Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019203.486ON22322310931e-153
CAGL0I10604g3.486ON2112283658e-43
NCAS0E008503.486ON2302373493e-40
KNAG0B008503.486ON2252313381e-38
YGR126W3.486ON2301513277e-37
Smik_6.2223.486ON2301523242e-36
Skud_7.4373.486ON2302223191e-35
Suva_7.4143.486ON2302223069e-34
NDAI0G009803.486ON2342222808e-30
KLTH0F14696g3.486ON2191572692e-28
TDEL0D055403.486ON2162382622e-27
SAKL0F02904g3.486ON2221552457e-25
Kwal_55.212153.486ON1421462266e-23
TPHA0D032503.486ON2192342082e-19
KLLA0E04709g3.486ON1661301963e-18
Kpol_1017.103.486ON2341591232e-07
KAFR0C020303.503ON62457985e-04
YPR156C (TPO3)3.503ON62257940.001
Smik_16.4083.503ON62257940.002
Skud_16.4503.503ON62257930.002
Suva_16.4843.503ON62257910.004
TPHA0D033103.503ON61357900.005
TBLA0D029003.503ON691196870.014
TDEL0D057103.503ON61658830.042
KNAG0B007303.503ON62259800.090
NCAS0E007503.503ON62058790.12
Kpol_1017.33.503ON62157790.12
CAGL0I10384g3.503ON63059780.16
Kwal_47.189193.503ON64055770.25
Ecym_70828.589ON573114770.25
ZYRO0F10978g8.615ON483105760.29
NDAI0I027703.503ON62659750.42
KLTH0G02266g3.503ON64455720.87
NCAS0F036203.503ON63458701.5
Kwal_27.10370singletonOFF7856632.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01920
         (223 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   425   e-153
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   145   8e-43
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   139   3e-40
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   134   1e-38
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   130   7e-37
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   129   2e-36
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   127   1e-35
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   122   9e-34
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   112   8e-30
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   108   2e-28
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   105   2e-27
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...    99   7e-25
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...    92   6e-23
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    85   2e-19
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    80   3e-18
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    52   2e-07
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    42   5e-04
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    41   0.001
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    41   0.002
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    40   0.002
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    40   0.004
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    39   0.005
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    38   0.014
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    37   0.042
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    35   0.090
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               35   0.12 
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    35   0.12 
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    35   0.16 
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    34   0.25 
Ecym_7082 Chr7 (162495..164216) [1722 bp, 573 aa] {ON} similar t...    34   0.25 
ZYRO0F10978g Chr6 complement(895804..897255) [1452 bp, 483 aa] {...    34   0.29 
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     33   0.42 
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    32   0.87 
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    32   1.5  
Kwal_27.10370 s27 (308739..308975) [237 bp, 78 aa] {OFF} [contig...    29   2.5  

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  425 bits (1093), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/223 (94%), Positives = 210/223 (94%)

Query: 1   MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD 60
           MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD
Sbjct: 1   MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD 60

Query: 61  PLKQVQTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGL 120
           PLKQVQTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGL
Sbjct: 61  PLKQVQTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGL 120

Query: 121 DLTKRAVPDINSPISHESKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILGNDN 180
           DLTKRAVPDINSPISHESKLIDESKFETDTGLIKTKTLETL             ILGNDN
Sbjct: 121 DLTKRAVPDINSPISHESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKILGNDN 180

Query: 181 SNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
           SNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD
Sbjct: 181 SNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  145 bits (365), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 131/228 (57%), Gaps = 39/228 (17%)

Query: 6   DVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQV 65
           +VEDISSFSS++SYKPEPF G          LE   N                 + L + 
Sbjct: 13  EVEDISSFSSVDSYKPEPFTG----------LEHTKN-----------------ENLSRK 45

Query: 66  QTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKR 125
            TN S  ++   + TS+ S   LKK  S  IE++VTQNA+ G +ET++SL+A GLD+ ++
Sbjct: 46  ATNASQGTYMDDA-TSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRK 104

Query: 126 AVPDINSPI--SHESKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXX--------XXI 175
           A+PD N+P+  +  ++  +E + ETDTGL+K KTLETL                      
Sbjct: 105 AIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDKSISK 164

