Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C018805.348ON34534515390.0
ZYRO0F00550g5.348ON4151883356e-35
CAGL0H07161g5.348ON4242743287e-34
Suva_2.4865.348ON4152583261e-33
YDR317W (HIM1)5.348ON4141883163e-32
TDEL0E027905.348ON4112813163e-32
Skud_4.5835.348ON4151943093e-31
Smik_4.5765.348ON4151732981e-29
SAKL0G08910g5.348ON5052992736e-26
Ecym_81855.348ON4712522656e-25
Kpol_1051.45.348ON4261712489e-23
AGR348W5.348ON5421782481e-22
TBLA0A031005.348ON3721652327e-21
TPHA0D020605.348ON4961602181e-18
Kwal_34.159895.348ON5061562162e-18
KLTH0H14784g5.348ON5141582134e-18
KLLA0B10120g5.348ON3481071691e-12
ZYRO0D09548g7.148ON225761092e-05
Smik_5.1187.148ON23185995e-04
Suva_5.917.148ON22985996e-04
Skud_5.1037.148ON22785960.001
YER004W (FMP52)7.148ON23185930.003
KLTH0H00264g7.148ON22289860.022
NCAS0E020907.148ON22571860.024
Ecym_44797.148ON224101860.025
CAGL0H09768g7.148ON233143850.029
KNAG0L00930singletonON22997840.045
TBLA0A105007.148ON23788810.10
NCAS0E02080singletonON22572800.11
Kpol_312.97.148ON221148790.19
Kwal_47.188627.148ON22470711.9
KAFR0G027507.148ON225103683.9
Kpol_1020.352.212ON95774694.9
Kpol_487.131.391ON1044146678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01880
         (345 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   597   0.0  
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   133   6e-35
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   130   7e-34
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   130   1e-33
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   126   3e-32
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   126   3e-32
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   123   3e-31
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   119   1e-29
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   109   6e-26
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   106   6e-25
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   100   9e-23
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   100   1e-22
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    94   7e-21
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...    89   1e-18
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...    88   2e-18
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...    87   4e-18
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    70   1e-12
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    47   2e-05
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    43   5e-04
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    43   6e-04
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    42   0.001
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    40   0.003
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    38   0.022
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      38   0.024
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    38   0.025
CAGL0H09768g Chr8 complement(954112..954813) [702 bp, 233 aa] {O...    37   0.029
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               37   0.045
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    36   0.10 
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      35   0.11 
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    35   0.19 
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    32   1.9  
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    31   3.9  
Kpol_1020.35 s1020 complement(75767..78640) [2874 bp, 957 aa] {O...    31   4.9  
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    30   8.0  

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/345 (86%), Positives = 299/345 (86%)

Query: 1   MSINSKEHIXXXXXXXXXXXXXXXXXXXXXXXXCNKQNNFYDVIESSIVSGVYDIAFDKI 60
           MSINSKEHI                        CNKQNNFYDVIESSIVSGVYDIAFDKI
Sbjct: 1   MSINSKEHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIESSIVSGVYDIAFDKI 60

Query: 61  IYCFNRTPQNIRYKYHSDFEKNSQFDFGGTKYTLXXXXXXXXXXXXKGQLQFAINDVEER 120
           IYCFNRTPQNIRYKYHSDFEKNSQFDFGGTKYTL            KGQLQFAINDVEER
Sbjct: 61  IYCFNRTPQNIRYKYHSDFEKNSQFDFGGTKYTLSNNPEPNNSFESKGQLQFAINDVEER 120

Query: 121 IKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIA 180
           IKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIA
Sbjct: 121 IKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIA 180

Query: 181 RKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE 240
           RKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE
Sbjct: 181 RKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE 240

Query: 241 NKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKES 300
           NKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKES
Sbjct: 241 NKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKES 300

Query: 301 EISTNIRTLNPITRAIHYXXXXXXXXXXHWSYFTLMMPKRKFLRC 345
           EISTNIRTLNPITRAIHY          HWSYFTLMMPKRKFLRC
Sbjct: 301 EISTNIRTLNPITRAIHYKKKLIKQKKKHWSYFTLMMPKRKFLRC 345

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  133 bits (335), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 120/188 (63%), Gaps = 5/188 (2%)

Query: 108 GQLQFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLL 167
           G +Q         + ++++    S +  + +++ + L +T++   VQ+V+ +S +W DLL
Sbjct: 132 GTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLL 191

