik_6.2233.487ON3133237348e-96
Suva_7.4153.487ON3133237348e-96
KNAG0B008403.487ON3133227027e-91
SAKL0F02882g3.487ON2983126633e-85
TDEL0D055503.487ON3103186443e-82
Kpol_1017.93.487ON3103206219e-79
KLLA0E04687g3.487ON3063196122e-77
Kwal_55.212173.487ON3033075662e-70
TPHA0D032603.487ON3143195592e-69
Ecym_12423.487ON3113225574e-69
KLTH0F14718g3.487ON3003135425e-67
ZYRO0D10098g3.487ON2762784962e-60
AFR305W3.487ON3093084931e-59
TBLA0D029903.487ON3183314435e-52
Skud_2.2918.518ON58034693.9
ZYRO0G16874g5.308ON577111684.8
YGL203C (KEX1)3.512ON729106678.0
Smik_2.3048.518ON58762669.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01930
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   647   0.0  
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   324   e-110
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   318   e-107
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   297   e-100
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   291   2e-97
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   288   4e-96
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   287   8e-96
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   287   8e-96
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   275   7e-91
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   259   3e-85
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   252   3e-82
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   243   9e-79
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   240   2e-77
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   222   2e-70
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   219   2e-69
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   219   4e-69
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   213   5e-67
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   195   2e-60
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   194   1e-59
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   175   5e-52
Skud_2.291 Chr2 (533122..534864) [1743 bp, 580 aa] {ON} YBR163W ...    31   3.9  
ZYRO0G16874g Chr7 complement(1386649..1388382) [1734 bp, 577 aa]...    31   4.8  
YGL203C Chr7 complement(112475..114664) [2190 bp, 729 aa] {ON}  ...    30   8.0  
Smik_2.304 Chr2 (551840..553603) [1764 bp, 587 aa] {ON} YBR163W ...    30   9.3  

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
           LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK 180
           SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK 180

Query: 181 PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAETI 240
           PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAETI
Sbjct: 181 PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAETI 240

Query: 241 YVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSGL 300
           YVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSGL
Sbjct: 241 YVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSGL 300

Query: 301 NPKEVQRLDFTIT 313
           NPKEVQRLDFTIT
Sbjct: 301 NPKEVQRLDFTIT 313

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  324 bits (830), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 225/332 (67%), Gaps = 22/332 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNK-IFGT 59
           MCIL AT +H +YELILISNRDE+L RKTH +CWHND+FILSPYDM++E  + +K +FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 60  WLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKF 119
           WLG+NK GKIAT+LNL+   S+ LK+LV P+SRG++PF +L SD T EDSF EW+ ++ F
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYL-SDMT-EDSFAEWDGYDNF 118

Query: 120 KSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLY-------- 171
             KYP LQS+GDFN FYGD+K   YRI+DS+GNT   L++N + +++SND++        
Sbjct: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178

Query: 172 -QHKDEYEGKP--------TWGKIKIGAERLNKFLKET--ERSNEDEVLAKCFELASYCS 220
            Q   + EGK         TWGK+K+G   L   + ++  E+ +ED ++++CF+L+S CS
Sbjct: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238

Query: 221 IDSSITREENPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHV 280
           +      + + N  L  ETI VPPL+    +D+G +   G+YYGTR+QIV+L+ +    V
Sbjct: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298

Query: 281 TLVEHTIHNSDEEIYKYSGLNPKEVQRLDFTI 312
              EH I+ SD +I  +S  NPKE  R DFT+
Sbjct: 299 KFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 217/317 (68%), Gaps = 11/317 (3%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSRE-ENHGNKIFGT 59
           MCIL AT +H +YELILISNRDE+  RKTH +CWHND+FILSP+DM++  E H  KIFGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 60  WLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKF 119
           W+G+N+  KIATILNL+  S +DLK+LVKP+SRG+IPF FL     ++  F +W+T+EKF
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSE---HDSDFNKWDTYEKF 133

Query: 120 KSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQ------H 173
             KY +L+ +GDFNFFYGD     YRIIDS GNTFKVL + +  + +SND++        
Sbjct: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL-SGDPYLTVSNDMFATGGITVE 192

Query: 174 KDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNK 233
           +        W KIK G   L   ++E++  +ED ++ KCF+LAS CS+      + N N 
Sbjct: 193 RASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNS 252