Query: 176 LGNDNSNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
             ++ S  S +  +++NM VERN+K++ KYQ+HK EKG+KGFF+++FD
Sbjct: 165 SQSNKSEVSDI-AQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  139 bits (349), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 126/237 (53%), Gaps = 30/237 (12%)

Query: 2   SIEQDVEDISSFSSIESYKPEPFVG--QGIARENTDELEFQSNLKDAQSHTSEKFQEEQV 59
           S E D ED+SSFSSI+SY+PEPF G  +  A + TD        KD  S    +      
Sbjct: 9   STEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDR-------KDTLSGDETE------ 55

Query: 60  DPLKQVQTNDSFWSFRSVSN-TSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRAT 118
             LKQ  TN +  S  +    TSRTS   L++  S  IER++T NA  G  ET+ SL A 
Sbjct: 56  --LKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAK 113

Query: 119 GLDLTKRAVPDINSPISHESKLI---DESKFETDTGLIKTKTLETLXXXXXXXXXX---- 171
           GLDL K+A  DIN+P++     +   +E   ET+TGL+K KT+ETL              
Sbjct: 114 GLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRRGD 173

Query: 172 -----XXXILGNDNSNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
                     G    +   L  E++N+ VE+N+K+LEK ++HK +KGLKGF  ++FD
Sbjct: 174 DVVSHKSQATGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  134 bits (338), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 130/231 (56%), Gaps = 32/231 (13%)

Query: 6   DVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQV 65
           + +++SSFSS++SYKPEPFVG G   E  D   F    K+     SE   E   +    +
Sbjct: 12  EFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLF----KNDTILNSEDLAENTANTPSDL 67

Query: 66  QTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKR 125
                          S+ SS  L K+ S  IER+VT+NAM  ++E+ D+LR+ GLD TKR
Sbjct: 68  N--------------SKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKR 113

Query: 126 A-VPDINSPIS-HESKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILG----ND 179
             +PDIN+P++  +S   +E + ET+TGL+K KT+E+L               G    + 
Sbjct: 114 RNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSK 173

Query: 180 NSNTS--------GLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIF 222
           NS TS        GL+ E++N  VERNRK+LE+Y++++ +KG+KGF  K+F
Sbjct: 174 NSLTSSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  130 bits (327), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 97/151 (64%), Gaps = 15/151 (9%)

Query: 88  LKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPI---SHESKLIDES 144
           LK+  S  IE++VT NA+ G +ETVDSL+  GL+L K+A+PDI +P+   +H++   +E 
Sbjct: 80  LKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEY 139

Query: 145 KFETDTGLIKTKTLETLXXXXXXXXXXXXXILGND------------NSNTSGLDPERMN 192
           + ET+TGL+K KTLE+L              + +             NS  S L+P ++N
Sbjct: 140 RLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLN 199

Query: 193 MVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
           M VE+N+K++EKYQ+HK EKG+KGFF++IFD
Sbjct: 200 MAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  129 bits (324), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 98/152 (64%), Gaps = 17/152 (11%)

Query: 88  LKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPI---SHESKLIDES 144
           LK+  S  IE++VTQNA+ G +ET+DSL+  GL+L K+A+PDI +P+   +H++   +E 
Sbjct: 80  LKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEY 139

Query: 145 KFETDTGLIKTKTLETLXXXXXXXXXXXXXILGND-------------NSNTSGLDPERM 191
           + ET+TGL+K KTLETL                ND             NS  S L+P ++
Sbjct: 140 RLETETGLVKLKTLETLRREDSRVSSTKKE-HNNDHTDIHSTRSKVTTNSQGSSLEPNKL 198

Query: 192 NMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
           NM VE+N+KK+E+YQ+HK EKG+KGFF++IFD
Sbjct: 199 NMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  127 bits (319), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 118/222 (53%), Gaps = 34/222 (15%)

Query: 19  YKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQTNDSF-WSFRSV 77
           YKPEPF G                 KD+Q+      + + +    Q +  ++     R  
Sbjct: 26  YKPEPFTG----------------FKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 69

Query: 78  SNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPI--- 134
              S  SS  LK+  S  IE+++T NA+ G +ET DSL+  GL+L K+A+PDI +P+   
Sbjct: 70  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 129