Query: 168 PILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYD 227
           P +F+GE  +++  +  +   P   +L +++ + T++CTLG +S++ K  +     ++Y 
Sbjct: 192 PSIFSGE--VELVPEESNHTSP---RLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQ 246

Query: 228 LTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILR 287
           LT+ +++ F + E+K+++I+TSFNN+L+S+IFPYF+ K +LENDL+  + P + +L +LR
Sbjct: 247 LTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLR 306

Query: 288 PGPIKGKH 295
           PGPI G H
Sbjct: 307 PGPIVGNH 314

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  130 bits (328), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 138/274 (50%), Gaps = 28/274 (10%)

Query: 42  DVIESSIVSGVYDIAFDKIIYCFNRTPQNIRYKYHSDFEKNS--QFDFGGTKY------- 92
           +++  +I  G+ ++     +YCFNR       KY      NS   F F G++Y       
Sbjct: 55  ELLLEAIEEGLENVTIKTCLYCFNRKIGEPLDKYLKSPSANSFGPFCFNGSQYHYNKGTC 114

Query: 93  ---TLXXXXXXXXXXXXKGQLQFAINDVEERIKIKYQVMP--YSKEFGFSAE----EEQQ 143
               +             G L +   D  + +  K  +    Y KE+ +  E    E   
Sbjct: 115 VPLDIDQDIETSNDATFDGFLYY--KDKGKNVTGKNPISGEYYGKEYMYYLEYMSAEGNL 172

Query: 144 LNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRK--DRLFPELFKLANINDIS 201
           L + +   H+Q++   S  WP ++PI+F+ E E    R++    R FP L      +DI 
Sbjct: 173 LKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVEAISFREKMPLKRYFPLL------SDIK 226

Query: 202 TVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPY 261
           T++ T+G ++   K  N T N IDY L  +L++AF+ T++K VIIVTSFNN +IS + PY
Sbjct: 227 TMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIISTVSPY 286

Query: 262 FRTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295
           F+ K++LE+ L   + PP+K L ILRPGP+ G+H
Sbjct: 287 FKIKMKLESTLANAITPPLKTLTILRPGPLVGRH 320

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  130 bits (326), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 126/258 (48%), Gaps = 18/258 (6%)

Query: 54  DIAFDKIIYCFNR--TPQNIRYKYHSDFEKNSQFDFGGTKYTLXXXXXXXXXXXXKGQLQ 111
           ++  +K I+C NR    +   +    D+       + G +Y L                 
Sbjct: 55  NVVLNKHIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNT 114

Query: 112 FAINDVEERI-------------KIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYN 158
           F  +D EE I                Y    +S    ++  +++   + YN    Q+V  
Sbjct: 115 FCYDDFEEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIP 174

Query: 159 ESEKWPDLLPILFTGENEIKIARKRKD-RLFPELFKLANINDISTVVCTLGASSATAKKQ 217
           +S  WP LLP +F+G    K+ R   D R +     L  +N I T+VC LG+S+A  +K 
Sbjct: 175 QSTSWPKLLPEVFSGTQ--KLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKS 232

Query: 218 NMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLE 277
            +  + +DY L++NL + FT T +KK++++TSFNN  +S  F YFR K +LENDL+  L 
Sbjct: 233 QVPNSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALP 292

Query: 278 PPIKELYILRPGPIKGKH 295
             +KEL ILRPGP+ G+H
Sbjct: 293 NKLKELIILRPGPMCGQH 310

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  126 bits (316), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 107/188 (56%), Gaps = 5/188 (2%)

Query: 112 FAINDVEERIKIKYQVMPYSKEFGF----SAEEEQQLNVTYNVFHVQIVYNESEKWPDLL 167
           F  N  EER K  Y  +   K+F +    +  +E+ + +  N    Q++   SE WP LL
Sbjct: 124 FIKNTPEERGKDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWPKLL 183

Query: 168 PILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYD 227
           P +F+G  +++          P    L ++ DIST+VC+LG++SA  ++  +  +  DY 
Sbjct: 184 PRIFSGTQKLEKFDIDNKNYVPGR-SLPSLCDISTMVCSLGSTSARVRRTQVPSSFADYY 242

