Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C019103.485ON1020102050100.0
NCAS0E009503.485ON1052103230730.0
NDAI0G009903.485ON1054102030440.0
Suva_7.4133.485ON1037103130360.0
YGR125W3.485ON1036103430360.0
Smik_6.2213.485ON1036103430180.0
Skud_7.4363.485ON1036101230160.0
KNAG0B008603.485ON1088106429480.0
CAGL0I10626g3.485ON1070102829420.0
ZYRO0C07986g3.485ON1024102128470.0
TDEL0D055303.485ON1031101028140.0
SAKL0F02926g3.485ON1050102627300.0
Kpol_480.183.485ON1057101826780.0
KLTH0F14674g3.485ON101098926680.0
Kwal_55.212013.485ON101198826670.0
TBLA0C044403.485ON115091426570.0
TPHA0D042103.485ON104998426440.0
KLLA0E04731g3.485ON106091924030.0
AFR304W3.485ON101599222600.0
Skud_16.2868.99ON7452881391e-07
Smik_16.2418.99ON7442871352e-07
SAKL0H08800gna 1ON6203571291e-06
Suva_16.3228.99ON7422871282e-06
Ecym_7084na 1ON6893101173e-05
KLLA0E14059g8.99ON7063411148e-05
AGR213Cna 1ON6893001149e-05
YPR003C8.99ON7542901131e-04
NCAS0B048008.99ON7242851122e-04
SAKL0B03124g8.99ON7443311093e-04
ZYRO0F04796g8.99ON7352901068e-04
TBLA0C052708.99ON77669960.012
Kwal_27.110398.99ON726324960.012
TDEL0C012808.99ON727288950.013
KLTH0G16764g8.99ON710300940.020
Kpol_467.118.99ON744284890.079
Smik_12.1518.271ON893204890.086
CAGL0L09207g8.99ON725132880.099
Skud_12.1608.271ON893252870.12
Smik_2.435na 2ON863170870.14
Suva_10.1768.271ON893204840.28
KNAG0D023908.99ON716129830.35
TDEL0F039808.271ON867179830.39
Kpol_2002.865.180ON636113820.48
YLR092W (SUL2)8.271ON893203820.52
NDAI0B022108.99ON706285800.77
Skud_2.424na 2ON863173791.1
TPHA0H007208.99ON78769791.2
TPHA0O003401.464ON105662781.7
Suva_4.554na 2ON850156762.7
YBR294W (SUL1)na 2ON859167762.7
SAKL0H16830g8.271ON862161753.7
NDAI0E014008.644ON32574735.1
Skud_7.918.141ON89773735.6
NDAI0C002102.661ON31653726.1
YDR325W (YCG1)5.367ON1035195736.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01910
         (1020 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1934   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1188   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1177   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1174   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1174   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1167   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1166   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1140   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1137   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1101   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1088   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1056   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1036   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1032   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1031   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1028   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1023   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   930   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   875   0.0  
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    58   1e-07
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    57   2e-07
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    54   1e-06
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    54   2e-06
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    50   3e-05
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    49   8e-05
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    49   9e-05
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    48   1e-04
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    48   2e-04
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    47   3e-04
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    45   8e-04
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    42   0.012
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    42   0.012
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    41   0.013
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    41   0.020
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    39   0.079
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...    39   0.086
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    39   0.099
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...    38   0.12 
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...    38   0.14 
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...    37   0.28 
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    37   0.35 
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...    37   0.39 
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    36   0.48 
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...    36   0.52 
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    35   0.77 
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...    35   1.1  
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    35   1.2  
TPHA0O00340 Chr15 (49952..53122) [3171 bp, 1056 aa] {ON} Anc_1.4...    35   1.7  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...    34   2.7  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...    34   2.7  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...    33   3.7  
NDAI0E01400 Chr5 complement(279960..280937) [978 bp, 325 aa] {ON...    33   5.1  
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    33   5.6  
NDAI0C00210 Chr3 (33765..34715) [951 bp, 316 aa] {ON} Anc_2.661 ...    32   6.1  
YDR325W Chr4 (1117126..1120233) [3108 bp, 1035 aa] {ON}  YCG1Sub...    33   6.9  

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1934 bits (5010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/1020 (94%), Positives = 963/1020 (94%)

Query: 1    MTSFNKSNDARAXXXXXXXXXXXXXXXXQDQESNIAGTDNELSNSKSNYLSRSYMYGLLP 60
            MTSFNKSNDARA                QDQESNIAGTDNELSNSKSNYLSRSYMYGLLP
Sbjct: 1    MTSFNKSNDARASKRLSLSDSISRSLGLQDQESNIAGTDNELSNSKSNYLSRSYMYGLLP 60

Query: 61   SATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTD 120
            SATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTD
Sbjct: 61   SATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTD 120

Query: 121  RDNINEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAEVSSIAEGLRHHYSSIES 180
            RDNINEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAEVSSIAEGLRHHYSSIES
Sbjct: 121  RDNINEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAEVSSIAEGLRHHYSSIES 180

Query: 181  TKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIF 240
            TKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIF
Sbjct: 181  TKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIF 240

Query: 241  SHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEEN 300
            SHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEEN
Sbjct: 241  SHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEEN 300

Query: 301  QDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIE 360
            QDAIITTTIFCYVISSM                IVGFFPRHILIGCIGGVGYFLLITGIE
Sbjct: 301  QDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIE 360

Query: 361  VTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLI 420
            VTTRIAKFEYSLPLIKELFTDTSMLWKW             QKCFKRSLVLPSFYIATLI
Sbjct: 361  VTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLI 420

Query: 421  LFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLAL 480
            LFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLAL
Sbjct: 421  LFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLAL 480

Query: 481  TFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIR 540
            TFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIR
Sbjct: 481  TFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIR 540

Query: 541  AGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTT 600
            AGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIF            DTWDKLTT
Sbjct: 541  AGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTT 600

Query: 601  FEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDL 660
            FEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDL
Sbjct: 601  FEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDL 660

Query: 661  IQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNI 720
            IQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNI
Sbjct: 661  IQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNI 720

Query: 721  NADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGA 780
            NADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGA
Sbjct: 721  NADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGA 780

Query: 781  LEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNI 840
            LEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNI
Sbjct: 781  LEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNI 840

Query: 841  FKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSK 900
            FKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSK
Sbjct: 841  FKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSK 900

Query: 901  KRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAP 960
            KRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAP
Sbjct: 901  KRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAP 960

Query: 961  SSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020
            SSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST
Sbjct: 961  SSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1032 (61%), Positives = 746/1032 (72%), Gaps = 49/1032 (4%)

Query: 29   QDQESNIAGTDNELSNSKSNYLSRSYMYGLL---PSATPVEELETNTLPLSND----LRN 81
            Q++E      D+E  N+ +NY+ RSY+ G L   P+     + +  +LP++ +    L N
Sbjct: 30   QEEEPRDDYFDDENVNN-NNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFN 88

Query: 82   KSIHQSRILHKQTAAICEDFNESDEGS-MKDYLDFIENTDRDNINEHKESLPVTVVLST- 139
            + IH S  LHKQTAAI EDF + ++ + +KDY+   +  D   + +  +SL   + L   
Sbjct: 89   RPIHASEKLHKQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQD 148

Query: 140  ---------PADEVEEQDESSRLLLTPSSSNAEVSSIAEGL----RHHYSSIESTKDNNM 186
                     P  E  + DESSRLL++P SSN    +I + L        SS +S      
Sbjct: 149  EEAEEDFIEPVAEAADVDESSRLLISPLSSNIN-PNIDDLLPTVTGEDVSSYQSIYRTAT 207

Query: 187  PIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPT 246
            P   +   TI + ++ F Y  + Y PA+VLGLLLNILDALSYGMIIFPI+EPIFSHLGPT
Sbjct: 208  PSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPT 267

Query: 247  GMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIIT 306
            G+SMFYISTII Q IYSSGWSSFPS IGSEMIE+TPFFHTMA AI  +LPG +  D IIT
Sbjct: 268  GLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRD--DEIIT 325

Query: 307  TTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIA 366
            TTIFCYVISSM                IVGFFPRHILIGCIGGVGYFLL+TGIEVTTR+A
Sbjct: 326  TTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVA 385

Query: 367  KFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIV 426
            KFEYS+P +  LF+D + LWKW             Q+CFK SLVLPSFYI TLILFHFIV
Sbjct: 386  KFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIV 445

Query: 427  AIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGIL 486
            AIIP L+L QLR++GWIF     NS WYDHYKLFDF KVHW LVFKQIPTMLALTFFGIL
Sbjct: 446  AIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGIL 505

Query: 487  HVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSP 546
            HVPINVPALAMS+ +DKYDVDKELIAHGLSN +SG  GSIQNYLVYTNSVLFIRAGADS 
Sbjct: 506  HVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSA 565

Query: 547  FAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTV 606
             AGY+LI LT +VM IGPVIISFIPICIVGSLIF            D W K++ FEY+T+
Sbjct: 566  MAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITI 625

Query: 607  VVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFL 666
            V+IVLTMGI DFVLGIIVGILIACF FLIDS+KLQTINGE+ G VAKSTV RDLIQ+KFL
Sbjct: 626  VIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFL 685

Query: 667  NGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNID 726
            NGIG+QIYVLKLQNLLFFGTIISIEEKID+LLE+  ++SS+ +IKYLILDF+NINADNID
Sbjct: 686  NGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNID 745

Query: 727  YSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCEN 786
            YSAAEGFNRIKR T++K IQL+ISSIK RD IY +F+ VGLL GVELFNDLN ALEWCEN
Sbjct: 746  YSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCEN 805

Query: 787  EFLYQYKMIRERIKIKNVK-----------------TATHSSDGNLSKP-SAMTLSINTP 828
            EFL++YK +R++ K +  +                 TA +    NL  P + M+L INTP
Sbjct: 806  EFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTP 865

Query: 829  RNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEI 888
            RN+QI SVAQN+F+NEEQTV  LK   +DQ P LPLLLF LKQYRP I+S DK  K  EI
Sbjct: 866  RNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEI 925

Query: 889  EFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKI 948
            +FWSQL PYF K  +ASQS L H NNIFF+VE G+LK TF+LPQG +YETMS R CYGKI
Sbjct: 926  KFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKI 985

Query: 949  MGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIR 1008
             G     + +  + + + I+ E D+++W+IDS +L KM+ EN EL+ EL LL+M +KD R
Sbjct: 986  TG-----QHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNR 1040

Query: 1009 FKSLLGHALVST 1020
            FK LLG+ LVS 
Sbjct: 1041 FKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1177 bits (3044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1020 (61%), Positives = 743/1020 (72%), Gaps = 60/1020 (5%)

Query: 47   SNYLSRSYMYGLLPSATPV--EELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNE- 103
            SNYL RSY+ G L SA+P    +   NTLP++N   NKSIH S+ LH+QTAAI EDFN  
Sbjct: 47   SNYLGRSYVSGFL-SASPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNND 105

Query: 104  ---SDEGSMKDYLD-----------------FIENTDR-DNINEHKESLPVTVVLSTPAD 142
                D+ +MK+Y+                  +I+N DR DNI   +E+ PVT        
Sbjct: 106  PTFEDDINMKEYISNLEDDATGNNGKRYTAYYIDNEDRIDNI-LTEEAEPVT-------- 156

Query: 143  EVEEQDESSRLLLTPSSSNAEVS------SIAE-----GLRHHYSSIESTKDNNMPIEEQ 191
            +   QDE+SRLLL+P  S++ ++      SI+E       R   S+ +S +  N    E 
Sbjct: 157  DFYPQDENSRLLLSPIPSDSLLAGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEY 216

Query: 192  QDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMF 251
                   K        +QY PAS+LGLLL ILDALSYGMIIFPI+EPIFSHLGPTG+SMF
Sbjct: 217  SSIPTWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMF 276

Query: 252  YISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFC 311
            YISTII Q I+S GWSSFP  IGSEMIE+TPFFHTMAFAI  +LP E + D IITTT+FC
Sbjct: 277  YISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALP-EGSNDDIITTTLFC 335

Query: 312  YVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYS 371
            YVISSM                IVGFFPRHILIGCIGGVGYFL+ITGIEV+TR+AKF+Y+
Sbjct: 336  YVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYT 395

Query: 372  LPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPR 431
            +P I  LFTD   LW+W             QKC + SLVLPSFYI TLILFHF+VAIIP 
Sbjct: 396  IPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPS 455

Query: 432  LSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPIN 491
            LSL QLR++GWIF   A +S WYDHYKLF+ HKVHW L+ KQIPTMLALTFFGILHVPIN
Sbjct: 456  LSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPIN 515

Query: 492  VPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYL 551
            VPALAMS+QMD+YDVDKELIAHG+SN VSGMFGSIQNYLVYTNSVLFIRAGADS  AG++
Sbjct: 516  VPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHI 575

Query: 552  LIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVL 611
            LI LTI++M+IGPVIISFIPICIVGSLIF            D   K++ FEY+T+V+IV 
Sbjct: 576  LIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVF 635

Query: 612  TMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGD 671
            TMGI DFVLG+IVGILIACF FLIDS+KLQTINGEF G VAKSTV RDLIQ+KFLNGIG+
Sbjct: 636  TMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGE 695

Query: 672  QIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAE 731
            QIYVLKLQNLLFFGTIISIEEKIDKLLE+SD +SSK +IKYLILDF+NINADNIDYSAAE
Sbjct: 696  QIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAE 755

Query: 732  GFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQ 791
            GFNRIKR T++K I+LIISSI+ RD IYN+FN VGLL GVELFNDLN ALEWCENEFL++
Sbjct: 756  GFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFK 815

Query: 792  YKMIRERIKIKNVK-----------TATHSSDGNLSKP-SAMTLSINTPRNYQIYSVAQN 839
            YK +RE+ + K                T   + +L  P + M+L +NTPRN Q+ SVAQN
Sbjct: 816  YKTLREKTRQKRKNKIDINLAITNGNPTEERNMHLEIPRNIMSLPMNTPRNNQMLSVAQN 875

