Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C018705.349ON34134116990.0
KNAG0C055205.349ON3853897352e-94
Smik_4.5775.349ON3683457081e-90
Skud_4.5845.349ON3683496968e-89
YDR318W (MCM21)5.349ON3683706905e-88
Suva_2.4875.349ON3683506672e-84
TDEL0E027805.349ON3473626261e-78
Kpol_1051.55.349ON3703666081e-75
CAGL0H07139g5.349ON3583685852e-72
TPHA0D020705.349ON3733715498e-67
SAKL0G08888g5.349ON3793525308e-64
KLTH0H14806g5.349ON3463385112e-61
ZYRO0D10120g5.349ON3293675084e-61
TBLA0H019805.349ON3593714042e-45
NCAS0F028505.349ON2812983973e-45
NDAI0I015505.349ON2762943939e-45
Kwal_34.159865.349ON2312443873e-44
Ecym_81845.349ON2482543534e-39
AGR349W5.349ON2422473168e-34
KLLA0B10142g5.349ON2932101935e-16
Suva_13.3636.256ON211136760.35
Kpol_1048.671.406ON157368780.42
Smik_13.3876.256ON21263702.4
KLLA0A07579g5.689ON72084685.7
TBLA0B056002.476ON141297686.3
ZYRO0B12650g4.261ON125346687.2
AFL124C6.243ON62941678.1
KLTH0C10230g6.56ON78366678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01870
         (341 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   659   0.0  
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   287   2e-94
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   277   1e-90
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   272   8e-89
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   270   5e-88
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   261   2e-84
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   245   1e-78
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   238   1e-75
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   229   2e-72
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   216   8e-67
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   208   8e-64
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   201   2e-61
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   200   4e-61
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   160   2e-45
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   157   3e-45
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   155   9e-45
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   153   3e-44
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   140   4e-39
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   126   8e-34
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    79   5e-16
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    34   0.35 
Kpol_1048.67 s1048 (189209..193930) [4722 bp, 1573 aa] {ON} (189...    35   0.42 
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    32   2.4  
KLLA0A07579g Chr1 complement(679469..681631) [2163 bp, 720 aa] {...    31   5.7  
TBLA0B05600 Chr2 (1333565..1337803) [4239 bp, 1412 aa] {ON}            31   6.3  
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    31   7.2  
AFL124C Chr6 complement(201644..203533) [1890 bp, 629 aa] {ON} S...    30   8.1  
KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} simila...    30   8.6  

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/341 (96%), Positives = 329/341 (96%)

Query: 1   MSNIEELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEYKGPGDETLLEPLQD 60
           MSNIEELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEYKGPGDETLLEPLQD
Sbjct: 1   MSNIEELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEYKGPGDETLLEPLQD 60

Query: 61  QNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSSPSKR 120
           QNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSSPSKR
Sbjct: 61  QNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSSPSKR 120

Query: 121 RQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMDTMRE 180
           RQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMDTMRE
Sbjct: 121 RQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMDTMRE 180

Query: 181 MLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEVSAGLAIS 240
           MLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEVSAGLAIS
Sbjct: 181 MLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEVSAGLAIS 240

Query: 241 YEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISNLRISLSSTKVSFSIGTFEIELYLQ 300
           YEDIYLFSKEIYLQLLKESAR            ISNLRISLSSTKVSFSIGTFEIELYLQ
Sbjct: 241 YEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISNLRISLSSTKVSFSIGTFEIELYLQ 300

Query: 301 DNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLRQLK 341
           DNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLRQLK
Sbjct: 301 DNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLRQLK 341

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  287 bits (735), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 161/389 (41%), Positives = 229/389 (58%), Gaps = 59/389 (15%)

Query: 1   MSNIEELEQDIASLRRE-------------------------KQPANTVMREFEELFQQF 35
           M  +E+LEQDI +L +E                         K   N V++EFE +F++F
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIRDKRLGGSRTKDTTNVVIQEFESVFEKF 60

Query: 36  PQLRDLLYKEYK---GPGDETLLEPLQDQNLVEKFQTPSRKRPKT--------------- 77
           PQL D+LY +Y+      D+     +         QT +R    T               
Sbjct: 61  PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQQG 120