Query: 135 SHESKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILGNDNSNT----------- 183
           +H     +E + ET+TGL+K KTLETL                ND+++            
Sbjct: 130 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT-NDHADAHSTRSKVTTYS 188

Query: 184 --SGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
             S L+ +++NM VE+N+KK+E+Y++HK EKG+KGFF++IFD
Sbjct: 189 QGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  122 bits (306), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 120/222 (54%), Gaps = 34/222 (15%)

Query: 19  YKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQTNDSFW-SFRSV 77
           YKPEPF G                 KD+Q+      + + +    Q + +DS     R  
Sbjct: 26  YKPEPFTG----------------FKDSQAPEQPLLKNDTIVGKGQSENDDSVDDQHRHS 69

Query: 78  SNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPI--- 134
              S  SS  LK+  S  IE++VT NA+ G +ETVDSL+  GL+L K+  PDI +P+   
Sbjct: 70  DVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNS 129

Query: 135 SHESKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILGNDNSNT----------- 183
           +H++   +E + ET+TGL+K KTLETL               G+D+++            
Sbjct: 130 AHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKD-HGHDHTDAHSTRSKATAYS 188

Query: 184 --SGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
             S L+ +++N+ VE+N+K++EKYQ+HK EKG+KG F+++FD
Sbjct: 189 QGSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  112 bits (280), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 121/222 (54%), Gaps = 33/222 (14%)

Query: 19  YKPEPFVGQGIARENTDELEFQSN-LKDAQ-SHTSEKFQEEQVDPLKQVQTNDSFWSFRS 76
           Y+PEPF G             + N L +AQ S T+   +++  D +    ++D+    + 
Sbjct: 29  YQPEPFTG------------LKGNELPNAQPSTTATTTEQDHDDTVISSHSHDT----KH 72

Query: 77  VSNTSRTSSKNLKKQRSR--DIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPI 134
               SRTS+  LKK  S   DIE+ +T N M  K ET+DSL   GL+  K++V DIN+P+
Sbjct: 73  GEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPL 132

Query: 135 -SHESKLIDESKFETDTGLIKTKTLETL------XXXXXXXXXXXXXILGNDNSNT---- 183
            +  ++  +E + ET+TGL+K KT+E+L                         +NT    
Sbjct: 133 NAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSR 192

Query: 184 --SGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
             S LDP ++NM VE+N+K+LEKY +HK++KG+KGFF ++FD
Sbjct: 193 ASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  108 bits (269), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 90/157 (57%), Gaps = 17/157 (10%)

Query: 84  SSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISH--ESKLI 141
           S+  L+KQ S  IE+I+T NA  G++ETV+SL+  GL+L K+A+PDIN+P ++       
Sbjct: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFP 122

Query: 142 DESKFETDTGLIKTKTLETL---------------XXXXXXXXXXXXXILGNDNSNTSGL 186
           +E + ETDTGL+K +TL  L                             L + N+  +GL
Sbjct: 123 EEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGL 182

Query: 187 DPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
           D E++   VE+N+KK++KYQ+HK   GL+ F  KIFD
Sbjct: 183 DGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  105 bits (262), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 111/238 (46%), Gaps = 60/238 (25%)

Query: 8   EDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQT 67
           +++SSFSSI+SY+P+PF G                            QEE    L Q + 
Sbjct: 17  DEVSSFSSIDSYQPQPFTG----------------------------QEE----LPQEKN 44

Query: 68  NDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAV 127
            DS     S S T+      L  Q S  IE+ VT NAM G +ET  SL+  GLD  K+A+
Sbjct: 45  PDSSSRRSSKSGTT------LNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAI 98

Query: 128 PDINSPISHE---SKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILGNDNSNTS 184
           PDIN PI+     S+  +E + ET TGL+K KTL  L              +   +S   
Sbjct: 99  PDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPG 158

Query: 185 GLD-------------------PERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223
            +D                    E +   +E+N+ ++EK+++H+ EKGLKGF +++FD
Sbjct: 159 TIDSKIEPKPDTAKAEQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score = 99.0 bits (245), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 90/155 (58%), Gaps = 22/155 (14%)