Query: 234 ELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEE 293
            L  ETI+VPPL+   ++DIG + + GKYYGTR+QIV+L+ K+ + V LVEH ++ SD +
Sbjct: 253 TLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDND 312

Query: 294 IYKYSGLNPKEVQRLDF 310
           I  YS  NPKEV+  +F
Sbjct: 313 IQHYSSTNPKEVKSFEF 329

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  297 bits (761), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 208/321 (64%), Gaps = 12/321 (3%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSR-EENHGNKIFGT 59
           MCILFATR H +YELI+ISNRDE+L RKTH TCWHND+FILSPYD++R      N  FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 60  WLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKF 119
           W G+N+KG++AT+LNLR    +D+K ++  RSRG +PF FL     N   FE+W+T+ KF
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGN---FEDWDTYAKF 117

Query: 120 KSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-MIISNDLY-----QH 173
              YP ++ +GDFN FYGD KEG Y +IDSLGNT  +     +  ++ISN+++     Q 
Sbjct: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177

Query: 174 KDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNK 233
           +D   G   WGKIK G + + +F+K      +++V+  CF+LAS   I   IT E +  K
Sbjct: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237

Query: 234 ELAA--ETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSD 291
            L    ETIYV PL   P E+IG   T G+YYGTR+QIV+LV K +   T +E  I++SD
Sbjct: 238 SLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSD 297

Query: 292 EEIYKYSGLNPKEVQRLDFTI 312
           ++I  YS  NPKE  R ++ I
Sbjct: 298 QDISLYSTSNPKEELRYEYDI 318

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  291 bits (745), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 215/322 (66%), Gaps = 20/322 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL ATR+H +YELILISNRDE+L RKTH TCWHN++FILSPYD+++      +IFGTW
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAE-KQIFGTW 59

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
            G+NK+GK+ATILNL+  +    +   K RSRGL+PF FL     ++  FE+W+ ++KF+
Sbjct: 60  SGINKEGKLATILNLKLDNE---QNNTKSRSRGLLPFIFLS---IHKADFEDWDNYKKFE 113

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-----MIISNDLYQHKD 175
             Y  L+S+GDFNFFYGD+ +  Y++IDSLG TF VL +  R      M++SN  +    
Sbjct: 114 GHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSS 173

Query: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREE-----N 230
              G+  W K+K+  + L   + E   S+E+++++ CF+LAS  S+ S+I+  +     +
Sbjct: 174 SIPGQ-AWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232

Query: 231 PNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNS 290
           PN  +   TIYVPPL+  P +D+G +  +G YYGTR+QIV+LV KD   VT +E  +++S
Sbjct: 233 PN--VTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSS 290

Query: 291 DEEIYKYSGLNPKEVQRLDFTI 312
           DE++ KYS  +PKE +R  F +
Sbjct: 291 DEDVRKYSVTSPKEEKRFKFKL 312

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  288 bits (736), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 213/323 (65%), Gaps = 21/323 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL ATR+H +YELILISNRDE+L RKTH TCWHND+FILSPYD+++      +IFGTW
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKE-KQIFGTW 59

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
            G+N++GK+ATILNL+       ++ +K +SRGL+PFTFL    T++  F+ W+ ++KF+
Sbjct: 60  SGINREGKLATILNLKLDGQ---RDTIKSKSRGLLPFTFLS---THKADFQNWDNYDKFE 113

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLD-----NNNRNMIISNDLYQHKD 175
             Y  L ++GDFNFFYGD+ E  Y++IDSLG TF VLD     N N  M +SN  + +  
Sbjct: 114 MNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSP 173

Query: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITRE------E 229
               +  W K+K+  + L K +     S+E+ +++ CF+LAS  S+  + ++        
Sbjct: 174 SISEQ-AWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLA 232

Query: 230 NPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHN 289
           +PN  +   TIYVPPL+  PD+D+G +  +G YYGTR+QIV+LV K+   VT +E  +++
Sbjct: 233 DPN--VIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290

Query: 290 SDEEIYKYSGLNPKEVQRLDFTI 312
           SDE++  YS   PKE +R +F +
Sbjct: 291 SDEDVNHYSVATPKEEKRFEFKL 313

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  287 bits (734), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 216/323 (66%), Gaps = 21/323 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL ATR+H +YELILISNRDE+L RKTH TCWHND+FILSPYD++R    G + FGTW
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQE-FGTW 59