Query: 228 LTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILR 287
           L +NL + FT T NK++++ T+FNN  +S  F YFR K +LENDL   L   +KEL ILR
Sbjct: 243 LPFNLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVILR 302

Query: 288 PGPIKGKH 295
           PGP+ G+H
Sbjct: 303 PGPMCGQH 310

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  126 bits (316), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 145/281 (51%), Gaps = 30/281 (10%)

Query: 57  FDKIIYCFNRTPQNIRYK-------YHSDFEKNSQFDFGGTKYTLXXXXXXXXXXXXKGQ 109
           F+K+IYC NR    I YK        +   +K +   F    Y              K  
Sbjct: 58  FNKLIYCINR---KIGYKNILLDNEQYLKADKLAPISFNKADYRF-EKITSICPSVKKHS 113

Query: 110 LQFAINDVEERIKIKY-------QVMPYSK-----EFGFSAEEEQQLNVTYNVFHVQIVY 157
            Q  +N+V +     Y        V+ Y +     +  + +E  ++L +T+N   +QI  
Sbjct: 114 NQSLVNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIAC 173

Query: 158 NESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQ 217
            +S KW +LLP +F+G     +A + +        KL  +++I T++CTLGA S  +K +
Sbjct: 174 PDSSKWCELLPDIFSG----CVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAK 229

Query: 218 NMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLE 277
               + +DY+LT+ L ++F   E K+++IVT+FNN LI ++ PYFRTK +LENDL+  L+
Sbjct: 230 R---HYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLK 286

Query: 278 PPIKELYILRPGPIKGKHRSKESEISTNIRTLNPITRAIHY 318
           P + +L +LRPGP+ G+H    ++  T   + N + + ++Y
Sbjct: 287 PRLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYY 327

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  123 bits (309), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 106/194 (54%), Gaps = 22/194 (11%)

Query: 107 KGQLQFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDL 166
           KG   FA N  +           +S    ++  +E+   + YN    Q++   SE WP L
Sbjct: 134 KGNFSFAYNQKQ-----------FSYSLHYACRKEESFGIKYNFTVTQLIIPPSESWPRL 182

Query: 167 LPILFTGENEIK---IARKR--KDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTV 221
           L  +F+ E +++   I  K    D+  P L       DI T+VCTLG++SA  ++  +  
Sbjct: 183 LSRIFSKEQKLEKFDIDNKTYVADKSLPSL------RDIGTMVCTLGSTSARVRRTQVPN 236

Query: 222 NKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIK 281
           + +DY L ++L + F  T NK++++VTSFNN L+   F YFR K +LENDL+  L   +K
Sbjct: 237 SFVDYHLVFSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLK 296

Query: 282 ELYILRPGPIKGKH 295
           EL ILRPGP+ G+H
Sbjct: 297 ELVILRPGPMCGQH 310

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  119 bits (298), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 102/173 (58%), Gaps = 1/173 (0%)

Query: 123 IKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARK 182
           I Y    +S    +++ +++   + Y     Q++   SE W  LL  +F+G  +++    
Sbjct: 139 IPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSYIFSGTQKLE-KFD 197

Query: 183 RKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENK 242
             ++ +     L N+ DIST+VCTLG++SA  ++  +  + +DY L ++L + FT T +K
Sbjct: 198 ANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTDK 257

Query: 243 KVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295
           +++I+TSFNN  +S  F YFR K +LENDL+  L    KEL ILRPGP+ G+H
Sbjct: 258 RLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQH 310

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  109 bits (273), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 91/299 (30%), Positives = 149/299 (49%), Gaps = 41/299 (13%)

Query: 48  IVSGVYDIAFDKIIYCFNR---------TPQNIRYKYHSDFEKNSQFDFGGTKYTLXXXX 98
           I+ G   I   K ++CFNR         TP+     Y +D+ + S  D+ GTKY      
Sbjct: 135 ILRGEKSIEITKNLFCFNRKLALLEIPSTPE-----YINDYWEYS-IDYKGTKYHSKKNN 188

Query: 99  XXXXXXXXK-GQLQFAINDVEERIKIKYQVMPYSKEFGFSAEE---------EQQLNVTY 148
                   K G+L   +N  E  I  + Q+  +  +F F  E+          Q L ++ 
Sbjct: 189 ISFGVPTLKFGKL---VNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISL 245