Query: 84  SSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISH--ESKLI 141
           SS  LKK  S  IE+++T NA+ G  ET++SL+  GLDL K+A+PD N+P  H   S+  
Sbjct: 73  SSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFP 132

Query: 142 DESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILGN--------------DNSNTSGLD 187
           +E + ET+TGL+K KTL++L              LGN              D     G D
Sbjct: 133 EEYQIETETGLVKVKTLQSLNRLDTRVS------LGNKPSTNQNMEAESAHDEQRPVGYD 186

Query: 188 PERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIF 222
            E++   V++N+KK+EKYQ+HK EKG+KGF  ++F
Sbjct: 187 EEKLKKAVDKNKKKIEKYQKHKHEKGIKGFMSRLF 221

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score = 91.7 bits (226), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 80/146 (54%), Gaps = 26/146 (17%)

Query: 100 VTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISH--ESKLIDESKFETDTGLIKTKT 157
           +T NA  G++ETVDSL+  GL++ ++AVPD N+P ++    +  +E + ETDTGL+K +T
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFTNCEFPEEYQLETDTGLVKVQT 60

Query: 158 LETLXXXXXXXXXXXXXILGNDN--------------------SNTSGLDPERMNMVVER 197
           L+ L               GN                      S+ SGLD E++   VE+
Sbjct: 61  LQKLNRLESRTSIRS----GNSQRKSMRSTPSTDHSISPSAGRSSNSGLDAEKLRKAVEK 116

Query: 198 NRKKLEKYQQHKKEKGLKGFFYKIFD 223
           N+++++KYQ+HK   GLK F  KIFD
Sbjct: 117 NKRQIDKYQKHKASGGLKKFLGKIFD 142

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 84.7 bits (208), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 112/234 (47%), Gaps = 45/234 (19%)

Query: 5   QDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQ 64
           ++ +D+SSF+S  SY P+ F+G  + +E++ +++      D  SH S   +E +      
Sbjct: 14  ENFDDVSSFNSDNSYTPQEFIGDTLGKESSTKMD------DRASHLSHAIKETR------ 61

Query: 65  VQTNDSFWSFRSVSNTSRTSSKN-LKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLT 123
                           S TS  N +K   S D+ RIV++N M    E+ ++L+    ++ 
Sbjct: 62  ----------------SGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNME 105

Query: 124 KRAVPDINSPISHE--SKLIDESKFETDTGLIKTKTLE------TLXXXXXXXXXXXXXI 175
            R   DI  P S E  S   +E   ET TGL+  KTLE      T+             +
Sbjct: 106 SRRA-DIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSEL 164

Query: 176 LGNDNSNT------SGLDPERMNMVVERNRKKLEKYQQHKKEKG-LKGFFYKIF 222
             + ++NT       GL+P ++N  VE+N+++LEKYQ HK EK  +K   +K+F
Sbjct: 165 KASKSNNTVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 80.1 bits (196), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 73/130 (56%), Gaps = 3/130 (2%)

Query: 93  SRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISHESKLIDESKFETDTGL 152
           ++++E  V  N   G+ +++DSL+AT LDL+K+A+P  N PI+  ++  +E + ET TGL
Sbjct: 39  TQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEGAEFPEEYEIETRTGL 98

Query: 153 IKTKTLETLXXXXXXXXXXXXXILGNDNSNTSGLDPERMNMVVERNRKKLEKYQQHKKEK 212
           +K  TL  L                 + + + G D +++   +ERN+K+++ Y  HKK  
Sbjct: 99  VKVATLHQLNRLDTRVTTHSSKKSTKEKNTSCGYDNDKLQKCIERNQKEIDSY--HKKS- 155

Query: 213 GLKGFFYKIF 222
           G K F  K+F
Sbjct: 156 GFKKFIGKLF 165

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 71/159 (44%), Gaps = 41/159 (25%)

Query: 6   DVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQV 65
           + EDISSF S  S+ P+ F G                                   L   
Sbjct: 17  NFEDISSFDSQNSFAPQEFKGN----------------------------------LDSN 42