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
            G+NK+GK+ATILNL+  S    +  +K +SRGL+P+ FL +   +E +F++W+++ KF 
Sbjct: 60  SGINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSN---HEANFKDWDSYSKFG 113

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-----MIISNDLYQHKD 175
           + Y  L+++GDFNFFYGD+ E  Y++IDSLG TF VL +  R      M+ISN  + +  
Sbjct: 114 NHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTS 173

Query: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREE------ 229
               K  W K+K+  + L   + +    +E+ +++ CF+LAS  S+  ++++ +      
Sbjct: 174 SIPEK-AWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLV 232

Query: 230 NPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHN 289
           +PN  ++  TIYVPPL+  P +D+G +  +G +YGTR+QIV+L+ KD    T +E  I++
Sbjct: 233 DPNVTMS--TIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYS 290

Query: 290 SDEEIYKYSGLNPKEVQRLDFTI 312
           SDE++ +YS   PKE +R +F +
Sbjct: 291 SDEDVRQYSVSAPKEEKRFEFEL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  287 bits (734), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 148/323 (45%), Positives = 212/323 (65%), Gaps = 21/323 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL ATR+H  YELILISNRDE+L RKTH TCWHND+FILSPYD+++      +IFGTW
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME-KQIFGTW 59

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
            G+NK+GK+ATILNL+     D +   K +SRG++PFTFL S   ++  F++W+ + KF+
Sbjct: 60  SGINKEGKLATILNLKM---DDQRSCTKSKSRGMLPFTFLTS---HKARFQDWDDYNKFE 113

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-----MIISNDLYQHKD 175
             Y  L+++GDFNFFYGD+ E  Y++IDSLG+TF VL +  R      M+ISN  Y H  
Sbjct: 114 KHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKY-HNS 172

Query: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREE------ 229
               +  W K+KI  + L   + +   S+E+ +++ CF+LAS  S+  +  + +      
Sbjct: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232

Query: 230 NPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHN 289
           +PN  +   TIYVPPL+  P +D+G +  +G YYGTR+QIV+LV KD   VT +E  +++
Sbjct: 233 DPN--VTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYS 290

Query: 290 SDEEIYKYSGLNPKEVQRLDFTI 312
           SDE++  YS   PKE +R +F +
Sbjct: 291 SDEDVSHYSASAPKEEKRFEFEL 313

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  275 bits (702), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 211/322 (65%), Gaps = 19/322 (5%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSRE-ENHGNKIFGT 59
           MCIL  TR H +Y+L+LISNRDE+  R TH T WH+ ++ILSPYDM++   + G  + GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 60  WLGMNKKGKIATILNL-------RRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEE 112
           W+G+N+ G+++T+LNL       R+ S    K  VK RSRGLIPF FL    ++    ++
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHS----KNPVKRRSRGLIPFMFL----SDRGFIDQ 112

Query: 113 WETFEKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVL-DNNNRNMIISNDLY 171
           W++FEKF+ +YP L+ SGDFN F GDI++ +Y+++DS GNTF VL +    NM++SND Y
Sbjct: 113 WDSFEKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTY 172

Query: 172 QHKDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENP 231
           +  +E +    W K+K+G  +L++ +      ++   + KCF  AS+CSI+ S   + + 
Sbjct: 173 KEFNEND-ISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKS-HEDISK 230

Query: 232 NKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSD 291
             E+ + TI+VPPLK  P +D+GLTK+ G Y+GTR+Q+V LV KDR+ VT+ E  +H SD
Sbjct: 231 TPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSD 290

Query: 292 EEIYKYSGLNPKEVQRLDFTIT 313
            +    S  NPKEV++  F ++
Sbjct: 291 LDRDFNSPHNPKEVKQFTFDLS 312

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  259 bits (663), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 190/312 (60%), Gaps = 14/312 (4%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL  T +H  Y LILISNRDE+  R+TH TC H+D+FI+SP+DMS      N  FGTW
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN--FGTW 58

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
            G+NK GK+A ILNLR  S  + K +  P+SRG++P  FL      +  F  W+++EKF 
Sbjct: 59  CGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAG---KDVDFNNWDSYEKFS 115