Query: 840  IFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFS 899
            +F+NEEQ    LK +F+++  VLPLLLF LKQYRP IVS DK  + KEI+FWSQL PY S
Sbjct: 876  VFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLS 935

Query: 900  KKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADA 959
            ++ + +QS L H NN FF+VE G+LK TF LP G +YETMS R CYGKI+G    +E   
Sbjct: 936  ERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILGS--NNETTV 993

Query: 960  PSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVS 1019
             + Q + IKTE D  +W+ID  AL +M+ EN+ELY+ELVLL+M+I+D RFK LLG+ LVS
Sbjct: 994  LNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVS 1053

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1031 (58%), Positives = 740/1031 (71%), Gaps = 61/1031 (5%)

Query: 31   QESNIAGTDNELSNSKSNYLSRSYMYGLLPS-ATPVE-ELETNTLPLSNDLRNKSIHQSR 88
            Q+S+        +++ S  L RSYM G     ++P+   +    LP SN    K IH S 
Sbjct: 27   QDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSNKQHPKVIHGSE 86

Query: 89   ILHKQTAAICEDFN----ESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADEV 144
             LH+QTA +  +F     E +  ++KDY+D I++ DR +    +        +    DE 
Sbjct: 87   NLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSMR-------TIEENIDE- 138

Query: 145  EEQDESSRLLLTPSSSNAE-----------VSSIAEGLRHHYSSIESTKDNNMPIEEQQD 193
            E  DE SRLLL+P+SSN +            S + +G    Y S+  + D          
Sbjct: 139  EYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRF-----GP 193

Query: 194  NTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYI 253
             ++ +  ++F     QY PA+VLGLLLNILDALSYGMIIFPI+EP+FSHLGPTG+SMFYI
Sbjct: 194  RSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYI 253

Query: 254  STIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYV 313
            STII Q +YS GWSSFPS +GSEMIEITPF+HTMA  I  +L G +  D IITTTIFCYV
Sbjct: 254  STIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD--DEIITTTIFCYV 311

Query: 314  ISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLP 373
            ISSM                IVGFFPRHILIGCIGGVGYFL+ITGIEVTTR+AKFEYS P
Sbjct: 312  ISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWP 371

Query: 374  LIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLS 433
             +  LFT+   L KW             Q+CFK SLVLP+FYI TL+LFHFIVAIIP LS
Sbjct: 372  FVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLS 431

Query: 434  LTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVP 493
            L  LR++GWIF   + +S WYDHYKLF+ HKVHW LV +QIPTM+ALTFFGILHVPINVP
Sbjct: 432  LDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVP 491

Query: 494  ALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLI 553
            ALAMS+QMDKYDVDKELIAHG SN  SG+ GS+QNYLVYTNSVLFIRAGADS FAG+LL+
Sbjct: 492  ALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLV 551

Query: 554  FLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTM 613
             LT+ +M+IGPVIISFIPICIVGSLIF            DTW KL  FEY+TVV+IV TM
Sbjct: 552  ALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTM 611

Query: 614  GIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQI 673
            GI DFVLGIIVGILIACF FL+DS+KLQT+NGE++G VAKSTV RD +Q+KFL+GIG+QI
Sbjct: 612  GIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQI 671

Query: 674  YVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGF 733
            YVLKLQN+LFFGTIISIEEKI++LLE+S+++S+KR+IKYLILDF+NINADNIDYSAAEGF
Sbjct: 672  YVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGF 731

Query: 734  NRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYK 793
            NRIKR TE+K I+LIISSIK RD IYN+FN VGLL  VELF DLNGALEWCENEFL+QYK
Sbjct: 732  NRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYK 791

Query: 794  MIRERIKIK-------NVKTATHSSDGN---------LSKPS-------AMTLSINTPRN 830
             +RE+ K +       NV +A  ++  N         L+K          M+L  NTPRN
Sbjct: 792  QLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRN 851

Query: 831  YQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVS-VDKVKKGKEIE 889
            +Q+ SVAQN+F N+EQ V  LK  +++  PVLP+LLFALKQYRPDIVS V KV++ KEI+
Sbjct: 852  HQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVRE-KEIK 910

Query: 890  FWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIM 949
            FW+QL PYFS++R+ASQS+L H +N+FFL+E G+LK  ++LPQG +YE MS   C+GKI+
Sbjct: 911  FWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKII 970

Query: 950  GKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRF 1009
                      P  Q + I+TE D+++W+IDSS+LKKMK+EN+ LY+E+ L++M IKD RF
Sbjct: 971  A----PGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRF 1026

Query: 1010 KSLLGHALVST 1020
            K LLG+ LVS 
Sbjct: 1027 KELLGYTLVSA 1037

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1034 (58%), Positives = 737/1034 (71%), Gaps = 65/1034 (6%)

Query: 30   DQESNIAGTDNELSNSKSNYLSRSYMYGLLPSATP--VEELETNTLPLSNDLRNKSIHQS 87
            +Q+S++        ++ S  L RSYM G         +  L  + LP+SN    K IH S
Sbjct: 25   NQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNLSDSKLPISNKQHPKVIHGS 84

Query: 88   RILHKQTAAICEDFN----ESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADE 143
              LH+QTA +  +F     E +  ++KDY+D I N DR +    +        +    DE
Sbjct: 85   ENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKDDQSMR-------TIEENIDE 137

Query: 144  VEEQDESSRLLLTPSSSNAE-----------VSSIAEGLRHHYSSIESTKDNNMPIEEQQ 192
             E  DE SRLLL+P+SSN +           +  + +G    Y S+  + +        +
Sbjct: 138  -EYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQSLRPSHNLRF-----R 191

Query: 193  DNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFY 252
               +    ++F      Y PA+VLGLLLNILDALSYGMIIFPI+EP+FSHLGPTG+SMFY
Sbjct: 192  PRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFY 251

Query: 253  ISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCY 312
            ISTII Q +YS GWSSFPS IGSEMIEITPF+HTMA AI  +L G  N D IITTTIFCY
Sbjct: 252  ISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAG--NDDEIITTTIFCY 309

Query: 313  VISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSL 372
            VISSM                IVGFFPRHILIGCIGGVGYFL+ITGIEVTTR+AKFEYS 
Sbjct: 310  VISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSW 369

Query: 373  PLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRL 432
            P    LFTD   L KW             Q+ FK SLVLPSFYI TL+LFHFIVAIIP L
Sbjct: 370  PFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTL 429

Query: 433  SLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINV 492
            SL  LR+AGWIF     +S WYDHY+LF+ HKVHW LV +QIPTM+ALTFFGILHVPINV
Sbjct: 430  SLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINV 489

Query: 493  PALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLL 552
            PALAMS+QMDKYDVD+ELIAHG SN  SG+ GS+QNYLVYTNSVLFIRAGADSPFAG+LL
Sbjct: 490  PALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLL 549

Query: 553  IFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLT 612
            I LTI +M+IGPVIISFIPICIVGSLIF            DTW+KL  FEY+TVV+IV T
Sbjct: 550  IALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFT 609

Query: 613  MGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQ 672
            MGI DFVLGIIVGILIACF FL+DS+KLQTINGE++G VA+STV RD +Q+KFL+GIG+Q
Sbjct: 610  MGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQ 669

Query: 673  IYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEG 732
            IYVLKLQNLLFFGTIISIEEKI++LL++S+++++KR+IKYLILDF+NINADNIDYSAAEG
Sbjct: 670  IYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEG 729

Query: 733  FNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQY 792
            FNRIKR TE+K I+LIISSIK RDRIYN+FN VGLL  VELF DLN ALEWCENEFL+QY
Sbjct: 730  FNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQY 789

Query: 793  KMIRERIK------------------IKNVKTAT------HSSDGNLSKPSAMTLSINTP 828
            K +R++ K                   KN K  T        S+G+ ++ + M+L  NTP
Sbjct: 790  KQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTAR-NLMSLPTNTP 848

Query: 829  RNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVS-VDKVKKGKE 887
            RNYQI SVAQN+F N+EQ V   K  ++D  PVLP+LLFALKQYRPDI+S V KV++ KE
Sbjct: 849  RNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVRE-KE 907

Query: 888  IEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGK 947
            I+FW+QL PYF+++R+ASQS L H +NIFFLVE G+LK T++LPQG +YE  S   C+GK
Sbjct: 908  IKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGK 967

Query: 948  IMGKIPVSEADA-PSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKD 1006
            I     ++  +A P  Q + I+TE D+V+W+IDSS+L K+K++N+ LY+E+ L+VM IKD
Sbjct: 968  I-----IAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKD 1022

Query: 1007 IRFKSLLGHALVST 1020
             RFK LLG+ LVS 
Sbjct: 1023 TRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/1034 (58%), Positives = 737/1034 (71%), Gaps = 65/1034 (6%)

Query: 30   DQESNIAGTDNELSNSKSNYLSRSYMYGLLPSATP--VEELETNTLPLSNDLRNKSIHQS 87
            +Q+S+I        ++ S  L RSYM G         +  +  + LPLSN    K IH S
Sbjct: 25   NQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINSMSDSKLPLSNKQHPKVIHGS 84

Query: 88   RILHKQTAAICEDFN----ESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADE 143
              LH+QTA +  +F     E +  ++KDY+D I++ DR +    +          T  ++
Sbjct: 85   ENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDRKDDQSMR----------TIEED 134

Query: 144  VEEQ--DESSRLLLTPSSSNAE-----------VSSIAEGLRHHYSSIESTKDNNMPIEE 190
            ++E+  DE SRLLL+P+SSN              S + +     Y S+ S+ +       
Sbjct: 135  IDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQSLRSSHN-----LR 189

Query: 191  QQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSM 250
             +        ++F    + Y PA+VLGLLLNILDALSYGMIIFPI+EP+FSHLGPTG+SM
Sbjct: 190  SRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISM 249

Query: 251  FYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIF 310
            FYISTII Q +YS G SSFPS IGSEMIEITPF+HTMA A+  +L G++  D IITTTIF
Sbjct: 250  FYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDD--DEIITTTIF 307

Query: 311  CYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEY 370
            CYVISSM                IVGFFPRHILIGCIGGVGYFL+ITGIEVTTR+AKFEY
Sbjct: 308  CYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEY 367

Query: 371  SLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIP 430
            S P    LFT+   L KW             Q+ FK SLVLPSFYI TL+LFHFIVAIIP
Sbjct: 368  SWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIP 427

Query: 431  RLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPI 490
             LSL  LR AGWIF     +S WYDHYKLF+ HKVHW LV +QIPTM+ALTFFGILHVPI
Sbjct: 428  TLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPI 487

Query: 491  NVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGY 550
            NVPALAMS+QMDKYDVD+ELIAHG SN  SG+ GS+QNYLVYTNSVLFIRAGADS FAG+
Sbjct: 488  NVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGF 547

Query: 551  LLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIV 610
            LLI LTI +M+IGPVIISFIPICIVGSLIF            DTW+KL  FEY+TVV+IV
Sbjct: 548  LLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIV 607

Query: 611  LTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIG 670
             TMGI DFVLGIIVGILIACF FL+DS+KLQTINGE++G VAKSTV RD +Q+KFL+GIG
Sbjct: 608  FTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIG 667

Query: 671  DQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAA 730
            +QIYVLKLQNLLFFGTI+SIEEKI+KLL++S+++++KR+IKYLILDF+NINADNIDYSAA
Sbjct: 668  EQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAA 727

Query: 731  EGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLY 790
            EGFNRIKR TE+K I+LIISSI+ RDRIYN+FN VGLL  VELF DLN ALEWCENEFL+
Sbjct: 728  EGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLF 787

Query: 791  QYKMIR----ERIK-------IKNVKTATHSSD----------GNLSKP--SAMTLSINT 827
            QYK +R    ER++       +  V  AT + +          GN   P  + M+L  NT
Sbjct: 788  QYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNLMSLPTNT 847

Query: 828  PRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKE 887
            PRNYQ+ SVAQN+F N+EQ V   K  ++D  PVLP+LLFALKQYRPDI+S  +  + KE
Sbjct: 848  PRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKE 907

Query: 888  IEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGK 947
            I+FW+QL PYF+++R+ASQS+L H +N+FFLVE G+LK T++LPQG +YE  S   C+GK
Sbjct: 908  IKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGK 967

Query: 948  IMGKIPVSEADA-PSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKD 1006
            I     ++  +A P  Q + I+TE D+++W+IDSS+LKKMK+EN+ LY+E+ L+VM IKD
Sbjct: 968  I-----IAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKD 1022

Query: 1007 IRFKSLLGHALVST 1020
             RFK LLG+ LVS 
Sbjct: 1023 TRFKELLGYTLVSA 1036

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1012 (59%), Positives = 724/1012 (71%), Gaps = 61/1012 (6%)

Query: 50   LSRSYMYGLLPSATP--VEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFN----E 103
            L RSYM G     +   V+ +  + LP SN      IH S  LH+QTA +  +F     E
Sbjct: 45   LCRSYMSGFFTGGSSPMVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVE 104

Query: 104  SDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAE 163
             +  ++KDY+D I++ DR +    +     T+V +   DE E  DE SRLLL+P+SSN +
Sbjct: 105  ENSPTIKDYMDIIDSDDRKDDQSMR-----TIVENI--DE-EYSDEYSRLLLSPASSNVD 156

Query: 164  -----------VSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFP 212
                       +S + +     Y S+  + +        +   I +  ++F +    Y P
Sbjct: 157  DERNRALQSGPISELEDDYGGGYQSLRPSHNLRF-----RPRNIWQWCTSFPFKFAHYLP 211

Query: 213  ASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSC 272
            A+VLGLLLNILDALSYGMIIFPI+EP+FSHLGPTG+SMFYISTII Q +YS GWSSFPS 
Sbjct: 212  AAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSG 271

Query: 273  IGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXX 332
            IGSEMIEITPF+HTMA A+  +L G  N D IITTTIFCYVISSM               
Sbjct: 272  IGSEMIEITPFYHTMALAVKDALEG--NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLG 329