Query: 149 NVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLG 208
            +  +QI+   S+ WP LL   F G+ +  +A   + ++ P      +++ ++T+V  LG
Sbjct: 246 KINVIQILEPNSKLWPLLLHSTF-GDTDTNVALHVQGQV-PTPMIFPSLSKVNTLVSALG 303

Query: 209 ASSATAKKQNMTVNKIDYDLTYNLIRAFTTTEN-----KKVIIVTSFNNALISNIFPYFR 263
           +++   KK +++ + +DYDL + +   FTT  +     KKV+++TSFNN  +S+  PYF 
Sbjct: 304 STTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFH 363

Query: 264 TKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSK----ESEISTNIRTLNPITRAIHY 318
           TKL+LE DL T + P + EL ILRPGP+ G H  +    +   STN   L P++   +Y
Sbjct: 364 TKLKLEQDLATRI-PELDELVILRPGPLIGSHTPEFIPGDPPKSTN-GLLKPLSTVCYY 420

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  106 bits (265), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 130/252 (51%), Gaps = 28/252 (11%)

Query: 50  SGV-YDIAFDKIIYCFNRTPQNIRYKYHS-DFEKNSQFDFGGTKYTLXXXXXXXXXXXXK 107
           SGV YD+   K I+CFNR  + + +          +  ++GG  + +             
Sbjct: 125 SGVLYDLKLTKNIWCFNRRLKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDL-------- 176

Query: 108 GQLQFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLL 167
            +++  I ++ +   +++Q   +  E     +E +  NVT NVF  QI+ N+S+KW    
Sbjct: 177 -KIKQHITEIGKLDGLEFQWDQFDWELKLPTDEVK--NVTVNVF--QIIQNDSKKWDKTF 231

Query: 168 PILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYD 227
             LFTG       +   DR+  E++ L +I+ + T++ TLG+SS  ++K     + +DY 
Sbjct: 232 SELFTGNR-----KPLNDRI--EVY-LPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283

Query: 228 LTYNLIRAFTTTENKKVI----IVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKEL 283
           L  ++ + F   + K +I    IVTSFNN  +  + PYFRTK +LENDL   + P +  L
Sbjct: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHL 342

Query: 284 YILRPGPIKGKH 295
            ILRPGP+ G+H
Sbjct: 343 TILRPGPLIGQH 354

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  100 bits (248), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 92/171 (53%), Gaps = 2/171 (1%)

Query: 123 IKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARK 182
           + +++     +  + A+E   L + + +    I+   S +WP LLP +F     I+    
Sbjct: 146 LSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPATVIEKVED 205

Query: 183 RKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENK 242
           +++ + P    L ++ +I T++ +LG +      +  +   ID+DLT  L + F    NK
Sbjct: 206 KENSILPT--GLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNNK 263

Query: 243 KVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKG 293
           K++++T+FNN ++S +F YF  K ++E  L+  L P + +L ILRPGPI G
Sbjct: 264 KLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVG 314

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 94/178 (52%), Gaps = 15/178 (8%)

Query: 145 NVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTVV 204
           N T NV  VQ+V  +S +WPDL   +FTG         R    + E++ +  + +I T++
Sbjct: 281 NATINV--VQVVQPDSRRWPDLFNKMFTGG-------VRTFNAYSEIY-MPAVTEIETLI 330

Query: 205 CTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKK----VIIVTSFNNALISNIFP 260
            TLG++S  A+K       +DY L   + + F     K     ++IVTSFN+  +  +  
Sbjct: 331 STLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQ 390

Query: 261 YFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKESEISTNIRTLNPITRAIHY 318
           YFRTK RLENDL   + P +  L ILRPGP+ G+H SK     TN  T N +TR   Y
Sbjct: 391 YFRTKQRLENDLTYDV-PGLTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTY 447

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 94.0 bits (232), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 89/165 (53%), Gaps = 14/165 (8%)

Query: 143 QLNVTYNVFHVQIVYNESEKWPDLLPILFTG----ENEIKIARKRKDRLFPEL--FKLAN 196
           +LN   N++  Q V  +S+ W ++LP +F       ++I       D+   E     L  
Sbjct: 188 KLNYIINIY--QFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPK 245

Query: 197 INDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALIS 256
           + DI  ++CTLG +    +K      KID+DLT+ L   F+    KK++IVT+FNN+L+S
Sbjct: 246 LEDIQVMICTLGTNLLCDQK------KIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLS 299