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK 180
             YP ++ +G+FN FYGD  +G Y++I SL  T     N++  M++SNDL   K +    
Sbjct: 116 HHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKK---- 171

Query: 181 PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAETI 240
             WGKI +    L   ++ +    +D +L KCF+LAS+ +    I  +   ++ +  ETI
Sbjct: 172 --WGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVK---HESVTNETI 226

Query: 241 YVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSGL 300
           YVPPL V   +D+ ++   GKYYGTR+QIV+LV KD+K +T VE  ++  DE++ KY   
Sbjct: 227 YVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPK 286

Query: 301 NPKEVQRLDFTI 312
           NPKE    +F I
Sbjct: 287 NPKEQIEFEFDI 298

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  252 bits (644), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 198/318 (62%), Gaps = 16/318 (5%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL AT  H +Y+L+L+SNRDEY  RK     W  DNF+L P D   + +   +  GTW
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSS--GEDLGTW 58

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
           +G N+ GKI T+LNL+ FS    +  V P SRG IP +FL S   N   F++W+T++KF 
Sbjct: 59  IGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN---FKDWDTYDKFC 115

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNN-RNMIISNDLYQHKDEYEG 179
            ++  L+ + DFNFFYGD   G+YR+IDSLGNT KVL   N + +++SND++Q   E   
Sbjct: 116 HQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQ--GESNK 173

Query: 180 KPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPN-----KE 234
              W KI +  + L+  ++E   ++ED+ + +CF +AS   I+   ++ ++ N      E
Sbjct: 174 NRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIAS---INPFHSKHDHGNYYMKAVE 230

Query: 235 LAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEI 294
           L+ +T++VPPLK   D+ +G +   G+YYGTR+Q V+LV KDR H+T VE  IH+SD + 
Sbjct: 231 LSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDA 290

Query: 295 YKYSGLNPKEVQRLDFTI 312
            +YS  + KE +R DF +
Sbjct: 291 LQYSRDHYKEQKRYDFDL 308

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  243 bits (621), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 205/320 (64%), Gaps = 18/320 (5%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNF--ILSPYDMSRE-ENHGNKIF 57
           MCIL A+R H  Y+LILISNRDE+L R+THETCW+   +  IL PYDMS+  E + NKI 
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59

Query: 58  GTWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFE 117
           GTW G+N+ G+++TILNL+   S         +SRG +P  FL  D    DS   W+++E
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFL--DNKETDSLLNWDSYE 117

Query: 118 KFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEY 177
           KF  +YPF++ +GDFNFFYGD++ G Y +IDS+G+T +VL  +N  ++ISND +   +  
Sbjct: 118 KFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSN-- 175

Query: 178 EGKPT--WGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKEL 235
            GK T  W KI + A+ L K L   E   ED+++ KCF++AS  +++  + ++ +  +EL
Sbjct: 176 -GKSTKEWEKITL-AKNLLKHLPLCE--TEDDLIHKCFDIASTNTLNEDLIKDVDV-REL 230

Query: 236 AAETIYVPPLKVCPDED---IGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDE 292
             ETI VPPL V   E+   IG +   G+YYGTR+QIV+LV+K+R  V  +E  ++NSD+
Sbjct: 231 MTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDD 290

Query: 293 EIYKYSGLNPKEVQRLDFTI 312
           ++      +P +    +FTI
Sbjct: 291 DVTTQKLSSPIQDLTYNFTI 310

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  240 bits (612), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 198/319 (62%), Gaps = 22/319 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCILFATR+H +Y+LIL+SNRDE+  RKTH TCW++D FILSPYDM+ E+    + +GTW
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKK--GQGYGTW 58

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELV---KPRSRGLIPFTFLYSDWTNEDSFEEWETFE 117
           LG+N++G+IA ILNL+  S +D + ++   +PRSRG++P  FL  +  +   F+ W+++E
Sbjct: 59  LGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQE--DNAPFDNWDSWE 116

Query: 118 KFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSL---GNTFKVLDNNNRNMIISNDLYQHK 174
           KF  ++  L+ +G F  FYGD K   Y +ID L    N F+ ++    +M+ISND++ H 
Sbjct: 117 KFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME----HMVISNDIF-HC 171

Query: 175 DEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKE 234
              E    W K + G   L+   K T    ++E+L KCFEL S  + +     E      
Sbjct: 172 AVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFN-----EGEDVDS 226