Query: 333  XIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXX 392
             IVGFFPRHILIGCIGGVGYFL+ITGIEVTTR+AKFEYS P    LFT+   L KW    
Sbjct: 330  KIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPV 389

Query: 393  XXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSA 452
                     Q+ FK SLVLP+FYI TL+LFHFIVAIIP LSL  LREAGWIF     +S 
Sbjct: 390  LLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSK 449

Query: 453  WYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIA 512
            WYDHYKLF+ HKVHW LV +QIPTM+ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIA
Sbjct: 450  WYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIA 509

Query: 513  HGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPI 572
            HG SN  SG+ GS+QNYLVYTNSVLFIRAGADS FAG+LLI LTI VMLIGPVIISFIPI
Sbjct: 510  HGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPI 569

Query: 573  CIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFK 632
            CIVGSLIF            DTW+KL  FEY+TVV+IV TMG+ DFVLGIIVGILIACF 
Sbjct: 570  CIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFS 629

Query: 633  FLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEE 692
            FL+DS+KLQTINGE++G VAKSTV RD +Q+KFL+GIG+QIYVLKLQN+LFFGTIISIEE
Sbjct: 630  FLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEE 689

Query: 693  KIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSI 752
            KI+KLL++S++++ KR+IKYLILDF+NINADNIDYSAAEGFNRIKR T +K I+LIISSI
Sbjct: 690  KIEKLLQISNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSI 749

Query: 753  KVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERI------------- 799
            K RDRIYN+FN VGLL  VELF DLN ALEWCENEFL+QYK +RE+              
Sbjct: 750  KERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLREKAKKRLEERKQSSVA 809

Query: 800  ----------KIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVD 849
                      KI  +     + +      + M+L  NTPRNYQ+ SVAQN+F N+EQ V 
Sbjct: 810  SAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVK 869

Query: 850  RLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSIL 909
              K  +++  P+LP+LLFALKQYRPDI+S  +  + KEI+FW+QL PYF+++R+ASQS+L
Sbjct: 870  NFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLL 929

Query: 910  YHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADA-PSSQAMIIK 968
             H +NIFFLVE G+LK T++LPQG +YE  S   C+GKI     ++  +A P  Q + I+
Sbjct: 930  LHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKI-----IAPGNAMPREQKLTIE 984

Query: 969  TEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020
            TE D+V+W+IDSS+LKKMK+EN+ LY+E+ L+VM IKD RFK LLG+ LVS 
Sbjct: 985  TETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1140 bits (2948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1064 (57%), Positives = 746/1064 (70%), Gaps = 79/1064 (7%)

Query: 31   QESNIAGTDNE----LSNSKSNYLSRSYMYGLLPSATPVEELETNTLPLSND-LRNKSIH 85
            Q ++   +DNE    +   +S+YL RSY+ GL        +   + LP SN+   +K IH
Sbjct: 28   QNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQRNNKSGYDLLPTSNEQAYSKPIH 87

Query: 86   QSRILHKQTAAICEDFNES--DEGS----MKDYLDFIENTDR-----DNINE-------- 126
            +S++LH+QT AI E+F++S  DEGS    + +Y+D +E+ +R     DN+++        
Sbjct: 88   KSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHNERKTANIDNVDQIGGLATGP 147

Query: 127  -----HKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAEVSSIAEGL---------R 172
                   ++ PVT  LS   DE    DE+SRLLLTP SS +   S A  L         R
Sbjct: 148  QTTVPGNKTHPVTSPLS---DEYGIPDENSRLLLTPVSSLSVAISDASSLTPEDYNGRAR 204

Query: 173  HHYSSIESTKDNNMPIEEQQDNT-------INEK---LSTFFYNTLQYFPASVLGLLLNI 222
               + I ST  + +P      +        I  K   +S   ++ + Y PAS+LGLLLNI
Sbjct: 205  SPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHYLPASILGLLLNI 264

Query: 223  LDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITP 282
            LDALSYGMIIFPI+EPIFS LGP+G+SMFYIST+I QF YSSGWSSFP  IGSEMIE+TP
Sbjct: 265  LDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTP 324

Query: 283  FFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHI 342
            FFHTMA  IM++L GEE ++ IITTTIFCYVISSM                +VGFFPRHI
Sbjct: 325  FFHTMALTIMKTL-GEERKNEIITTTIFCYVISSMFTGLTFFTLGKLKLGKLVGFFPRHI 383

Query: 343  LIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQ 402
            LIGCIGGVGYFLLITGIEV TRIAKFEYS+P +  LFTD   L++W             Q
Sbjct: 384  LIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQ 443

Query: 403  KCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDF 462
              F+ SLVLPSFYI TLILFHFIVAI+P LSLT+LR +GWIF   A N  WYDHYK F+F
Sbjct: 444  NRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNF 503

Query: 463  HKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGM 522
              VHW LV KQIPTM+ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHG SN  SG+
Sbjct: 504  SDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGL 563

Query: 523  FGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFXX 582
            FGSI+NYLVYTNSVLFIRAGADS  AGY+LI LTI+VMLIGPVIISFIPICIVGSLIF  
Sbjct: 564  FGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVMLIGPVIISFIPICIVGSLIFLL 623

Query: 583  XXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQT 642
                      DTW KL TFEYVTV +I+LTMGI DFVLGIIVGILIACFKFLIDS+ LQT
Sbjct: 624  GYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQT 683

Query: 643  INGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSD 702
            +NGEFSG+VAKSTV RD IQ+ FL+G+G+QIYVLKLQNLLFFGTIISIEEKIDKLLE+S+
Sbjct: 684  VNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISN 743

Query: 703  RNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSF 762
             +SSKR+IKYLILDF+NIN DNIDYSAAEGFNRI+R T++K IQLIISSI+ +D IY +F
Sbjct: 744  NDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAF 803

Query: 763  NKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIKNVK----------------- 805
            N VGLL  VELF DLN +LEWCENE L+ Y  +R + K +  K                 
Sbjct: 804  NNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSAS 863

Query: 806  -----TATHSSD--GNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQ 858
                  A  S+D  G  +  + M+L  NTPRN+Q+ +VAQ++FKN+EQTV  L+ + + +
Sbjct: 864  KQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRKQLKTK 923

Query: 859  TPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFL 918
             P+LPLLL  LKQYRPDI S DK+ + KEI  WS+L PYF+KK + +Q+ L H N IFFL
Sbjct: 924  DPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFL 983

Query: 919  VEIGVLKVTFDLPQGKVYETMSKRACYGKIM-GKIPVSEADA--PSSQAMIIKTEADTVI 975
            V+ GVLK  F LPQG VYETM+ R CYGKI+     V +AD   P    + I TE D+ +
Sbjct: 984  VQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSEL 1043

Query: 976  WIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVS 1019
            W+ID++A+ +++ E+ EL+++L LLVM IKD RFK LLGHAL+S
Sbjct: 1044 WVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALIS 1087

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1028 (57%), Positives = 724/1028 (70%), Gaps = 69/1028 (6%)

Query: 43   SNSKSNYLSRSYMYGLLPSATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFN 102
            +N  + +L RSY+ G+L S+ P +  E NTLP+SN   +++IH+   LH+QTAAI E+F+
Sbjct: 60   NNDTNTFLGRSYVSGILGSSLP-QGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFD 118

Query: 103  ESDEG----SMKDYLDFIE-------------NTDRDNINEHKESLPVTVVLSTPAD-EV 144
            +   G    S+K+YL+ ++             + D D I ++K   PV++ L    D E+
Sbjct: 119  DGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLITDNKT--PVSINLKRATDPEL 176

Query: 145  EEQDESSRLLLTPSSSN---------------AEVSSIAEGLRHHYSSIESTKDNNMPIE 189
            E+Q  +   LLTPSSSN               A  +   E      + + S     MP  
Sbjct: 177  EQQTVA---LLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTS 233

Query: 190  EQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMS 249
                  +  K  T       Y PA++LGLLLNILDALSYGMIIFPI+EPIF+ LGPTG+S
Sbjct: 234  TTAKAWMTLKRVT------NYMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPTGIS 287

Query: 250  MFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTI 309
            MFYISTII QFIYSSGWSSFPS IGSEMIEITPF+HTMA AI ++LPG +  D IITTTI
Sbjct: 288  MFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRD--DEIITTTI 345

Query: 310  FCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFE 369
            FCYVISS+                IVGFFPRHILIGCIGGVGYFL+ITG+EVTTRIAKFE
Sbjct: 346  FCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFE 405

Query: 370  YSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAII 429
            YS+P + +LF D+SML+KW             QKCFK SLVLPSFYI TLILFHF+VAI 
Sbjct: 406  YSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAIA 465

Query: 430  PRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVP 489
            P LSL QLR+ GWIF     +S WYDHY+ FD  K HW LV KQIPTMLALTFFGILHVP
Sbjct: 466  PNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVP 525

Query: 490  INVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAG 549
            INVPALAMS+QMDKYDVDKELIAHG SN  SG+FGS+QNYLVYTNSVLFIRAGADS  AG
Sbjct: 526  INVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAG 585

Query: 550  YLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVI 609
            Y+LI LTI+VM+IGPVIISFIPICIVGSLIF            D + K+TTFEY T+ +I
Sbjct: 586  YVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGII 645

Query: 610  VLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGI 669
            VLTMGI DFVLGI+VGILIACF FL+DS+KLQT+NGEF G VAKSTV RD  Q++FL+ I
Sbjct: 646  VLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQI 705

Query: 670  GDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSA 729
            G+QIYVLKLQN+LFFGTIISIEEKI++LLE+SD + SK +IK+LILDF+NINADNIDYSA
Sbjct: 706  GEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSA 765

Query: 730  AEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFL 789
            AEGFNRIKR TE+K I+LIIS+I+  DRIY+ FN+VGLL  +ELFNDLN ALEWCENEFL
Sbjct: 766  AEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFL 825

Query: 790  YQYKMIRERI------KIKNVKTA----------THSSDGNLSK--PSAMTLSINTPRNY 831
            YQYK +RE+       + KN+  A          T+ + G  S    + M+LS NTPRNY
Sbjct: 826  YQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTSSLMQNLMSLSNNTPRNY 885

Query: 832  QIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFW 891
            Q+ S AQ  F NE+Q    +  + +   P+L +LLFALK YRP+IVS+D  K+  E+EFW
Sbjct: 886  QLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPNIVSMDTEKRTDEVEFW 945

Query: 892  SQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGK 951
             QL PYF++K   + +   H NN FFLV+ G+LKV ++LP G VYET+S   CYGKI+ K
Sbjct: 946  KQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSK 1005

Query: 952  IPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKS 1011
                  +   +Q + ++ E DT++WIID  +++ MK +NI LY ELVLL++ I+D RFK 
Sbjct: 1006 ----RDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKE 1061

Query: 1012 LLGHALVS 1019
            LLG+ LVS
Sbjct: 1062 LLGYTLVS 1069

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1021 (57%), Positives = 711/1021 (69%), Gaps = 77/1021 (7%)

Query: 29   QDQESNIAGTDNELSNSKSNYLSRSYMYGLLPSATPVEELE-----TNTLPLSNDLRNKS 83
            Q+  S+I        NS +NY  RSY+ G   SA+P   L+     ++ LP+    R+KS
Sbjct: 52   QNDSSSIEIVSPPFYNS-NNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRS-RSKS 109

Query: 84   IHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADE 143
            IH S+I+H+QTA +  +F++   G     ++ + N                       D 
Sbjct: 110  IHGSQIIHRQTAELSNNFSDDTTG-----MEEVRNR---------------------YDA 143

Query: 144  VEEQDESSRLLLTPSSSNAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTF 203
            +E+++ S    +T    + +  ++  G    +     T +NN        ++I +    F
Sbjct: 144  MEDENSSLHHYMT----HQDYQTLPGGTDEDW-----TNNNNSQTARASGSSIVQ----F 190

Query: 204  FYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYS 263
              + L YFP++VLGLLLNILD LSYGMIIFPI+EPIFSHLG TG+SMFYISTII Q +YS
Sbjct: 191  GQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYS 250

Query: 264  SGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXX 323
             G SSF S IGSEMIE+TPFFHTMAFAI  ++PG++  D IITTTIFCY ISS+      
Sbjct: 251  GGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQD--DDIITTTIFCYAISSVVTGITF 308

Query: 324  XXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTS 383
                      IVGFFPRHILIGCIGGVGYFLLITG+ VTTR+AK EY+   +K+LF DT 
Sbjct: 309  YLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTD 368

Query: 384  MLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWI 443
            +LWKW             QKCF+ SLVLPSFYI TLILFHF+VAI+P +SL QLR+ GWI
Sbjct: 369  ILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWI 428

Query: 444  FSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDK 503
            F        W+DHYKLFD+HKVHW LV  QIPTMLALTFFGILHVPINVPALA+S+ MDK
Sbjct: 429  FPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDK 488

Query: 504  YDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIG 563
            +DVDKELIAHG SN +SGM GSIQNYLVYTNSVLFIRAGADSPFAGY+L  LT  VM+IG
Sbjct: 489  FDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIG 548

Query: 564  PVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGII 623
            PVI+SFIPICIVGSLIF            DT  K+T FEY+T+V+IVLTMGI DFVLG+I
Sbjct: 549  PVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVI 608

Query: 624  VGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLF 683
            VGILIACF FL+DS+KLQTINGEF GKVA+STVNRD +QS FLNG+G+QIYVLKLQN+LF
Sbjct: 609  VGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLF 668

Query: 684  FGTIISIEEKIDKLLEMSD-RNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTES 742
            FGTIISIEEKIDKLLE++D ++SSKR+IKYLILDF+NINADNIDYSAAEGFNRIKR T++
Sbjct: 669  FGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 728

Query: 743  KNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIK 802
            K I+LIISSIK RD IYN F+ VGLL  VELFNDLNGALEWCENEFL +YK +R+R + K
Sbjct: 729  KRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREK 788