Query: 257 NIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKESE 301
             F YF  K +LE  LK  L+ P+ EL ILRPGP+ G H    SE
Sbjct: 300 KTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSE 344

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 88/160 (55%), Gaps = 4/160 (2%)

Query: 134 FGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFK 193
           F  S+ +  ++N    ++H+  V  +S  WP LLP+LF    ++   +   + +     K
Sbjct: 228 FASSSGDILKINFDLKLYHLSAV--DSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEK 285

Query: 194 LANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNA 253
           L  ++++  ++ +LG+ S + K  N T   IDY L  +LI +F  T +KKVII+TS N  
Sbjct: 286 LPLLSEVKVMLNSLGSRSHSPK--NETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKK 343

Query: 254 LISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKG 293
           + +    Y   K+ LE DLKT L+  I EL ILRPGP+ G
Sbjct: 344 IYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVG 383

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 88/156 (56%), Gaps = 6/156 (3%)

Query: 144 LNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTV 203
           L +   V  + IV  +S+KWP LL  +F G++  K     KD   P L+    +  I+T+
Sbjct: 247 LMIQLRVNIILIVEEDSQKWPMLLTRIF-GKHASKRPLIVKDTEEPILWTAPPLTQINTM 305

Query: 204 VCTLGASSATAKKQNMTVNKIDYDLTYNLIRAF----TTTENKKVIIVTSFNNALISNIF 259
           V +LG+ S   KK  ++ +  DY+L   L  AF    T    KK++I+TSFNN  +S+  
Sbjct: 306 VSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTS 365

Query: 260 PYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295
            YF++KL LE DL T ++  + +L +LRPGP+ G H
Sbjct: 366 DYFQSKLMLEQDLVTKVQ-ALDKLVLLRPGPLVGNH 400

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 91/158 (57%), Gaps = 8/158 (5%)

Query: 144 LNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPEL--FKLANINDIS 201
           L V  N+  + ++  +S++WP LL  +F GE  +K     + +    +  ++  ++ D+ 
Sbjct: 252 LMVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVG 310

Query: 202 TVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE----NKKVIIVTSFNNALISN 257
           T+V  LG++    +K ++  + +DY+L   L + F   +     KK+++VTSFN++L+S 
Sbjct: 311 TLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLST 370

Query: 258 IFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295
           +  YF+TKL+LE DL T +   +  L +LRPGP+ G H
Sbjct: 371 VSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNH 407

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 6/107 (5%)

Query: 199 DISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE--NKKV---IIVTSFNNA 253
           D+S + C LG++SA +K+  +  + +D  L  ++++A    +  ++K+   II+TSFNN 
Sbjct: 133 DLSVISC-LGSTSARSKRTGVARDWVDKILNLDILKAILNNDILSQKLSQYIIMTSFNNF 191

Query: 254 LISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKES 300
            IS +FPYF+ K  LE + +  L+     + ILRPGP+ GKH S  S
Sbjct: 192 AISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKHGSTSS 238

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL   L +A  T     +++V+S   A  +++ PYF+ K  +E D+   L      
Sbjct: 86  KIDHDLNVELAKAAKTKGCTTMVLVSSVG-ANENSMLPYFKDKGEIERDI---LALDFDH 141

Query: 283 LYILRPGPIKGKHRSK 298
             ILRPGP+ G+ +SK
Sbjct: 142 TIILRPGPLLGRQKSK 157

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL   L RA      + +++V+S   A   + F Y + K  +E D+   +    K 
Sbjct: 88  KIDHDLNLQLARAAKDKGCETIVLVSS-AGAHADSRFGYMKMKGEIERDV---IALNFKH 143

Query: 283 LYILRPGPIKG-KHRSKESEISTNI 306
             ILRPGP+ G +  SK+S    N+
Sbjct: 144 TIILRPGPLLGERENSKQSGFGGNL 168

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL   L RA        +++V+S   A + + F Y + K  +E D+   +    K 
Sbjct: 88  KIDHDLNMQLARAAKDRGCDTIVLVSS-AGAHVDSRFGYMKMKGEIERDI---IALNFKH 143