Query: 66  QTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKR 125
             ND+    ++ S TS T++  LK   S +IE+IVT+NA+    ETV +LR T   L+K 
Sbjct: 43  NDNDTGVFNKTKSGTSETNT--LKVNSSNEIEKIVTRNALENNTETVATLRETESKLSK- 99

Query: 126 AVPDIN---SPISHESKLIDESKFETDTGLIKTKTLETL 161
            VP  N   + + + +   +E + ET TGL+  KTLE +
Sbjct: 100 -VPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 1/39 (2%)

Query: 186 LDPERMNMVVERNRKKLEKYQQHKKE-KGLKGFFYKIFD 223
           L+ + +++VVERN+K+LEK+++HK E   +K F YK  D
Sbjct: 193 LEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G++ T  AVPD+N+P S+ + +  +E   ET TGL+   TL++L
Sbjct: 49  LIRTETVKSLQDMGMNATP-AVPDVNAPQSNRNAIFPEEYTIETTTGLVPVATLQSL 104

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  +K  VPD+N+P S ++K+  +E   ET TGL+   TL ++
Sbjct: 47  LTRTETVKSLQDMGVS-SKAPVPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSI 102

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  +K  VPD+N+P S ++K+  +E   ET TGL+   TL ++
Sbjct: 47  LTRTETVKSLQDMGVS-SKAPVPDVNAPQSGKNKIFPEEYTLETPTGLVPVATLHSI 102

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  +K  +PD+N+P S ++K+  +E   ET TGL+   TL ++
Sbjct: 47  LTRTETVKSLQDMGVS-SKAPIPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSI 102

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  ++  VPD+N+P S ++K+  +E   ET TGL+   TL ++
Sbjct: 47  LTRTETVKSLQDMGVS-SRAPVPDVNAPQSSKNKIFPEEYTIETPTGLVPVATLHSI 102

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  GL  +   +PD+N+P S++  +  +E   ET TGL+   TL +L
Sbjct: 42  LSRTETVKSLQDMGLT-SDAPIPDVNAPTSNKHSIFPEEYTMETPTGLVPVATLHSL 97

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 38.1 bits (87), Expect = 0.014,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 75/196 (38%), Gaps = 62/196 (31%)

Query: 14  SSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQTNDSFWS 73
           + +E  +P+ ++ Q ++R++ D+L+   N                              S
Sbjct: 18  TGLEDTQPQQYIYQSVSRQSRDDLQSSIN------------------------------S 47

Query: 74  FRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSP 133
           + + + T+R+S+ +              Q   L K ETV SL   G+  +    P IN+P
Sbjct: 48  YLTTTPTNRSSNAS------------TNQRLKLVKTETVKSLIDMGVS-SYIPNPAINAP 94

Query: 134 -ISHESKLIDESKFETDTGLIKTKTLETLXXXXXXXXXXXXXILGNDNSNTSGLDPERMN 192
             S ++   +E   ET+TGL+   TL +               LG  N+N   L  +R  
Sbjct: 95  KTSKKAIFPEEYTLETETGLVPVSTLHS---------------LGRTNTN---LSRQRTR 136

Query: 193 MVVERNRKKLEKYQQH 208
             + R   ++    QH
Sbjct: 137 HTLSRRNTRIASSAQH 152

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSP--ISHESKLIDESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  T   VPD+N+P   +      +E   ET TGL+   TL+++
Sbjct: 42  LTRTETVKSLQEMGMTATA-PVPDVNAPQTTARPQIFPEEYTMETPTGLVPVATLQSI 98

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 5/59 (8%)

Query: 106 LGKAETVDSLRATGLDLTKRA-VPDINSPISHESKLI--DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  TK A +PD+N+P + +   I  +E   ET TGL+   TL+++
Sbjct: 48  LVRTETVKSLQDMGM--TKNAPIPDVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSI 104

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI--DESKFETDTGLIKTKTLETL 161
           L + ETV +L+  G+  +   VPDIN+P S +   I  +E   ET TGL+   TL+++
Sbjct: 43  LTRTETVKTLQDLGVT-SHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSM 99

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI-DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  ++  +P +N+P +   ++  +E   ET TGL+   TL++L
Sbjct: 45  LSRTETVKSLQDMGMT-SEAPIPGVNAPQTSRVQIFPEEYTMETPTGLVPVATLQSL 100