Query: 803  -----NVKTATHS-------------SDGNLSKPSAMTLS---INTPRNYQIYSVAQNIF 841
                 NV +A  +             S  NLS  +   LS   +NTPRN+Q+ SVAQN+F
Sbjct: 789  MQHSYNVTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMF 848

Query: 842  KNEEQTVDRLKNRF--QDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFS 899
             N+E+ VD L++      Q PVLPLLLFALK YR +I S D   + +E + WSQL PYF 
Sbjct: 849  -NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFV 907

Query: 900  KKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADA 959
            K+R+ +QSIL H  + FF+VE G+LK+  DLPQG VYETMS R C G I+G    S+  +
Sbjct: 908  KRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVG----SDYKS 963

Query: 960  PSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVS 1019
                 + I TE DT +W+ID   L+K++ EN++LY ELVLL + IK  RF+ LLG+ LVS
Sbjct: 964  SEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVS 1023

Query: 1020 T 1020
             
Sbjct: 1024 A 1024

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1088 bits (2814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/1010 (55%), Positives = 724/1010 (71%), Gaps = 56/1010 (5%)

Query: 39   DNELSNSKSNYLSRSYMYGLLPSATPV--EELETNTLPLSNDLRNKSIHQSRILHKQTAA 96
            +++  + ++NYL RSY+ G L S +P     LE++ LP++  +R KSIH ++ LH+QTA 
Sbjct: 50   NDQFMSPRNNYLGRSYVSGFL-SCSPYGSNSLESDRLPIAR-MRTKSIHAAKNLHRQTAK 107

Query: 97   ICEDFNES--DEGSMKDYLDFIEN------TDRDNINEHKESL--PVTVVLSTPADEVEE 146
            +CEDFNE   ++ +++DY+   E       +D + + + ++ L  PV V      D++E+
Sbjct: 108  LCEDFNEPNVEDNNIQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIED 167

Query: 147  QDESSRLLLTPSSSNAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYN 206
              ES                +  G    Y +I ++    +    +  + +  +  +    
Sbjct: 168  VYES----------------LVTGAHGGYRAIPTSPGGGLRTSSR--SALWRQFMSSSSK 209

Query: 207  TLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGW 266
             + Y PA++LGLLLN+LD LSYGMIIFPI+EPIFSHLGP+G+SMFY+STII Q IYSSG+
Sbjct: 210  LVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGF 269

Query: 267  SSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXX 326
            S+FP+ +GSEMIE+TPFFH+MA AI  +LPG +  D I+TTTIFCYVISS+         
Sbjct: 270  SNFPTGVGSEMIEVTPFFHSMALAIKDALPGRD--DEILTTTIFCYVISSLVTGLTFYVL 327

Query: 327  XXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLW 386
                   IVGFFPRHILIGCIGGVGYFL++TG+EVTTR+AK EY+ P I  +FTD S L 
Sbjct: 328  GKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLV 387

Query: 387  KWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSN 446
            KW             Q+ F+ SLVLP+FYIATL+ FHF+VAIIP +SL +LR  GWIF  
Sbjct: 388  KWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPV 447

Query: 447  TAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDV 506
             A    WYDHYKLF  H+VHW L+ KQ PTMLAL+FFGILHVPINVPALA+S+QMDKYDV
Sbjct: 448  AASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDV 507

Query: 507  DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
            DKELIAHG SNL+SG  GSIQNYLVYTNS+LFIRAGADS  AGYLL FLT ++M+IGPVI
Sbjct: 508  DKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVI 567

Query: 567  ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
            IS+IPICIVGSLIF            +T  K+T FEY+T+ +IVLTMGI DFVLG+IVGI
Sbjct: 568  ISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGI 627

Query: 627  LIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGT 686
            LIACF FL+DS+KLQTINGE+ GK+AKSTV RD +QS+FL+GIG+QIYVLKLQ+LLFFGT
Sbjct: 628  LIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGT 687

Query: 687  IISIEEKIDKLLEMS-DRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNI 745
            IISIEEKI+KLLE+S D+ +SKR+IK LILD +NINADNIDYSAAEGFNRIKR T+SK+I
Sbjct: 688  IISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHI 747

Query: 746  QLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIR--ERIKIKN 803
            QLIISSI   D IY +F+KV LL  VELF DLNGALEWCENE L++YK +R   R +++N
Sbjct: 748  QLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQN 807

Query: 804  VKTATHSSDGNLSKP-----------SAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLK 852
                 + +  N +K            + M+L  NTPRN Q+ SVAQ +FKNE++TVD LK
Sbjct: 808  KMQMANLAANNDTKAIDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLK 867

Query: 853  NRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHG 912
              +++  PVLPLLLFALK YRP I+S D   K  E+E WS+L PYF+++R+ASQSIL H 
Sbjct: 868  VNYKELPPVLPLLLFALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHN 927

Query: 913  NNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIM--GKIPVSEADAPSSQAMIIKTE 970
            ++IFF++E G+LK+ +DLPQG VYE++S R CYG ++  G  P SE+       + IKTE
Sbjct: 928  SDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSES------KVTIKTE 981

Query: 971  ADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020
             + V+W+IDSS L ++K EN+ LY EL+LL+ T+K+ R++ +LG+ LVS 
Sbjct: 982  TEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/1026 (55%), Positives = 711/1026 (69%), Gaps = 65/1026 (6%)

Query: 44   NSKSNYLSRSYMYGLLPSATPVEELETNT---LPLSNDLRNKSIHQSRILHKQTAAICED 100
            NS + YL RSY+      +    E   +T   L L  D  +KSIH+S  LH+QTAA+  +
Sbjct: 41   NSSNYYLGRSYVGSFSSPSFLQRESSADTGHILSLHKD-ASKSIHESVKLHRQTAALSNN 99

Query: 101  FNESDEGSMKDYLDFIENTDRDNINEHKE-------------SLPVTVVLSTPADEVEEQ 147
            F++S +G   D +D   + +  N    +E             +      ++   D + ++
Sbjct: 100  FDDSSDGK-SDEIDVAASQEFQNEALQRELSLENGSYSNSNNNNNNNNQIAYSEDAITQE 158

Query: 148  D----ESSRLLLTPSSSNA---EVSSIAEGL--------RHHYSSIESTKDNNMPIEEQQ 192
            +    E +RLL +P+S+ A   E  +    L        +  Y S+ +    +  + +Q 
Sbjct: 159  NNGLNECTRLL-SPTSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQA 217

Query: 193  DNTINEKLSTF----------FYN--------TLQYFPASVLGLLLNILDALSYGMIIFP 234
                +   +T+          +Y+        TL Y PA +LGLLLN+LDALSYGMIIFP
Sbjct: 218  TGDGDNAFNTYHSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFP 277

Query: 235  ISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRS 294
            I+EP+FSHLGPTG+SMFY+STI+ Q +YS G+S+F + IGSEMIEITPFFHTMA +IM S
Sbjct: 278  ITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNS 337

Query: 295  LPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFL 354
            LPG +  D II+TTI CY +SS+                IVGFFPRHILIGC+GGVGYFL
Sbjct: 338  LPGHD--DEIISTTIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFL 395

Query: 355  LITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSF 414
            LITGIEV TR++KFEYS P ++ELF +T +L KW             Q  F  SLVLPSF
Sbjct: 396  LITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSF 455

Query: 415  YIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQI 474
            YI TL LFHF+VAI+P LSL  LRE+GWIF     ++ WYD YKL+DF  VHW LV KQ+
Sbjct: 456  YIITLALFHFVVAIVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQV 515

Query: 475  PTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTN 534
            PTMLALTFFGILHVPINVPALAMS+ MDK+DVDKELIAHG SNL+SG  GSIQNYLVYTN
Sbjct: 516  PTMLALTFFGILHVPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTN 575

Query: 535  SVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDT 594
            S LFIRAG+DS +AG+LL   T VVM+IGPVIISFIPICIVGSLIF            DT
Sbjct: 576  SFLFIRAGSDSSWAGFLLALGTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDT 635

Query: 595  WDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKS 654
            W KL  FEY+T+V+IV TMG+ DFVLGIIVGILIACF FL+DS+KLQTINGEF+G+VA+S
Sbjct: 636  WGKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARS 695

Query: 655  TVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLI 714
            TV RD IQ+KFLN +G+QI+VLKLQNLLFFGTIISIEEKID LLE+SD++SS+++IKYLI
Sbjct: 696  TVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLI 755

Query: 715  LDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELF 774
            LDF+NINADNIDYSAAEGFNRIKR TE+K IQLIISSI  +DRIYN+FNKVGLL  VELF
Sbjct: 756  LDFKNINADNIDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELF 815

Query: 775  NDLNGALEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIY 834
             DLN ALEWCENEFL QYK IR R K K    A    + +LSK     L INTPRN QI 
Sbjct: 816  ADLNSALEWCENEFLLQYKQIRTRTKAK--LQAQKKQEKHLSKS---LLPINTPRNNQIV 870

Query: 835  SVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQL 894
            +VAQ IF  +EQ V  L+ ++Q + PVLPLLL ALK++RP I+S DK  K  E +FWS+L
Sbjct: 871  TVAQKIFP-DEQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKL 929

Query: 895  APYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPV 954
             PYF +KR A  S+L H NN+FFLVE G+LK+T+DL QG+ YETMS + CYG+I G    
Sbjct: 930  CPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRISGN--- 986

Query: 955  SEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLG 1014
              A+  ++  + IKTE D  +WIID++ L  +K++N+ LY EL+L+VM+I   R K LLG
Sbjct: 987  --AEFTTNLYVNIKTETDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLG 1044

Query: 1015 HALVST 1020
            ++LVS+
Sbjct: 1045 YSLVSS 1050

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/1018 (55%), Positives = 696/1018 (68%), Gaps = 52/1018 (5%)

Query: 38   TDNELSNSKSNYLSRSYMYGLLPSATPVEELETNT----LPLSNDLRNKSIHQSRILHKQ 93
            T + +SN +   + RSY  G + S +P   L T+     LP+   + +KSI     LH+Q
Sbjct: 57   TTSSVSNREFGRIGRSYA-GSISSNSPSLYLNTSRTDELLPI-RKMPSKSILGPDALHRQ 114

Query: 94   TAAICEDFNES--DEGSMKDYLDFIENTDRDNINEHKESL----PVTVV-----LSTPAD 142
            TA I  DFN++  DE  +K Y++ +     +   E +ES     P T +     LS    
Sbjct: 115  TAEISNDFNDTSMDEAKIKRYIELLNRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPIGS 174

Query: 143  EVEEQDE-SSRLLLTPSSS----NAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTIN 197
               + D    R LLTPSSS      ++ S  + + + Y+SI         +  Q     +
Sbjct: 175  SASQLDGLEQRALLTPSSSIVGNEFDLESTYDEINNDYNSI---------LRIQSRELTS 225

Query: 198  EKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTII 257
               +T     L Y PA++LGLLLNILDALSYGMIIFPI+EP+FS LGPTG+SMFYISTI+
Sbjct: 226  SSFATKGLELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIV 285

Query: 258  CQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSM 317
            CQ + S G+SSFP  IGSEMIEITPF+HTMAFAI  +LP ++N+  +ITTTIFCYVISS+
Sbjct: 286  CQLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDALPNQDNE--VITTTIFCYVISSV 343

Query: 318  XXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKE 377
                            IVGFFPRHILIGCIGGVGYFL+ITGIEV+TRI KFEY+   +  
Sbjct: 344  VTGLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLS 403

Query: 378  LFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQL 437
            L T+   L KW             Q+  + SLVLPSFYI T+ILFHFIVAI+P LSL  L
Sbjct: 404  LLTNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHL 463

Query: 438  REAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAM 497
            RE GWIF  T   ++WYDHYK F+ H +HW LV KQIPTMLALTFFGILHVPINVPALAM
Sbjct: 464  RENGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAM 523

Query: 498  SVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
            S+ MDKYDVD+ELIAHG SNL+SG+ GS+QNYLVYTNSVLFIRAGADS  AG+LL+ LT+
Sbjct: 524  SLHMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTV 583

Query: 558  VVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVD 617
            VVM+ G VI+SFIP+CIVGSLIF            DT   +T+FEY+T+++IV  MGI D
Sbjct: 584  VVMVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYD 643

Query: 618  FVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLK 677
            FVLGIIVGILIAC  F++D +KL+TINGE+ G+VAKSTV RD IQ+KFLNGI  QIY+LK
Sbjct: 644  FVLGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLK 703

Query: 678  LQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIK 737
            LQN+LFFGTIISIEEKIDKLLE+SD++ SKR+IKYLILDF+NINADNIDYSAAEGFNRIK
Sbjct: 704  LQNVLFFGTIISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIK 763

Query: 738  RLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRE 797
            R T+ K IQLIISSIK +D+IY+ FN V LL  VELF+DLN ALEWCENEFLYQY  + E
Sbjct: 764  RFTQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHE 823

Query: 798  --------RIKIKNVKTATH----SSDGNLSKPSA---MTLSINTPRNYQIYSVAQNIFK 842
                    RI I     +T+     SD  LS       M+L INTPRN Q+ SVA+ +FK
Sbjct: 824  KAKDRIHKRISISKDSGSTYFSRNRSDSGLSAADQQMLMSLPINTPRNNQVLSVARKVFK 883

Query: 843  NEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKR 902
            NE QT  + K   +   PVL LLL++++ +RPD+ S D   + KEI FW QL+PYF +  
Sbjct: 884  NEAQTASKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSL 943

Query: 903  IASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAPSS 962
              + S L + +N FF+VE GV++VT DLPQG V ETMS R CYGK++G          + 
Sbjct: 944  FPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGH----RGTVTNL 999

Query: 963  QAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020
              +I KTE +++IW+ID   + ++K EN+ LY EL+LLVMTI++ R+K L+G+ LVS 
Sbjct: 1000 PKIIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/989 (54%), Positives = 685/989 (69%), Gaps = 29/989 (2%)