Query: 235 LAAETIYVPPLKVCPDED-IGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEE 293
           +   +IYVPPL++    D IG +   G YYGTR+QIV+LV KD + VT  EH I+ SDE+
Sbjct: 227 VTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNR-VTYEEHVIYESDED 285

Query: 294 IYKYSGLNPKEVQRLDFTI 312
              YS ++PKEV +  F +
Sbjct: 286 CETYSFMDPKEVIQFQFNM 304

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  222 bits (566), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 188/307 (61%), Gaps = 20/307 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL A+ +H  Y LILISNRDE++ R+T  TC ++D++++SP DM+ ++N+   + GTW
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNL-GTW 59

Query: 61  LGMNKKGKIATILNLRRFSS--IDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEK 118
            G N+ G+IA ILNLR  ++     K +V   SRG +   +L    T++    +W ++ K
Sbjct: 60  CGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYL----TDKQPASDWNSYAK 112

Query: 119 FKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYE 178
           F SK P ++S  +FN FYGD K G+Y  IDS G++F+VL + N  ++ISND        E
Sbjct: 113 FASKCPDIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND------SIE 165

Query: 179 GKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAE 238
               W KI++  + +   ++++   +ED++LA+CF LAS+         +    +++ + 
Sbjct: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH---KQDYNVDHMDKEKVTSS 222

Query: 239 TIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYS 298
            I+VPPL+V   ED+G +   G++YGTR+QIVVLV K+ K +  VEH +++SD E   + 
Sbjct: 223 NIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFC 282

Query: 299 GLNPKEV 305
             NPK+ 
Sbjct: 283 AANPKKC 289

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  219 bits (559), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 199/319 (62%), Gaps = 19/319 (5%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWH--NDNFILSPYDMSREENHGNKIFG 58
           MCILF TRSH +YELILISNRDE+L RKT  +CW+  ++  +L PYD+SR E   +K FG
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSK-FG 59

Query: 59  TWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEK 118
           TW G+N+ G+++++LNL+   +    + V+ +SRG +P  FL  D   E+SF +W ++ K
Sbjct: 60  TWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFL--DNRKENSFNDWNSYSK 117

Query: 119 FKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN----MIISNDLYQHK 174
           F  +YP L+ +G FN F GD+K+  Y +IDS G T ++LD  + N    ++ISN  +   
Sbjct: 118 FLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISN 177

Query: 175 DEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKE 234
           D    K  W KI  G + +++FL +  R +E+ V+  CF++AS   + +      +   +
Sbjct: 178 D----KERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILD 232

Query: 235 LAAETIYVPPLKV---CPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSD 291
           L  ET++VPP+K+      ++IG +   GK+YGTR+QIV+LV+K+R  V  +E  ++  D
Sbjct: 233 LMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECD 292

Query: 292 EEIYKYSGLNPKEVQRLDF 310
           +++ K +G+  K +  L+F
Sbjct: 293 DDVSK-AGIE-KPINELNF 309

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  219 bits (557), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 183/322 (56%), Gaps = 22/322 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNK----- 55
           MCIL AT  H +Y+LILISNRDE+  R+TH TCWH D  IL+PYD+S  EN  +      
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 56  IFGTWLGMNKKGKIATILNLRRFSSIDLKELVKP-----RSRGLIPFTFLYSDWTNEDSF 110
            +GTWLG+N+ G ++ +LNL+  S     E V P     +SRG +   FL  D +N + +
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVS-----EAVNPGAGNRKSRGNVTVAFL-RDLSNGN-W 113

Query: 111 EEWETFEKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDL 170
           ++W  +EKF   +  L  +  F  FYGDIK G++ +IDS   +     +    ++ISN  
Sbjct: 114 DKWNNYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSR 173

Query: 171 YQHKDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREEN 230
              +DE    P W K+  G + L + +K     +++ +L KCFELA     D +   +  
Sbjct: 174 VNCEDE---GPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVT 230

Query: 231 PNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNS 290
            +  L  +TI+VP LK   +  +G++K  G+YYGTRT IV+LV  +  HVT+ EH IH+S
Sbjct: 231 -DTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILV-DNFNHVTMHEHVIHDS 288