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 106 LGKAETVDSLRATGLDLTKRA-VPDINSPISHESKLI--DESKFETDTGLIKTKTLETL 161
           L + ETV SL+  G+  T+ A +PD+N+P +     I  +E   ET TGL+   TL++L
Sbjct: 48  LTRTETVKSLQEMGM--TQDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSL 104

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 110 ETVDSLRATGLDLTKRAVPDINSPISHESK---LIDESKFETDTGLIKTKTLETL 161
           ETV SL+  G+   +  +PD+N+P +  S      +E   ET TGL+   TL++L
Sbjct: 52  ETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSL 105

>Ecym_7082 Chr7 (162495..164216) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AGR211W
          Length = 573

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 16  IESYKPEPFVGQGIAREN-TDELEFQSNLKDAQSHTSEKFQEEQVDPLKQ--------VQ 66
            E   P P   +   +EN T  + F + +++   HT++      + PL Q          
Sbjct: 132 CEYCSPLPPWDRSYQQENSTKHISFHAYVRELNEHTNKASGSSYIPPLSQPDFHVNKNCP 191

Query: 67  TNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGL 120
                W  RS+ +  + S+ +L++Q  R ++ +  Q++ L   E +DS R TG+
Sbjct: 192 AGHVPWP-RSICSKCQPSAISLQRQEFRMVDHVEFQHSELVN-EFIDSWRTTGM 243

>ZYRO0F10978g Chr6 complement(895804..897255) [1452 bp, 483 aa] {ON}
           similar to uniprot|Q02948 Saccharomyces cerevisiae
           YPL120W VPS30 Protein required for sorting and delivery
           of soluble hydrolases to the vacuole
          Length = 483

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 37  LEFQSNLKDAQSHTSEKFQEEQVDPLKQVQTNDSFWSFRSVSNTSRTSSKNLKKQRSRDI 96
           +  QSNLKD   H +E  +++ ++ L+Q++ +      RS+ N    +  NL K R  +I
Sbjct: 229 ISLQSNLKDKIQHENEDLRKKNIEDLEQLEFSK---EVRSLKNQHELTLNNLDKLRKVNI 285

Query: 97  ERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI 141
                + +  G    ++ LR  G D T     +IN+ +     L+
Sbjct: 286 YNETFKISHEGPFGVINGLRIGGFDNTTVPWHEINAGLGQVVLLL 330

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 106 LGKAETVDSLRATGLDLTKRA-VPDINSPISHESKLI--DESKFETDTGLIKTKTLETL 161
           L + ETV +L+  G+  T+ A VPD+N+P +     I  +E   ET TGL+   TL++L
Sbjct: 49  LTRTETVKTLQDLGV--TRDAPVPDVNAPQTSARNTIFPEEYTMETTTGLVPVSTLQSL 105

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 4/55 (7%)

Query: 110 ETVDSLRATGLDLTKRAVPDINSPISHE---SKLIDESKFETDTGLIKTKTLETL 161
           ETV SL+  G+   +  +PD+N+P + +   +   +E   ET TGL+   TL++L
Sbjct: 58  ETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSL 111

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 106 LGKAETVDSLRATGLDLTKRAVPDINSPISHESKLI--DESKFETDTGLIKTKTLETL 161
           L + ET  +L+  G+  ++  +PDIN+P   +   I  +E   ET TGL+   TL+++
Sbjct: 47  LTRTETAKTLQDMGMT-SEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSI 103

>Kwal_27.10370 s27 (308739..308975) [237 bp, 78 aa] {OFF} [contig
           36] FULL
          Length = 78

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 75  RSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDI 130
           RSV   +   S +LKK+ S  IE + T   M+    TV   RA+ L  T R +P I
Sbjct: 19  RSVLLINLKHSTSLKKRASVLIENVETSKPMINTVLTVA--RASNLSWTSRGIPGI 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,895,520
Number of extensions: 929294
Number of successful extensions: 4105
Number of sequences better than 10.0: 109
Number of HSP's gapped: 4062
Number of HSP's successfully gapped: 110
Length of query: 223
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 118
Effective length of database: 41,441,469
Effective search space: 4890093342
Effective search space used: 4890093342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)