Query: 40   NELSNSKSNYLSRSYMYGLLPSATPVEE-LETNTLPLSNDLRNKSIHQSRILHKQTAAIC 98
            N    S   YL RSY+  L P    ++E    +    S   +++SIHQS  L +QTAA+ 
Sbjct: 43   NGADGSPHYYLGRSYVANLSPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALS 102

Query: 99   EDFNESDEGSMKDYL-DFIENTDRDNINEH-KESLPVTVVLSTPADEVEEQDESSRLLLT 156
             +F+ + E   +D L D  EN +    +E       ++   S P   V +  + S LLL 
Sbjct: 103  NEFDGTFE--FEDQLEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLP 160

Query: 157  PSSS-NAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASV 215
            P++  + E  SI E   H Y S++S +  +       + ++ +K    F     Y PA +
Sbjct: 161  PNTQRDLEYGSIDE-FDHQYVSLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVI 219

Query: 216  LGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGS 275
            LGLLLNILDALSYGMIIFPI+EP+FSHLGP+G+SMFY+S+++ Q +YS G+S+F + +GS
Sbjct: 220  LGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGS 279

Query: 276  EMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIV 335
            EMIEITPF+H+MA +IM S+PGE  +D ++TTTI CY +SS+                IV
Sbjct: 280  EMIEITPFYHSMAASIMASMPGE--KDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIV 337

Query: 336  GFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXX 395
            GFFPRHILIGCIGGVGYFL+ITG EVTTR +KFEYS   +  L TD  +L KW       
Sbjct: 338  GFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMA 397

Query: 396  XXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYD 455
                  Q+  K SLVLP+FYIA L+LFHFIVA+IP LSL  LR++GW+F  T     W+D
Sbjct: 398  VLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFD 457

Query: 456  HYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGL 515
             YKL++F  V W LV KQ+PTMLALTFFGILHVPINVPALAMS+ +DK DVDKELIAHG 
Sbjct: 458  FYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGY 517

Query: 516  SNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIV 575
            SN +SGM GS+QNYLVYTNS+LFI+AGAD   AG +L   T  +M+IGPVI+++IP+CIV
Sbjct: 518  SNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIV 577

Query: 576  GSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLI 635
            GSLIF            DTW KL  FEY TVV IV TMG  DFVLGIIVGILIACF FL+
Sbjct: 578  GSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLV 637

Query: 636  DSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKID 695
            DS+KLQTINGEF G+VA+STV RD IQ++FLN IG+QI+VLKLQNLLFFGTIISIEEKID
Sbjct: 638  DSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKID 697

Query: 696  KLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVR 755
            KLLE+SD+++SK++IKYLILDF+NINADNIDYSAAEGFNRIKR T SK I LIISSIK  
Sbjct: 698  KLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTT 757

Query: 756  DRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNL 815
            DRIY +FNKVG L GVELF+DLN ALEWCENEFL Q++ +R + K+K V+      +  L
Sbjct: 758  DRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLKAVR----KQERQL 813

Query: 816  SKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPD 875
            SK +   L  NTPRN    SVAQ +F  +EQ++  LK  ++++TPVL LLL AL++YRP+
Sbjct: 814  SKGA---LPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPE 869

Query: 876  IVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKV 935
            I+S +K  K  E + WS+L  +F K+R+A+QS+L H NNIF +VE G++KVT++L QG++
Sbjct: 870  IMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQL 929

Query: 936  YETMSKRACYGKIMG----KIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENI 991
            YE +S + CYG+I      ++P+S  +        IK E D  +WI+D + L K+K EN+
Sbjct: 930  YEILSGKTCYGRITAPNSSEVPISSVE--------IKMETDCALWILDEANLAKLKKENL 981

Query: 992  ELYLELVLLVMTIKDIRFKSLLGHALVST 1020
             LY EL+L+ + +   R K LLGH LVS+
Sbjct: 982  ALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/988 (54%), Positives = 684/988 (69%), Gaps = 34/988 (3%)

Query: 44   NSKSNYLSRSYMYGLLPSATPVEELE---TNTLPLS-NDLRNKSIHQSRILHKQTAAICE 99
             S   YL RSY+  L P   P+  L       LPLS    +++SIHQS  L +QTAA+  
Sbjct: 47   GSPHYYLGRSYVANLSPP--PLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSN 104

Query: 100  DFNESDEGSMKDYLDFIENTDRDNINEHKESL------PVTVVLSTPADEVEEQDESSRL 153
            +F ++ E   +D L  +   D  +    + S+      PV+ V  TP D     +E S  
Sbjct: 105  EFEDTFE--FEDQLAGVSEDDGHSTTAEEPSMNGTLISPVSSVPDTPID----INEPSNA 158

Query: 154  LLTPSSS-NAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFP 212
            LL P++  + E  SI +G  H Y S++S +          D ++ EK+       + Y P
Sbjct: 159  LLPPNAEHDLEYGSI-DGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMP 217

Query: 213  ASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSC 272
            A +LGLLLNILDALSYGMIIFPI+EP+FSHLGPTGMSMFY+S+II Q IYS G+S+F + 
Sbjct: 218  AVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNA 277

Query: 273  IGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXX 332
            +GSEMIEITPF+H MA +I+  LPGE  +D +++TTI CY +SS+               
Sbjct: 278  VGSEMIEITPFYHAMAASIVAGLPGE--KDRVLSTTIVCYALSSIITGLVFFLLGRLRLG 335

Query: 333  XIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXX 392
             IVGFFPRHILIGCIGGVGYFLLITG+EVTTR+AKFEYS   +  LFT+  +L KW    
Sbjct: 336  KIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPA 395

Query: 393  XXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSA 452
                     Q  F  SLVLP+FYIA L+LFHFIVA+IP LSL  LR++GWIF  T     
Sbjct: 396  LMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEH 455

Query: 453  WYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIA 512
            W+D Y L++F  V W ++ KQIPTMLALTFFGILHVPINVPALAMS+ +DK DVDKELIA
Sbjct: 456  WFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIA 515

Query: 513  HGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPI 572
            HG SN +SG+ GS+QNYLVYTNSVLFIRAG D   AG +L   T  +M++GPVI+++IP+
Sbjct: 516  HGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPV 575

Query: 573  CIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFK 632
            CIVGSLIF            DTW KL  FEY TVV IV TMG  DFVLGIIVGILIACF 
Sbjct: 576  CIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFS 635

Query: 633  FLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEE 692
            FL+DS+KLQT+NGEF G+VA+STV+RD IQ++FLN IG+QI+VLKLQNLLFFGTI+SIEE
Sbjct: 636  FLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEE 695

Query: 693  KIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSI 752
            KIDKLLE+SD++SSK++IKYLILDF+NINADNIDYSAAEGFNRIKR T SK I LIISSI
Sbjct: 696  KIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSI 755

Query: 753  KVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIKNVKTATHSSD 812
            K  DRIY +FNKVG+L GVELF+DLN ALEWCENEFL Q+K +R + K+K    A    D
Sbjct: 756  KTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLK----AGKKQD 811

Query: 813  GNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQY 872
              +SK   + L  NTPRN Q  SVAQ +F  +EQ++  LK+ ++++ PVLPLLL AL+++
Sbjct: 812  RRMSK---VPLPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRF 867

Query: 873  RPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQ 932
            RP I+S DK  K  E   WS L  YF KKR+A+ S+L H +NIFF++E G++KVT++L Q
Sbjct: 868  RPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQ 927

Query: 933  GKVYETMSKRACYGKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIE 992
            G++YETMS + CYG++     +   +      + ++ E D  +WIID + L K+K EN+ 
Sbjct: 928  GQLYETMSGKTCYGRMS----IPNNNNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLN 983

Query: 993  LYLELVLLVMTIKDIRFKSLLGHALVST 1020
            LY E++L+ + I   R K LLGH LVS+
Sbjct: 984  LYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/914 (58%), Positives = 649/914 (71%), Gaps = 38/914 (4%)

Query: 135  VVLSTPADEVEE----QDESSRLLLTPS-------------SSNAEVSSIAEGLRHHYSS 177
            +V   P  E++E     DE SRLL TPS             SSN   S+  E   +  SS
Sbjct: 245  IVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSS 304

Query: 178  IESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISE 237
            I +T D    + +    +  + L+      L   PA +LGLLLNILDALSYGMI+FPI++
Sbjct: 305  IPTTTD----VTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITD 360

Query: 238  PIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPG 297
             +F HLGPTG+SMFYISTII Q +YS G+S+FPS +G EMIEI PFFHTMA  +  S+P 
Sbjct: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420

Query: 298  EENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVGYFLLIT 357
            ++ Q+ IITTTIFCYVIS +                +VGFFPRHILIGCIGGVGYFL++T
Sbjct: 421  KD-QNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVT 479

Query: 358  GIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVLPSFYIA 417
            GIEVTTR+ K EYSL  +  + T+ S L+K              QK +  SL+LPSFYI 
Sbjct: 480  GIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYII 539

Query: 418  TLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTM 477
            T I FHFIVA++P LSL  LR  GWIF     +  WY HYK F+F   HW LVFKQIPTM
Sbjct: 540  TFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTM 599

Query: 478  LALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVL 537
             ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHG SNL+SG+FGS+QNYLVYTNSVL
Sbjct: 600  FALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVL 659

Query: 538  FIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDK 597
            FIRAG ++  AG +L   T +++ IGPVIISFIP+CIVGSLIF            DTW K
Sbjct: 660  FIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGK 719

Query: 598  LTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVN 657
            +T FEY+T+++IV TMGI DFVLGI+VGILIACF FL+DS+KLQT+NGEF+G VAKSTV 
Sbjct: 720  VTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVY 779

Query: 658  RDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDF 717
            RD +QS+FL+GI +QIYVLKLQN+LFFGTIISIEEKID LLE+SD +SSKR+IKYLILD 
Sbjct: 780  RDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDL 839

Query: 718  RNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDL 777
            +N+N+DNIDYSAAEGFNRIKR T+SK IQLIISSIK  D+IY  FN V LL  VELF+DL
Sbjct: 840  KNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDL 899

Query: 778  NGALEWCENEFLYQYKMIRE------------RIKIKNVKTATHSSDGNLSKPSAMTLSI 825
            NGALEWCENEFLYQY+ ++             R  ++    +T  S+    + S+  L I
Sbjct: 900  NGALEWCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGNLPI 959

Query: 826  NTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKG 885
            NTPRN+Q+ SVA+NIF+N EQ V           PVL LL+FALKQYR DI S D   + 
Sbjct: 960  NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRD 1019

Query: 886  KEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACY 945
            KE+EFWSQL PYF+K+ +A+++ L H NN+FF+VE GVLK+ F+LPQG VYETMS R CY
Sbjct: 1020 KEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCY 1079

Query: 946  GKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIK 1005
            G+I+GK  + ++ +P    + IK E D +IW+I+S  L KMK EN+ELY EL LLVM++K
Sbjct: 1080 GRILGKGYLKKSTSP----LNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVK 1135

Query: 1006 DIRFKSLLGHALVS 1019
            D RF +LLG+AL+S
Sbjct: 1136 DDRFNNLLGYALIS 1149

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 11/63 (17%)

Query: 73  LPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTDRDNINEHKESLP 132
           LP+ N     SIH S  LHK+TA I  +FN S             +T+ DN N    ++P
Sbjct: 122 LPVINPFPKSSIHGSDNLHKRTAEISNEFNNSP-----------TDTEDDNANTETPNIP 170

Query: 133 VTV 135
            T 
Sbjct: 171 STA 173

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/984 (54%), Positives = 680/984 (69%), Gaps = 64/984 (6%)

Query: 74   PLSNDLRNKSIHQSRILHKQTAAICEDFNESD--EGSMKDYLDFIENTDRDNINEHKESL 131
            P  N    KSI  + ILH+QTA + + F +S+  +  +KDY+D I+N D    NE   + 
Sbjct: 91   PPENKTSMKSITVADILHRQTAELSKTFYDSNFTDKDVKDYIDIIDN-DVATSNESDSN- 148

Query: 132  PVTVVLSTP----ADEVEEQ--------------DESSRLLLTPSSS--NAEVSSIAEGL 171
                  STP     DE ++               DE SRLL TPSSS   AE+      L
Sbjct: 149  ------STPEPYLGDEYDQHRLAIRTQKSPNIADDEQSRLL-TPSSSIIGAELD-----L 196

Query: 172  RHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMI 231
              HY   E  + +   I  Q ++ + +     F   L YFPA+VLGLLLNILDALSYGMI
Sbjct: 197  EAHYDEFEPVRMDASSINRQNESKLID-----FSQILHYFPAAVLGLLLNILDALSYGMI 251

Query: 232  IFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAI 291
            IFPI+EPIF+++G  G+SMFYIS+IICQ+I S G+SSFP+ IGSEMIEITPF+HTMA AI
Sbjct: 252  IFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAI 311

Query: 292  MRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPRHILIGCIGGVG 351
              SL   + Q+ II+TTIFCYVISS+                IV FFPRHILIGCIGGVG
Sbjct: 312  KNSL---DVQEEIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVG 368

Query: 352  YFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXXXQKCFKRSLVL 411
            YFL++TG+EVTTR+AK EYS   +  L +D +++ KW             Q  F+ SLVL
Sbjct: 369  YFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVL 428

Query: 412  PSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVF 471
            PSFYI T+ILFHFIVA++P LSL +LR++GWIF  T  N  W+DHYK F+ + V W+L+ 
Sbjct: 429  PSFYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLIL 488

Query: 472  KQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLV 531
            KQ+PTMLALTFFGILHVPINVPALAMS+ +DK+DVD+E IAHG SN +SG+FGS+QNYLV
Sbjct: 489  KQMPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLV 548

Query: 532  YTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXX 591
            YTNSVLFIRAGADSP AGYLLI LT +VMLIGPVIISFIPICIVGSLIF           
Sbjct: 549  YTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEAL 608

Query: 592  XDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKV 651
             DT  K+T FEY T+++IV TMGI DFVLGIIVGIL+AC KF++D +KLQTIN E+ G +
Sbjct: 609  LDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTI 668