Query: 291 DEEIYKYSGLNPKEVQRLDFTI 312
           D++I   S +NPK     +F I
Sbjct: 289 DKDIGLSSAMNPKTKVAYEFDI 310

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  213 bits (542), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 182/313 (58%), Gaps = 19/313 (6%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60
           MCIL A+ +H +Y LI ISNRDE+  RKT  TC ++D++ILSP D +   N+     GTW
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNN-KPALGTW 59

Query: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120
            G+N+KG++A ILNLR         +  P SRG +P  +L     + D    W +FEKF 
Sbjct: 60  CGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTD----WNSFEKFV 115

Query: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK 180
           SKYP + +  +FN FYGD   G Y  IDSLG + + L  N  N+++SND   H D     
Sbjct: 116 SKYPQI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSND---HID---SS 168

Query: 181 PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKE-LAAET 239
             W K++     L + ++ ++  +E+E++ KCF LAS    ++     +N +KE     +
Sbjct: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS----NTEPAEIDNSDKEEFTCSS 224

Query: 240 IYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSG 299
           I++PP+++    D+G +   G++YGTR+QIV+LV +  + ++  E  +H+SD E+  +S 
Sbjct: 225 IFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSE 284

Query: 300 LNPKEVQRLDFTI 312
            +PKE  +L F +
Sbjct: 285 KHPKE--KLQFNL 295

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  195 bits (496), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 161/278 (57%), Gaps = 19/278 (6%)

Query: 43  PYDMSREENHGNKIFGTWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYS 102
           P  +     H    FGTW G+NK G++ T+LNL+          +   SRG +P  FL  
Sbjct: 9   PLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQ 68

Query: 103 ---DWTNEDSFEEWETFEKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDN 159
              DW      E+W ++ KF +++  L ++GDFNFFYGD K G Y+IIDSL  T  VL N
Sbjct: 69  HDLDW------EQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTN 122

Query: 160 NNRN-----MIISNDLYQHKDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFE 214
           N        M++SND+Y+    Y+G+ TW K+++  + L K +++    ++D  ++KCF+
Sbjct: 123 NESQDDSSYMVVSNDVYR----YQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQ 178

Query: 215 LASYCSIDSSITREENPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVH 274
           +AS        + E   + ++  ++I+VPPLK  PD ++G T T+  +YGTR+QIV+LV 
Sbjct: 179 VASTSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLG-TTTHAGFYGTRSQIVLLVS 237

Query: 275 KDRKHVTLVEHTIHNSDEEIYKYSGLNPKEVQRLDFTI 312
           KDR+ VT VE  +HNSDE++ + S  +P E  +  F +
Sbjct: 238 KDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  194 bits (493), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 178/308 (57%), Gaps = 14/308 (4%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREE----NHGNKI 56
           MCILFAT +H +Y+L+LISNRDEY  RKTH TCW +++ IL+PYDM+ ++    +HG+  
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  FGTWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETF 116
            GTW+G+N+ G ++ +LNL    +          SRG +   +L  D+ + ++++ W T+
Sbjct: 61  -GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYL-KDF-DHNNWDSWNTY 117

Query: 117 EKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDE 176
           EKF + +P L  +  F  FYGD+    + +I+SLG T     + +   ++SN      D 
Sbjct: 118 EKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGP---SDG 173

Query: 177 YEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELA 236
            +    W K+  G +   K ++E+   +E+E+L +CF LASY    S+     + +  + 
Sbjct: 174 AKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVH-DDSIP 232

Query: 237 AETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYK 296
             TI+VP L     +   L+   G YYGTR+ IV+LV +D   VT  EH IH+SD+++  
Sbjct: 233 KRTIFVPALYNLSGQ-ANLSFAAGMYYGTRSTIVMLVSEDGNVVTR-EHVIHDSDQDLDS 290

Query: 297 YSGLNPKE 304
           YS LNPKE
Sbjct: 291 YSILNPKE 298

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  175 bits (443), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 175/331 (52%), Gaps = 60/331 (18%)

Query: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENH---GNKIF 57
           MCIL  T +H  Y+LILISNRDE   R+TH TCW++++ IL PYDMS++  H   G++ F
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 58  ----GTWLGMNKKGKIATILNLRRFSSIDLKELVKPR---------SRGLIPFTFLYSDW 104
               GTW G+NK GKI T+LNL       LKE    R         SRGLIP  +L  D+
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNL-------LKEEEARRDGDCNNSLQSRGLIPIKYL-CDF 112