Query: 283 LYILRPGPIKGKH-RSKESEISTNI 306
             ILRPGP+ GK   SK++    N+
Sbjct: 144 TIILRPGPLLGKRTNSKQNGFGGNL 168

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL   L RA      + +++V+S   A   + F Y + K  +E D+   +    K 
Sbjct: 88  KIDHDLNLQLARAAKEKGCETIVLVSS-AGAHPDSRFGYMKMKGEIERDV---IALNFKH 143

Query: 283 LYILRPGPIKGKH-RSKESEISTNI 306
             ILRPGP+ G+  +SK+S    N+
Sbjct: 144 TIILRPGPLLGERTKSKQSGFGGNL 168

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL   L +A      + +++V+S   A   + F Y + K  +E D+   +    K 
Sbjct: 88  KIDHDLNLQLAQAAKEKGCETIVLVSS-AGAHPDSRFGYMKMKGEIERDV---IALDFKH 143

Query: 283 LYILRPGPIKGKH-RSKESEISTNI 306
           + ILRPGP+ G+   SK+S    N+
Sbjct: 144 IIILRPGPLLGERTNSKQSGFGGNL 168

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 6/89 (6%)

Query: 207 LGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKL 266
           L  +   A K+N    K+D+D+   L R+         ++V+S   A  +++F Y +TK 
Sbjct: 73  LATTRGEAGKENFY--KVDHDMNLQLARSAKEKGYSTYVVVSS-TGADENSMFYYMKTKG 129

Query: 267 RLENDLKTTLEPPIKELYILRPGPIKGKH 295
            LE D+   L    +   ILRPGP+ G+ 
Sbjct: 130 ELERDI---LALGFERTIILRPGPLLGER 155

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL  +L +A        V++V+S   +L S  F Y R K  +E D+   L      
Sbjct: 85  KIDHDLNVDLAKAAKEKGCSTVVLVSSSGASLDSR-FSYMRMKGEIERDI---LALDFDH 140

Query: 283 LYILRPGPIKG 293
             ILRPG + G
Sbjct: 141 TIILRPGILLG 151

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 7/101 (6%)

Query: 198 NDISTVVCTLGASSATAKK-QNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALIS 256
           + I+ +   LG + A A   +N    KID+ L   + +A      K +++V+S   A I 
Sbjct: 62  DGINVLFSALGTTKAAAGSIENQY--KIDHGLNLAVAKAAKEKGCKTLVLVSSLG-ASIE 118

Query: 257 NIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRS 297
           +  PYF+ K  LE D+   L    +   +LRPG + G+  S
Sbjct: 119 SRLPYFKMKGELERDV---LALGFERTILLRPGVLLGERDS 156

>CAGL0H09768g Chr8 complement(954112..954813) [702 bp, 233 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004w
          Length = 233

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 57/143 (39%), Gaps = 33/143 (23%)

Query: 154 QIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSAT 213
           QIV  +S  W  LLP                     E FK      + T + T  A++  
Sbjct: 48  QIVDKDSSSWASLLP--------------------KENFKF-----LFTSLATTRAAAGG 82

Query: 214 AKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLK 273
             KQ     +ID+DL   L +A      + +++V+S   A  ++  PY R K  +E D+ 
Sbjct: 83  FDKQY----QIDHDLNLELAKASKANGCETIVLVSS-TGANKNSWMPYLRMKGEIEEDI- 136

Query: 274 TTLEPPIKELYILRPGPIKGKHR 296
             +    K   ILRP  + G  R
Sbjct: 137 --IALNFKHTIILRPSALLGDRR 157

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 198 NDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISN 257
            ++  ++C LG + A +  +      +D+DLT  L       ++   ++V S   A   +
Sbjct: 67  GNLDVLICALGTTRARSNAEEQYA--VDHDLTLELATVAKREKHAHTVVVVSSTGAHPES 124

Query: 258 IFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGK 294
            F Y R K  +E D+    E       +LRPG + G+
Sbjct: 125 RFFYARMKGDVERDIT---ELQFNHTVLLRPGILLGE 158

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 212 ATAKKQNMTVNK---IDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRL 268
           AT KK      +   ID+DL  +  +          ++V+S   +  S  F Y + K  +
Sbjct: 75  ATTKKAAGGAQQQYYIDHDLNIDFAKKAKENGCSTFVVVSSAGASADSRFF-YLKMKGEI 133