Query: 652  AKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIK 711
            AKSTV RD IQSKFL+GIG+QIY++KLQN+LFFGTIISIEEKID LL++SD +SSK +I+
Sbjct: 669  AKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIR 728

Query: 712  YLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGV 771
            YLILDF+NIN DNIDYSAAEGFNRIKR T  ++I+LIISSI   D+IY +FNK+GLL  +
Sbjct: 729  YLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDI 788

Query: 772  ELFNDLNGALEWCENEFLYQYKMIRERIK--------------IKNVKTATHSSDGNLSK 817
            ELF+DLN  LEWCEN++L +Y+ + E+ K              I + +  + SSDGN  +
Sbjct: 789  ELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQ 848

Query: 818  PSA--MTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPD 875
             S   M+L +NTPRN+Q+ SVA+N+FKNE Q V R KN    +     LLL +++++RPD
Sbjct: 849  SSQRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPD 908

Query: 876  IVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKV 935
            + S  K  + +EI+FW+QLAPYF+K  + + S   + NN FFL++ GV+KVT DL  GK+
Sbjct: 909  VFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKL 968

Query: 936  YETMSKRACYGKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYL 995
             ETM  R  YG +  K          +  +    E  +VIW+IDS  LKKM+ EN++LY 
Sbjct: 969  SETMLSRTSYGILSSK----NNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYS 1024

Query: 996  ELVLLVMTIKDIRFKSLLGHALVS 1019
            EL LL+M+I D RFK+LLG+ LV+
Sbjct: 1025 ELTLLIMSISDYRFKALLGYTLVN 1048

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/919 (53%), Positives = 620/919 (67%), Gaps = 40/919 (4%)

Query: 101  FNESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSS 160
            F   D+ S  D  D  EN      N H     + V   T  +E +   +   LL   +SS
Sbjct: 181  FPGKDDSSFLDVSDSTENLALLPTNSHNS---MYVEYGTFDEENQPATQYISLLPDGASS 237

Query: 161  NAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLL 220
                S   +G R   S  +  +D  + I                    QY PA  LGLLL
Sbjct: 238  GGFTS---QGFRSSMSHYDKARDLMLRI-------------------FQYTPAVGLGLLL 275

Query: 221  NILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEI 280
            NILDALSYGMIIFPI+EP+FSHLGPTG+SMFY+ST+ICQ  +S G SSFPS IGSEMIEI
Sbjct: 276  NILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEI 335

Query: 281  TPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXXXXXXXXIVGFFPR 340
            TPFFHTMA +IM S+P E N + +I+TTI CY +SS+                IVGFFPR
Sbjct: 336  TPFFHTMALSIMNSIP-EGNDNKVISTTIVCYALSSIITGLTFFLLGKMRLGKIVGFFPR 394

Query: 341  HILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWXXXXXXXXXXXX 400
            HILIGCIGGVGYFL+ITG+EV TR+ +F+YS   +  LFTD  +L KW            
Sbjct: 395  HILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVILTLILIS 454

Query: 401  XQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLF 460
             Q     SLVLPSFYI TL+LFHF+VA++P LSL +LR+ GWIF+       WYD YKL+
Sbjct: 455  VQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLY 514

Query: 461  DFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVS 520
            DF  V W L+ KQ+PTMLALTFFGILHVPINVPALAMS+ +DKYDVDKELIAHG SNL+S
Sbjct: 515  DFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVDKYDVDKELIAHGYSNLIS 574

Query: 521  GMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIF 580
            G  GSIQNYLVYTNSVLFIRAGADSP AG +L   T +VM+IGPVIISFIPICIVGSLIF
Sbjct: 575  GFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIF 634

Query: 581  XXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKL 640
                        DTW KL  FEY+T+ +IV+TMG+VDFV+GIIVGIL+ACF FL++S++L
Sbjct: 635  LLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNSTQL 694

Query: 641  QTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEM 700
            QTINGE+ GKVAKSTV RD IQSKFL  IG+QIYVLKLQN+LFFGTIISIEEK++ LLE+
Sbjct: 695  QTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLLEI 754

Query: 701  SDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYN 760
             + +SSK++IKYLILDF+NI A +IDYSAAEGFNRIKR  E + I LIISSI   D+IY 
Sbjct: 755  CESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKERIHLIISSIDKEDQIYL 814

Query: 761  SFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSA 820
            +F+KV L   VELF+DLNGALEWCENEFL +YK IR + + + +     S +  +SK   
Sbjct: 815  AFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRARKLAQLKKSQN-RMSK--- 870

Query: 821  MTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVD 880
              L +NTPRN+Q  S  +NI+  EE  + +L N  +++   LP+ L +++++R  I S +
Sbjct: 871  --LPVNTPRNHQFVSEVRNIY-TEEMEIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPN 927

Query: 881  KVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMS 940
            ++K+  E++ W +L  YF +K+    + + H NN+F +VE GVL +T  L QG+ YETMS
Sbjct: 928  ELKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMS 987

Query: 941  KRACYGKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLL 1000
             +  YG I      S  ++    A+ I T+ + V+  ID+ +L  +K  + EL+ EL++L
Sbjct: 988  PKTAYGVI------SNVNS-DPLAVSITTDTECVLRYIDAESLADLKLTDPELFTELLIL 1040

Query: 1001 VMTIKDIRFKSLLGHALVS 1019
            VM I   RF+ LLG++L+S
Sbjct: 1041 VMAIHRDRFRELLGYSLIS 1059

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/992 (48%), Positives = 631/992 (63%), Gaps = 51/992 (5%)

Query: 49   YLSRSYMYG------LLPSATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFN 102
            YL RSY+        L+         ++  LP   D  +  +H    LH+QTAA+C+D  
Sbjct: 53   YLGRSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSR 112

Query: 103  ESDEGSMKDYLDFIENT--------DRDNINEH---KESLPVTVVLSTPADEVE----EQ 147
              D G  ++     E           R  +  +   K    ++ VL    + V+    +Q
Sbjct: 113  AYDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQ 172

Query: 148  DESSRLLLTPSSSNAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNT 207
            +  +RL L+P         I     H Y +I   ++ +      +  T    L  +   T
Sbjct: 173  EAGTRLFLSP---------ITTDYIHSYGAI--NEEQSASETASRAETGPSPLRLWGTRT 221

Query: 208  LQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWS 267
            ++Y PA +LGLLLNILDALSYGMIIFPI+EPIFSHLGP G+SMFY+STII Q +YS G+S
Sbjct: 222  VRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFS 281

Query: 268  SFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMXXXXXXXXXX 327
            SF    GSEMIE+TPFFHTMA +I  SL  E++ D IITTTI CY +S++          
Sbjct: 282  SFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDD-IITTTIVCYALSTIITGAVFLTLG 340

Query: 328  XXXXXXIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWK 387
                  +V FFP HILIGCIGGV YFL+ITGIEV+TR+ KFEYSL  ++ LF D  +L K
Sbjct: 341  KLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAK 400

Query: 388  WXXXXXXXXXXXXXQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNT 447
            W             Q+    S++LP FY++   LFHFIVA+IP LSL  LR+ GWIF  T
Sbjct: 401  WLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLT 460

Query: 448  APNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVD 507
                 WYD+ +L++  ++HW LV  +IPTMLALTFFGILHVPINVPALA+S  +DK DVD
Sbjct: 461  ESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVD 520

Query: 508  KELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVII 567
            KELIAHG SN+ SG  GSIQNYLVYTNSVLFIRAGADS +AG+LL   T + M  GP II
Sbjct: 521  KELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWII 580

Query: 568  SFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGIL 627
            S IP+CIV SLIF            D++++L+ FEY+TVV+I+LTMGI DFVLGIIVG+L
Sbjct: 581  SIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVL 640

Query: 628  IACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTI 687
            +ACF FL++S++ +TI+ EF GKVAKS  +RD +QS FL  + +QIYVLKLQN LFFGTI
Sbjct: 641  VACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTI 700

Query: 688  ISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQL 747
            ISIEEKI  LLE  + +  K+ IKYLILDF++IN DNIDYSAAEGFNRIKR+ E K I+L
Sbjct: 701  ISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKL 759

Query: 748  IISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIKNVKTA 807
            I+SSI   D+IY  F+K+GLL  VELF DLN ALEWCENE L +Y+ +  R     VK  
Sbjct: 760  IVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSR--AHRVKVR 817

Query: 808  THSSDGNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLF 867
              S D     P A     NTPRN QI + AQ ++  E+Q +++  ++++   P L LLL 
Sbjct: 818  RRSKD---IVPKAQIPLENTPRNAQIMTAAQAVYSGEQQ-LNKTLSKYKASHPALALLLV 873

Query: 868  ALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVT 927
            ALK YR    S    K+ KEI  W  L PYF +K  + Q+ +    ++FF+VE G+LK+T
Sbjct: 874  ALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKIT 929

Query: 928  FDLPQGKVYETMSKRACYGKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMK 987
            + LPQG + E ++ + CYG I G   +S +        +++TE + V+W+ID+  L+K++
Sbjct: 930  YMLPQGSLQEAIASKTCYGNISGPGSLSYSS-------VVRTETECVLWMIDAPGLQKLQ 982

Query: 988  DENIELYLELVLLVMTIKDIRFKSLLGHALVS 1019
            +EN+ LY EL+++ +++   RFK LLGH+L++
Sbjct: 983  EENLPLYTELLVVYISVIQHRFKELLGHSLIN 1014

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 130/288 (45%), Gaps = 27/288 (9%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  N+V  +FG++ ++  Y  S +   +GA S  +G  +  +T++ M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           + +IP C++  +              D    L    Y  + V  +T G V  +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFG-VTILCSIEAGI 516

Query: 627 LIACFKFLID------SSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQ-------- 672
            I C   +++       S++Q +    +G    + ++ D +++   N +G +        
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQIL-ARVAGTSNFTNLD-DYLRTMKKNPLGGENRLEEVEG 574

Query: 673 IYVLKLQNLLFFGTIISIEEKIDKLLEMSD------RNS--SKRQIKYLILDFRNINADN 724
             ++++   L F     +++++D++           R S  SK  IKY+I D   + +  
Sbjct: 575 CMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS-- 632

Query: 725 IDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772
           ID SAA+  + I    + +N+ + ++++ + D+I     K G++  +E
Sbjct: 633 IDSSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 129/287 (44%), Gaps = 26/287 (9%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  N+V  +FG++ ++  Y  S +   +GA S  +G  +  +T++ M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           + +IP C++  +              D    L    Y  + V  +T G+  F   I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIF-YSIEAGI 516

Query: 627 LIACFKFLID------SSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIG-------DQI 673
            I C   +++       S++Q +    +G    + ++  L+  K  N +        +  
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQIL-ARVAGTSNFTNLDDYLMNMK-RNPLSIENTEEIEGC 574

Query: 674 YVLKLQNLLFFGTIISIEEKIDKLLEMSD------RNS--SKRQIKYLILDFRNINADNI 725
            ++++   L F     +++++D++           R S  SK  IKY+I D   + +  +
Sbjct: 575 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--L 632

Query: 726 DYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772
           D SAA+  + I    + +N+ + ++++ + D+I    +K G++  VE
Sbjct: 633 DSSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/357 (21%), Positives = 140/357 (39%), Gaps = 54/357 (15%)

Query: 443 IFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQI-PTMLALTFFGILHVPINVPALAMSVQM 501
           I  +  PNS   DH K+     V     FK++  T   +   G+    I   ++  +  +
Sbjct: 215 IIGDIPPNS---DHIKV----PVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNV 267

Query: 502 DKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVML 561
           D    ++EL++ G+ NLVS +F ++  +  Y  S + I  GA + F+G  +  L I+ M 
Sbjct: 268 DASS-NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMN 326

Query: 562 IGPVIISFIPICIVGSLIFXXXXXXXXXXXXDT---WDKLTTFEYVTVVVIVLTMGIVDF 618
                   +PICI+  +I             D    W      E    ++IV+T  +   
Sbjct: 327 FLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSP 386

Query: 619 VLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQ------ 672
             G+ +G+ +   + L  S++ +              + RD I   F N   D+      
Sbjct: 387 QFGVTMGMCLTMIRLLKHSTRSRV-----------QILGRDPITYTFKNIDDDENSDIPL 435

Query: 673 -----IYVLKLQNLLFFGTIISIEEKIDKLLE-----------------MSDRNSSKRQI 710
                + V+K+   L F  +  +   + ++ +                 +S   S +  +
Sbjct: 436 EEIEKVMVVKIPEPLIFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSL 495

Query: 711 KYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGL 767
           KYL++D   +    ID SA +    I      +NI ++ +  K+ D + + F K G+
Sbjct: 496 KYLVIDLFGMT--YIDISALQALREIVDAYSRRNICVMFTRPKIPD-LRHKFRKSGI 549

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 128/287 (44%), Gaps = 25/287 (8%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  N+   +FG++ ++  Y  S +   +GA S  +G  +  +T++ M +    
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           + +IP C++  +              D    L    Y  + V  +T G+  F   I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIF-YSIESGI 516

Query: 627 LIACFKFLID------SSKLQTINGEFSGKVAKSTVNRDLIQSK----FLNGIGDQI--- 673
            I C   +++       S++Q I    +G    + ++  L  +K     + G  ++I   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQ-ILARIAGTSNFTNLDDYLRTTKKNPPAVEGRIEEIEGC 575

Query: 674 YVLKLQNLLFFGTIISIEEKIDKLLEMSD------RNS--SKRQIKYLILDFRNINADNI 725
            ++++   L F     +++++D++           R S  SK  IKY+I D   + +  I
Sbjct: 576 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--I 633

Query: 726 DYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772
           D SAA+  + I    + +N+ + ++++ + D+I     K G+   VE
Sbjct: 634 DSSAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVE 680

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 121/310 (39%), Gaps = 50/310 (16%)

Query: 494 ALAMSVQMDKYDVD----KELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAG 549
           A A     +K+D+D    +EL++ GL N+VS +F ++  +  Y  S L I   A +P AG
Sbjct: 333 ATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAG 392