Query: 105 TNEDSFEEWETFEKFKSKYPFLQSS-GDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN 163
             +  F++W T++KF  +   +    G FN F GD+K   Y II+S+G + +VLD  N  
Sbjct: 113 --DHGFQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPY 170

Query: 164 MIISNDLYQHKDEYEGKPT----WGKIKIGAERLNKFLKET-ERSNED--EVLAKCFELA 216
           M++SN  +       G P     W KIK G + L   + +  + SN+D  E+L  CF+++
Sbjct: 171 MVVSNINW-------GDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQIS 223

Query: 217 SYCS-----IDSSITREENPNKELAAETIYVPPLKVCPDE---------DIGLTKTNGKY 262
           S  +     ID +I R E        + I+VPPLK    E                + KY
Sbjct: 224 STINLSGKKIDGNIERLEQ-----TKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKY 278

Query: 263 YGTRTQIVVLVHKDRKHVTLVEHTIHNSDEE 293
           YGTR+QIVVL  +    VT VE  +H  +E+
Sbjct: 279 YGTRSQIVVLCERKSNKVTFVERILHCKNED 309

>Skud_2.291 Chr2 (533122..534864) [1743 bp, 580 aa] {ON} YBR163W
           (REAL)
          Length = 580

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 31  ETCWHNDNF--ILSPYDMSREENHGNKIFGTWLG 62
           E  +HNDNF  I+ PYD  + ENH +     W G
Sbjct: 495 EYYYHNDNFHNIIFPYDPVKLENHAHNSAMVWFG 528

>ZYRO0G16874g Chr7 complement(1386649..1388382) [1734 bp, 577 aa]
           {ON} highly similar to uniprot|P07275 Saccharomyces
           cerevisiae YHR037W PUT2 delta-1-pyrroline-5-carboxylate
           dehydrogenase
          Length = 577

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 9/111 (8%)

Query: 191 ERLNKFLKETERSNEDEVL-AKCFELASYCSIDSSITREENPNKELAAETIYVPPLKVC- 248
           ++L KF++E ++  E E++    ++ +    +  +I +  NPN +  +   + P L VC 
Sbjct: 411 DKLAKFIEEAKKDPELEIIQGGQYDKSKGWFVTPTIVKTTNPNHKFMSTEFFGPILTVCD 470

Query: 249 -PDED---IGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIY 295
            PD +   I  T  N   YG    I     KDR+ +      +  S    Y
Sbjct: 471 YPDAEFSQICETIDNTSTYGLTGSIFA---KDREAIVEASEKLRYSAGNFY 518

>YGL203C Chr7 complement(112475..114664) [2190 bp, 729 aa] {ON}
           KEX1Protease involved in the processing of killer toxin
           and alpha factor precursor; cleaves Lys and Arg residues
           from the C-terminus of peptides and proteins
          Length = 729

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 64  NKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFKSKY 123
           N KG + TI NL+          +K  S   + F +++   + +DS EE+  + K+    
Sbjct: 409 NNKGVLDTIDNLKWGG-------IKGFSDDAVSFDWIHKSKSTDDS-EEFSGYVKYDRNL 460

Query: 124 PFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISND 169
            F+      +    D    +  I+D   N   ++DNN +N++I+ D
Sbjct: 461 TFVSVYNASHMVPFDKSLVSRGIVDIYSNDVMIIDNNGKNVMITTD 506

>Smik_2.304 Chr2 (551840..553603) [1764 bp, 587 aa] {ON} YBR163W
           (REAL)
          Length = 587

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query: 5   FATRSHKEYELI--LISNRDEYLGRKTHETCWHNDNF--ILSPYDMSREENHGNKIFGTW 60
           FA R  + Y ++  L+SN D  +     E  +HNDNF  IL PYD  + E H +     W
Sbjct: 478 FAARLSQIYYIVGKLVSN-DLMI-----EYYYHNDNFHNILFPYDSLKLETHAHDSAMVW 531

Query: 61  LG 62
            G
Sbjct: 532 FG 533

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,107,226
Number of extensions: 1947254
Number of successful extensions: 5758
Number of sequences better than 10.0: 44
Number of HSP's gapped: 5888
Number of HSP's successfully gapped: 44
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)