Query: 269 ENDLKTTLEPPIKELYILRPGPIKGKHR 296
           E DLK         L ILRPGP+ G+ +
Sbjct: 134 ERDLKAI---DFDHLIILRPGPLLGERQ 158

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 223 KIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKE 282
           KID+DL   L +A    +    I+V S + A + + F Y R K  +E D+   +      
Sbjct: 85  KIDHDLNLELAKA-AKAKGCSTIVVVSSDRASLDSRFSYMRMKGEIERDI---VALDFDH 140

Query: 283 LYILRPGPIKGK 294
             ILRPG + G+
Sbjct: 141 TIILRPGILLGE 152

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 54/148 (36%), Gaps = 42/148 (28%)

Query: 154 QIVYNESEKWPDLLP----ILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGA 209
           QIV  +S KW +L+P     LF+G    + A    D  +                     
Sbjct: 45  QIVEKDSTKWSELIPDDTKYLFSGLATTRAAAGGLDNQY--------------------- 83

Query: 210 SSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLE 269
                        KIDYDL   L +A        +++V+S      S I  Y + K  +E
Sbjct: 84  -------------KIDYDLNIELAKAAKEKGCSTLVLVSSAGANEHSWI-AYLKMKGEIE 129

Query: 270 NDLKTTLEPPIKELYILRPGPIKGKHRS 297
            D+   ++       ILRPG I G+  S
Sbjct: 130 RDM---IKLGFDHTIILRPGAILGERTS 154

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 224 IDYDLTYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKEL 283
           +D+DL   L +       K  ++V+S   +  S  F YF+TK  +E D+   L    ++ 
Sbjct: 89  VDHDLNLQLAQKAKENGCKTFVLVSSAGASEKSPFF-YFKTKAEIERDI---LALNFEKT 144

Query: 284 YILRPGPIKG 293
            ILRPG + G
Sbjct: 145 IILRPGALFG 154

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 9/103 (8%)

Query: 196 NINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALI 255
           NI+ + T + T  A   T  +      KID+DL   L +A        ++IVT+ + A  
Sbjct: 66  NIDVLFTALATTRAVGGTGYQY-----KIDHDLNVELAKAAREKGCSTIVIVTA-HGAHA 119

Query: 256 SNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSK 298
            + F Y + K  +E D+    +       ILRPG + G+   +
Sbjct: 120 DSRFFYTKMKGEIERDIS---DLGFNRTIILRPGILLGERHER 159

>Kpol_1020.35 s1020 complement(75767..78640) [2874 bp, 957 aa] {ON}
           complement(75767..78640) [2874 nt, 958 aa]
          Length = 957

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 14/74 (18%)

Query: 193 KLANINDISTV------------VCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE 240
           K++N  D+S+V            +C +   S     +    ++++YD+   LI   TTT 
Sbjct: 80  KISNFEDVSSVQTLGFRGEALSSLCAISKVSVVTTTKAPRADRLEYDMHGTLIGKSTTTR 139

Query: 241 NKKVIIVTS--FNN 252
           NK   ++ S  FNN
Sbjct: 140 NKGTAVIVSQLFNN 153

>Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON}
           complement(50878..54012) [3135 nt, 1045 aa]
          Length = 1044

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 23/146 (15%)

Query: 162 KWPDLLPIL----FTGENEIK-------------IARKRKDRLFPELFK-LANINDISTV 203
           + P+L+P+L    +  + E+K             +  K  +R  P+L + +AN ND+   
Sbjct: 167 RMPELIPVLSEAMWDTKKEVKEAATATITKATETVDNKDIERFIPKLIECIANPNDVPET 226

Query: 204 VCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALISN---IFP 260
           V  LGA++  A+    T++ +   L   L    T+ + K  +I+ +    L+ +   + P
Sbjct: 227 VHLLGATTFVAEVTPATLSIMVPLLARGLAERETSIKRKAAVIIDNMCK-LVEDPQVVAP 285

Query: 261 YFRTKL-RLENDLKTTLEPPIKELYI 285
           +    L  L+N+  T  +P  +E+ +
Sbjct: 286 FLNKLLPGLKNNFATIADPEAREVTL 311

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,778,694
Number of extensions: 1380583
Number of successful extensions: 3771
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3875
Number of HSP's successfully gapped: 46
Length of query: 345
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 235
Effective length of database: 40,868,139
Effective search space: 9604012665
Effective search space used: 9604012665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)