Query: 550 YLLIFLTIVVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDT---WDKLTTFEYVTV 606
            ++    I  M        ++P+C++  +I             D    W      E +T 
Sbjct: 393 IVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTF 452

Query: 607 VVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFL 666
           V +V+T  +     G+ +G+ +   + L  +++ +              + RD +  KF 
Sbjct: 453 VAVVVTTLVWSPQFGVSIGVGLTMIRLLKHTTQSRV-----------QILGRDPVTKKFQ 501

Query: 667 NGIGDQ-----------IYVLKLQNLLFFGTIISIEEKIDKL------------------ 697
           N   +Q             V+K+   L F  +  +++++ +L                  
Sbjct: 502 NIYAEQSEQIPLEEIEKTMVIKIPEPLIFSNVSDLKKRLSRLEKYGSLKVHPSYPTPLRP 561

Query: 698 LEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDR 757
           +  S  + S+  I Y+I D   +    ID SA +    +      +   ++ +   + D 
Sbjct: 562 VSASAGSQSESYISYVIFDL--LGMTYIDMSALQALTEMVVNYHKRGTFVLFARPSIHD- 618

Query: 758 IYNSFNKVGL 767
           + N  NK G+
Sbjct: 619 LKNKLNKSGI 628

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 69/341 (20%), Positives = 137/341 (40%), Gaps = 51/341 (14%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++ELIA G  N+V  MF  +  +  Y  S +   +GA +  +G+ +  +T+  +     I
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I +IP+CI+  +              D         Y  + V  +T+ +      +  GI
Sbjct: 437 IRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTL-LATLFYSLEAGI 495

Query: 627 LIACFKFLID------SSKLQTINGEFSGKVAKSTVNRDLIQSK----FLNGIGDQI--- 673
            I C   +I+       S++Q I G   G   ++ +N D  Q+     F+N   ++I   
Sbjct: 496 YIGCACSIINVIKHSAKSRIQ-ILGRVPG--TETFINADDYQANAAGYFINPQIEEIEGF 552

Query: 674 YVLKLQNLLFFGTIISIEEKIDKLLE--------MSDRNSSKRQIKYLILDFRNINADNI 725
            ++K+   L F     ++ ++ +L +         + R+  K   + +I D + +   +I
Sbjct: 553 LIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--HI 610

Query: 726 DYSAAEGFNRIKRLTESKNIQLIISSI----KVRDRIYNSFNKVGLLVGVELFNDLNGAL 781
           D SAA+    I      +++ + ++++    KVR+R+  S                 G  
Sbjct: 611 DSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKVRERLVTS-----------------GVA 653

Query: 782 EWCENEFLYQ---YKMIRERIKIKNVKTATHSSDGNLSKPS 819
           E CE   +     +  I + +   +V    H+   +   PS
Sbjct: 654 ELCERNTITNSSYFSTIEDALTAADVIAQRHNQQYHTPPPS 694

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 119/300 (39%), Gaps = 50/300 (16%)

Query: 504 YDVD----KELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVV 559
           +D+D    +EL++ GL N+V  +F S+  +  Y  S L I  GA +P AG  +    I  
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 560 MLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDT---WDKLTTFEYVTVVVIVLTMGIV 616
           M     +  ++P+CI+  +I             D    W      E +T   +VL+  I 
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 617 DFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIG------ 670
               G+++G+ +   + L  +++ +              + +D I  KF N         
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRI-----------QILGKDPITKKFRNIYSEHNEEI 511

Query: 671 -----DQIYVLKLQNLLFFGTIISIEEKIDKLLEMS------DRNSSKRQ---------- 709
                ++  V+K+   L F  +  + +K+ +L +           +S R           
Sbjct: 512 PLEEIEKTMVIKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDN 571

Query: 710 --IKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGL 767
             +KY+I+D   +    ID SA +    +      + I +I     +RD + N F+K G+
Sbjct: 572 VYVKYIIMDL--LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD-LKNKFDKSGI 628

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 124/290 (42%), Gaps = 32/290 (11%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  N+V  +FG++  +  Y  S +   +GA S  +G  +  +T++ M +    
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           + +IP C++  +              D    L    +  + V  +T     F   I  GI
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIF-YSIEAGI 526

Query: 627 LIACFKFLID------SSKLQTINGEFSGKVAKSTVNRDL------IQSKFLNGIGDQ-- 672
            I C   +I+       S++Q +      +VA ++   +L      ++   L+  G +  
Sbjct: 527 CIGCVYSIINIIKHSAKSRIQIL-----ARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEI 581

Query: 673 --IYVLKLQNLLFFGTIISIEEKIDKLLEMSD------RNS--SKRQIKYLILDFRNINA 722
               ++++   L F     +++++D++           R S  SK  IKY+I D   + +
Sbjct: 582 EGCMIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS 641

Query: 723 DNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772
             ID SAA+    I    + +N+ + + ++ + D++     K G+   VE
Sbjct: 642 --IDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVE 689

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/285 (18%), Positives = 124/285 (43%), Gaps = 38/285 (13%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  NLV  +FG++ ++  Y  S +   +GA +  +G  +  +T+  +     +
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I + P+CI+  +              D    +    Y  +++  L   +   +  +  GI
Sbjct: 444 IHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFTLIF-VTTIIHSVEAGI 502

Query: 627 LIAC------------------FKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNG 668
            + C                     +I +++   ++G + G     T+  DL +S  L  
Sbjct: 503 SVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPG---LKTI--DLRESSALEE 557

Query: 669 IGDQIYVLKLQNLLFFGTIISIEEKIDKL-------LEMSDRNSSKRQ-IKYLILDFRNI 720
           + D   ++K+   L F     ++E++++L       +    R    R+ IKY+I +   +
Sbjct: 558 LDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGM 617

Query: 721 NADNIDYSAAEGFNRIKRLTESKNIQL----IISSIKVRDRIYNS 761
            +  +D SAA+    I +  + +++ +    + S++++R R++++
Sbjct: 618 TS--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRTRLHDA 660

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/331 (19%), Positives = 141/331 (42%), Gaps = 35/331 (10%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  NL+  +FG++ ++  Y  S +   +GA +  +G  +  +T+  +      
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I +IP+C++  +              D    +    Y  ++  ++T+ +  F   +  GI
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITV-LTTFFYSVEAGI 518

Query: 627 LIACFKFLIDSSKLQTING-EFSGKVAKST--VNRDLIQSKFLNGIGDQ----------- 672
            + C   +I   K  T +  +  GK+A +   VN D  + K  N   ++           
Sbjct: 519 TVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGK--NSTSERRVNPQLEEIEG 576

Query: 673 IYVLKLQNLLFFGTIISIEEKIDKL--------LEMSDRNSSKRQIKYLILDFRNINADN 724
             ++++   L F     ++ ++++L           + R+  +   KY+I D   +    
Sbjct: 577 CLIVRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--T 634

Query: 725 IDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWC 784
           ID SA +    I    + +++ + +  +    ++ N F   G+L  VE  +D++ +L   
Sbjct: 635 IDSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSLLPS 692

Query: 785 ENEFLYQ---YKMIRERIKIKN---VKTATH 809
             + L     ++ I E ++I +   ++ A+H
Sbjct: 693 AQQMLTSSPYFETIEEALRIVDELELRAASH 723

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 122/290 (42%), Gaps = 31/290 (10%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGY---LLIFLTIVVMLIG 563
           ++EL+A G  NL S + GS+  +  Y  S +   +GA +  +G    LL+ LTI  +L  
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLL-- 450

Query: 564 PVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGII 623
             +I +IPIC++  +              D       F Y  ++V  LT+ +      + 
Sbjct: 451 -PMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTV-LTTMFYSVE 508

Query: 624 VGILIACFKFLID------SSKLQTI-----NGEF--SGKVAKSTVNRDLIQSKFLNGIG 670
           VGI I C   +I        S++Q +        F  S    K T NR+           
Sbjct: 509 VGICIGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQT-NREHANENLELEEL 567

Query: 671 DQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRN--------SSKRQIKYLILDFRNINA 722
           +   ++K+   L F     ++E++++L +              S+   +Y+I+D   +  
Sbjct: 568 EGCLIVKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT- 626

Query: 723 DNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772
            ++D SAA+    I      +++++ ++ + +  R+     K G++  VE
Sbjct: 627 -HMDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A GLSN+V    G++ ++  Y  S +   +G  +  +G  +   TI+ +L    +
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 567 ISFIPICIV 575
           I +IP+CI+
Sbjct: 473 IHYIPVCIL 481

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 135/324 (41%), Gaps = 43/324 (13%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  NLV  +FG++ ++  Y  S +   +GA +  +G  +  +T++        
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I  IPIC++  +              D         Y  ++   +T+ +  F   +  GI
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITV-LTTFFYSVEAGI 506

Query: 627 LIACFKFLIDSSKLQTING-EFSGKVAKST--VNRD------LIQSKFLNGIG--DQIYV 675
            + C   +I + K  T +G +  G+++ +   VN D       + S+F   +   +   V
Sbjct: 507 TLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHMEGCLV 566

Query: 676 LKLQNLLFFGTIISIEEKIDKL--------LEMSDRNSSKRQIKYLILDFRNINADNIDY 727
            ++   L F     ++ ++++L           S R+  K   + +I D   +    ID 
Sbjct: 567 ARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT--QIDS 624

Query: 728 SAAEGFNRI-KRLTESK---NIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGAL-- 781
           SA++    I K LT+ K    +  +  ++ VR+R+  S    G+   VE    LN A   
Sbjct: 625 SASQILCEIVKSLTKRKVRVYLARVPRALHVRERLVAS----GVAGMVENNIPLNTASMG 680

Query: 782 ----EWCENEFLYQYKMIRERIKI 801
                WC       +K I+E +K+
Sbjct: 681 QPGDSWC-------FKSIQEALKM 697

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 56/288 (19%), Positives = 125/288 (43%), Gaps = 29/288 (10%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  NL + + G++  +  Y  S +   +GA +  +G  +  + ++ +      
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I +IP+CI+  +              D      +  Y  ++V  +T+ +  F   + +G+
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTV-LTTFFYSLEMGV 503

Query: 627 LIACFKFLID------SSKLQTI-----NGEFSGK---VAKSTVNRDLIQSKFLNGIGDQ 672
            I C   +I        S++Q +      G+F      ++ +T   DL   + L G    
Sbjct: 504 CIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEG---- 559

Query: 673 IYVLKLQNLLFFGTIISIEEKIDKL-------LEMSDRNSSKRQ-IKYLILDFRNINADN 724
             V+K+   L F  +  ++E++ +L       +    + S +R+ IKYL+ D   +    
Sbjct: 560 CLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF-- 617

Query: 725 IDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVE 772
           +D SAA+    I +    + +++ ++ + + +++ +      +L  VE
Sbjct: 618 MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 127/300 (42%), Gaps = 39/300 (13%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  NLV  +FG++ ++  Y  S +   +GA +  +G  +  +T V  +     
Sbjct: 373 NRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNA 432

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I  IP+C++  +              D         Y  +++  LT+ +  F   +  GI
Sbjct: 433 IHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGI 491

Query: 627 LIAC----FKFLIDSSK-----LQTINGE---FSGKVAKSTVNRDLIQSKFLNGIGDQIY 674
            + C     + + +S+K     L+ ++G     +     S+ N  ++    L+ I   + 
Sbjct: 492 TLGCGYSVIRVIKNSTKSKIQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDIEGSL- 550

Query: 675 VLKLQNLLFFGTIISIEEKIDKLLE--------MSDRNSSKRQIKYLILDFRNINADNID 726
           ++K+   L F     ++ ++ +L +         S +  ++ Q K++I D   +    ID
Sbjct: 551 IVKIPERLTFMNTEDLKTRLYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--EID 608

Query: 727 YSAAEGFNRIKRLTESKNIQLIISSIKVRD-RIYNSFNKVGLLVGVELFNDLNGALEWCE 785
            SA            S+ +Q I+ S++ R  R+Y    +V L+ GV      +G +E  E
Sbjct: 609 SSA------------SQILQEIVLSLRKRGVRVY--LARVPLIAGVRERLVASGVVEMVE 654

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 55/284 (19%), Positives = 123/284 (43%), Gaps = 36/284 (12%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  N+++ +FG++ ++  Y  S +   +G+ +  +G  +  +T++ +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 567 ISFIPICIVG--------SLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDF 618
           I +IP+CI+         SL+               +D+L  F      + VL   +   
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVF-----AITVLATLLYSV 506

Query: 619 VLGIIVGILIACFKFLIDSSKLQ-TINGEFSGKVAKSTVNR--------DLIQSKFLNGI 669
            +GI +G   +    +  S+K +  I G   G    + ++         D+  +KF+   
Sbjct: 507 EMGICIGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEE 566

Query: 670 GDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNS--------SKRQIKYLILDFRNIN 721
            +   ++K+   L F     ++E++++L       +        SK   K +I D   + 
Sbjct: 567 IEGCLIVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMT 626

Query: 722 ADNIDYSAAEGFNRIKRLTESKNIQL----IISSIKVRDRIYNS 761
           +  ID SA + F  I    + + +++    ++ S ++R+R+  S
Sbjct: 627 S--IDSSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKS 668

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 38.9 bits (89), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 83/204 (40%), Gaps = 28/204 (13%)

Query: 484 GILHVP--------INVPA---------LAMSV---QMDKYDV--DKELIAHGLSNLVSG 521
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G+SNL+  
Sbjct: 396 GVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455

Query: 522 MFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFX 581
            F +      ++ S L  +    +P +G       ++ +        +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 582 XXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSK 639
                       TW+  K+   +++  +V VL         GI   +  +C   L+   K
Sbjct: 516 AVSDLLASYQT-TWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571

Query: 640 LQTINGEFSGKVAKSTVNRDLIQS 663
           +    G+F G+V  + V    I++
Sbjct: 572 MAFPAGKFLGRVEIAEVTDAYIKA 595

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (43%), Gaps = 1/132 (0%)

Query: 504 YDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIG 563
           Y  ++ELIA G  N+V  +FG++ ++  Y  S + + +G  +  +G ++  +T++   + 
Sbjct: 374 YSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLL 433

Query: 564 PVIISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGII 623
             +I + P C++  +              D    +    Y  + V  LT  I      + 
Sbjct: 434 LPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTF-IATLSQSVE 492

Query: 624 VGILIACFKFLI 635
           +G+ + C   LI
Sbjct: 493 LGVTVGCIYSLI 504

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 100/252 (39%), Gaps = 40/252 (15%)

Query: 484 GILHVPINV-----PALAMSV---------------QMDKYDV--DKELIAHGLSNLVSG 521
           G+ HVP  +     P+L  S+               +++ Y V  D+ELIA G+SNL+  
Sbjct: 396 GVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455

Query: 522 MFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFX 581
            F +      ++ S L  +    +P +G       ++ +        +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 582 XXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSK 639
                       TW+  K+   +++  +V VL         GI   +  +C   L+   K
Sbjct: 516 AVSDLLASYQT-TWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571

Query: 640 LQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLE 699
           +    G+F G+V  + V    +++       D +  +   N      I ++EE  +   E
Sbjct: 572 VAFPAGKFLGRVEIAEVTDAYVKAD-----SDAVSYVSENN----NRISTLEENGEDEKE 622

Query: 700 MSDR---NSSKR 708
           +S +   NSSK+
Sbjct: 623 ISAKYITNSSKK 634

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 73/170 (42%), Gaps = 14/170 (8%)

Query: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
           +++ Y V  D+ELIA G++NL+   F S      ++ S L  +    +PF+G   +F   
Sbjct: 420 RINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSG---VFTGA 476

Query: 558 VVMLIGPVIIS---FIPICIVGSLIFXXXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLT 612
            V+L    + S   +IP   + ++I              TW+  K+   + ++ +V VL 
Sbjct: 477 CVLLALYCLTSAFFYIPKATLSAVIIHAVSDLLASYET-TWNFWKMNPLDCISFIVTVLI 535

Query: 613 MGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQ 662
                   GI   +  +C   L+   K     G+F G+V  + V    IQ
Sbjct: 536 TVFSSIENGIYFAMCWSCAMLLL---KQAFPAGKFLGRVEVAEVLNPTIQ 582

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 84/204 (41%), Gaps = 28/204 (13%)

Query: 484 GILHVPI--------NVPA---------LAMSV---QMDKYDV--DKELIAHGLSNLVSG 521
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G+SNL+  
Sbjct: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGT 455

Query: 522 MFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFX 581
            F +      ++ S L  +    +P +G       ++ +        +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 582 XXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSK 639
                       TW+  K+   +++  +V VL         GI   +  +C  F++   K
Sbjct: 516 AVSDLLASYQT-TWNFWKMNPLDFICFIVTVLITVFSSIENGIYFAMCWSCAIFIL---K 571

Query: 640 LQTINGEFSGKVAKSTVNRDLIQS 663
           +    G+F G+V  + V    +++
Sbjct: 572 VAFPAGKFLGRVEIAEVTDAYVRA 595

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 1/129 (0%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A GL N +   FG I  +  Y  S +   +GA +  AG  +  +T+  +     +
Sbjct: 375 NRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPV 434

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           I +IP C++  +              D    +    Y  +++ VLT     F   I  GI
Sbjct: 435 IHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF-YSIEFGI 493

Query: 627 LIACFKFLI 635
           L  C   LI
Sbjct: 494 LAGCTYSLI 502

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 9/179 (5%)

Query: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
           +++ Y V  D+ELIA G +NL+   F +      ++ S L  +    +PF+G       +
Sbjct: 420 RINDYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVL 479

Query: 558 VVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGI 615
           V +        FIP   + ++I              TW+  K+   +    +V VL    
Sbjct: 480 VAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKT-TWNFWKMNPLDCCAFIVTVLITVF 538

Query: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKV-AKSTVNRDLIQSKFLNGIGDQI 673
                GI   +  +C   L+   K     G+F G+V     +N  +++      I DQI
Sbjct: 539 SSIENGIYFAMCWSCAMLLL---KHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQI 594

>Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON}
           (201096..203006) [1911 nt, 637 aa]
          Length = 636

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 15/113 (13%)

Query: 103 ESDEGSMKDYLDFIENTDRDNINEHKESLPVTV----VLSTPADEVEEQDESSRLLLTPS 158
           ESD  S++ Y   +    +DN N H + LPV +    V+S P+  +      +R  +T +
Sbjct: 10  ESDTSSVEQY---VPQQLQDNNNSHNDHLPVELTDDDVISRPSIALSR----TRTNMTQA 62

Query: 159 SSNAEVSSI----AEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNT 207
               EV SI     +G+    S  ES+     PIE+  D   +EK+     NT
Sbjct: 63  EERQEVLSIIASHKDGIERTLSRYESSTHGIGPIEQMIDKEDDEKIIPAIDNT 115

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 82/203 (40%), Gaps = 28/203 (13%)

Query: 484 GILHVPI--------NVPA---------LAMSV---QMDKYDV--DKELIAHGLSNLVSG 521
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G+SNL+  
Sbjct: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455

Query: 522 MFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFX 581
            F +      ++ S L  +    +P +G       ++ +        +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 582 XXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSK 639
                       TW+  K+   +++  +V VL         GI   +  +C   ++   K
Sbjct: 516 AVSDLLASYQT-TWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLIL---K 571

Query: 640 LQTINGEFSGKVAKSTVNRDLIQ 662
           +    G+F G+V  + V    ++
Sbjct: 572 VAFPAGKFLGRVEVAEVTDAYVR 594

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 55/285 (19%), Positives = 110/285 (38%), Gaps = 27/285 (9%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G  N+V  +FG++  +  Y  S +   +G  +  +G  L  +T+  +     +
Sbjct: 363 NRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPV 422

Query: 567 ISFIPICIVGSLIFXXXXXXXXXXXXDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGI 626
           +   P C++  +              D      +  Y  ++V+ LT  I      + VGI
Sbjct: 423 VHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTF-ITTIFYSVEVGI 481

Query: 627 LIACFKFLID------SSKLQTI----------NGEFSGKVAKSTVNRDLIQSKFLNGIG 670
            + C   +I        S++Q +          N +  G       N +      L  + 
Sbjct: 482 CVGCCYSIISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFEPLLEDLD 541

Query: 671 DQIYVLKLQNLLFFGTIISIEEKIDKL-------LEMSDRN-SSKRQIKYLILDFRNINA 722
           +   V+K+   L F     ++E++ +L       +    R+  S+ + KY+I D   +  
Sbjct: 542 EDRLVVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLHGMTY 601

Query: 723 DNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGL 767
             ID SAA+    I      + + +    + +R  +   F + GL
Sbjct: 602 --IDASAAQILLEIILAYNRRQVFVFFVRVPMRREVRQRFERSGL 644

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 20/173 (11%)

Query: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
           +++ Y V  D+ELIA G++NL+   F S      ++ S L  +    +PF+G   IF   
Sbjct: 420 RINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSG---IFTGA 476

Query: 558 VVMLIGPVIIS---FIPICIVGSLIFXXXXXXXXXXXXDTW-----DKLTTFEYVTVVVI 609
            V+L    + S   FIP   + ++I              TW     + L    ++  V I
Sbjct: 477 CVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKT-TWIFWKTNPLDCISFIATVFI 535

Query: 610 VLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQ 662
            +   I +   GI   +  +C   L+   K     G+F G+V  + V    +Q
Sbjct: 536 TVFSSIEN---GIYFAMCWSCAMLLL---KQAFPAGKFLGRVEVAEVLNPTVQ 582

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 39/69 (56%)

Query: 507 DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVI 566
           ++EL+A G+ NL + + G + ++  Y  S +   +GA +  +G ++  +T++ +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 567 ISFIPICIV 575
           I FIP C++
Sbjct: 488 IHFIPTCVL 496

>TPHA0O00340 Chr15 (49952..53122) [3171 bp, 1056 aa] {ON} Anc_1.464
           YEL025C
          Length = 1056

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 6/62 (9%)

Query: 223 LDALSYGMIIFPISEPIFSHLGPTGMSMFYIST--IICQFIYSSGWSSFPSC---IGSEM 277
           L  L+YG I+F I+  IF  +  T  S+F +S+  I+  +I +S W   PS    + S M
Sbjct: 660 LQNLTYGSIVFNINTSIFK-IRETNKSLFLLSSDDIVYHYITNSNWKHRPSMNLELQSHM 718

Query: 278 IE 279
           +E
Sbjct: 719 LE 720

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 61/156 (39%), Gaps = 8/156 (5%)

Query: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
           +++ Y V  D+ELIA G++NLV   F S      ++ S L  +    +PF+G       +
Sbjct: 410 RINDYKVVPDQELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVL 469

Query: 558 VVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGI 615
           + +        FIP   + ++I              TW   K    + V+ +V V     
Sbjct: 470 LALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYET-TWTFWKTNPLDCVSFIVTVFITVF 528

Query: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKV 651
                GI   +  +C   L+   K     G F G+V
Sbjct: 529 SSIENGIYFAMCWSCAILLL---KQAFPAGRFLGRV 561

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 66/167 (39%), Gaps = 8/167 (4%)

Query: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
           +++ Y V  D+ELIA G++NL+   F S      ++ S L  +    +PF+G       +
Sbjct: 416 RINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVL 475

Query: 558 VVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGI 615
           + +        FIP   + ++I              TW   K    + ++ +V V     
Sbjct: 476 LALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKT-TWTFWKTNPLDCISFIVTVFITVF 534

Query: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQ 662
                GI   +  +C   L+   K     G+F G+V  + V    +Q
Sbjct: 535 SSIENGIYFAMCWSCAMLLL---KQAFPAGKFLGRVEVAEVLNPTVQ 578

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 65/161 (40%), Gaps = 8/161 (4%)

Query: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557
           +++ Y V  D+ELIA G++NLV   F +      ++ S L  +    +P +G       +
Sbjct: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486

Query: 558 VVMLIGPVIISFIPICIVGSLIFXXXXXXXXXXXXDTWD--KLTTFEYVTVVVIVLTMGI 615
           + +        +IP   + ++I              TW+  K+   + +  +V V     
Sbjct: 487 LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYET-TWNFWKMNPLDCLCFLVTVFITIF 545

Query: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTV 656
                GI   I  +C   L    K+   +G+F G+V  S V
Sbjct: 546 SSIENGIYFAICWSCAILLF---KIAFPSGKFLGRVEVSEV 583

>NDAI0E01400 Chr5 complement(279960..280937) [978 bp, 325 aa] {ON}
           Anc_8.644
          Length = 325

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 621 GIIVGILIACFKFLIDSSKLQTINGEFSGKV--AKSTVNRDLIQSKFLNGIGDQIYVLKL 678
           GII  I+I  F+ +    KLQ +N +F+G V   K TV ++ I+  + NG+   I+   +
Sbjct: 148 GIIESIVIVPFELV--KIKLQDVNCKFNGPVDVLKDTVKKNGIKGLY-NGLESTIWRNGV 204

Query: 679 QNLLFFGTIISIEE 692
            N  +FG I  + E
Sbjct: 205 WNAGYFGIIFQVRE 218

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%)

Query: 869 LKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTF 928
           LK+YR D +S     KG+ +   SQL+  F+K  ++   +L +   + ++  + +L  + 
Sbjct: 657 LKKYREDCLSTKTFGKGRTLSAASQLSATFNKLPLSEMVLLCNEAIVLYMKALSILSKSM 716

Query: 929 DLPQGKVYETMSK 941
            +     YE+  K
Sbjct: 717 QVTSNWWYESQEK 729

>NDAI0C00210 Chr3 (33765..34715) [951 bp, 316 aa] {ON} Anc_2.661
           YKL019W
          Length = 316

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 790 YQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNIFK 842
           Y+Y++I   IK  +   +T+  +  LS    +TL  N P+NYQI+S  Q I K
Sbjct: 73  YRYEIIESEIKKMSEPDSTNFLNKELSWLDEITL--NNPKNYQIWSYRQAIIK 123

>YDR325W Chr4 (1117126..1120233) [3108 bp, 1035 aa] {ON}  YCG1Subunit
            of the condensin complex; required for establishment and
            maintenance of chromosome condensation, chromosome
            segregation and chromatin binding of the condensin
            complex; required for clustering of tRNA genes at the
            nucleolus
          Length = 1035

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 88/195 (45%), Gaps = 23/195 (11%)

Query: 707  KRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTE-----SKNIQLIISSIKVRDRIYNS 761
            K++IK +I+   NINA  I  S+ + ++ +K L E     ++N  L   S    D++ N+
Sbjct: 844  KKEIKKMII--TNINA--IFLSSEQDYSTLKELLEYSDDIAENDNLDNVSKNALDKLRNN 899

Query: 762  FNKVGLLVGVELFNDLNGALEWCENEFLY-QYKMIR----ERIKIKNVKTATHSSDGNLS 816
             N +     +E  N+ +      EN     QY  I      +     ++ A   +DGN +
Sbjct: 900  LNSL-----IEEINERSETQTKDENNTANDQYSSILGNSFNKSSNDTIEHAADITDGNNT 954

Query: 817  KPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKN----RFQDQTPVLPLLLFALKQY 872
            + +  T++I+   N    S ++   ++E + +D  KN      QD + V   + F L   
Sbjct: 955  ELTKTTVNISAVDNTTEQSNSRKRTRSEAEQIDTSKNLENMSIQDTSTVAKNVSFVLPDE 1014

Query: 873  RPDIVSVDKVKKGKE 887
            + D +S+D+  K  E
Sbjct: 1015 KSDAMSIDEEDKDSE 1029

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,038,894
Number of extensions: 4466268
Number of successful extensions: 16465
Number of sequences better than 10.0: 127
Number of HSP's gapped: 16983
Number of HSP's successfully gapped: 131
Length of query: 1020
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 900
Effective length of database: 39,721,479
Effective search space: 35749331100
Effective search space used: 35749331100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)