Query: 78  -KSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSSPSKRRQR--LNGDDRSSIGN 134
            +S ++LPEDEWVL+NQVP+EH +FD+SVGD+LDT+ILSSPSKR++    +G D S    
Sbjct: 121 NRSDEDLPEDEWVLKNQVPIEHQMFDQSVGDLLDTDILSSPSKRKRNPAQHGADTSR--- 177

Query: 135 LPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSK 194
                LH++I++EN +RLFGIT+FPVVDP+DLQ+N ETQ+M   REMLG+R D+F++   
Sbjct: 178 -----LHEKILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDS 232

Query: 195 KYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQ 254
           K++KP Y+LLKK +K+  W+IFKHTIP  I V  +F  ++ GLA S  DIYLFSKE+Y++
Sbjct: 233 KFEKPFYVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVR 292

Query: 255 LLKESARXXXXXXXXXXXXISNLRISLSSTKVSFSIG---TFEIELYLQDNIIISCSFVK 311
           L++ S R            I +LR  L ST VSF  G     +++L +Q+N ++S    K
Sbjct: 293 LVQSSLRLKHFNSLQERGLIEDLRGDLRSTNVSFMTGPRFMIDVKLTIQNNEVVSVYVKK 352

Query: 312 GIRDASVRSKWEVLFNGPLEDLEYKLRQL 340
           G  +  V+SK  +   GP++DLE KL+QL
Sbjct: 353 GKEE--VKSKLAMFLTGPIDDLEGKLKQL 379

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  277 bits (708), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 225/345 (65%), Gaps = 19/345 (5%)

Query: 5   EELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEYKGPGDETLLEPLQDQNL- 63
           EEL+  I + R+ +  +N +++EFE+LF+QFPQL + L+ E+        LE + D+ + 
Sbjct: 26  EELKTSIKNKRKNEDSSNPIVQEFEDLFEQFPQLNNFLFNEHPE------LEEMDDRGVS 79

Query: 64  VEKFQTPS-------RKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSS 116
           +     P+       +KR K  + +NLPE EWVL+ Q  ++H +FD  V D+LDT+IL+S
Sbjct: 80  IASVVIPATLIPYEPKKRAKLNNDENLPEQEWVLKTQPMVQHQMFDPEVADLLDTDILTS 139

Query: 117 PSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMD 176
           PSKR+++L  +D +SI       L D I+VEN++R+FGITFFP+VDP DL++  ++ E+ 
Sbjct: 140 PSKRKRKLKIEDINSIDK---GKLEDSIVVENVYRIFGITFFPLVDPIDLKIKDDSDEIF 196

Query: 177 TMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEVSAG 236
             REMLGIRL++F E + K++KP YILLKK+IKS++W +FKHT+PS+I V+ IF++ + G
Sbjct: 197 VDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFLFKHTVPSFIDVQGIFDDTNGG 256

Query: 237 LAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISNLRISLSSTKVSFSIGTFEIE 296
           L +SY+D YLF+K ++LQL++   R            I +L + L S+  SF +   ++E
Sbjct: 257 LVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLNLDLESSMASFFVKDVKVE 316

Query: 297 LYLQDNIIISCSFVKGIRDASV--RSKWEVLFNGPLEDLEYKLRQ 339
           L+++ N I+SCS +  I D S   ++KWE+   G L+DLE KL  
Sbjct: 317 LFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDLELKLNH 361

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  272 bits (696), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 145/349 (41%), Positives = 224/349 (64%), Gaps = 27/349 (7%)

Query: 5   EELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEY--------KGPGDETLLE 56
           EEL+ +I + R+ +   N +++EFEELF QFPQL + L+ E+        K    ++++ 
Sbjct: 26  EELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVI 85

Query: 57  PLQDQNLVEKFQTPS----RKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTE 112
           P           TP+    +KR K  + +N+ E EWVL+ Q  ++H +FD +V D+LDT+
Sbjct: 86  P----------ATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQHQMFDSAVADLLDTD 135

Query: 113 ILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIET 172
           IL+SPSKR+++L   D   I     ++L D I++EN++R+FGITFFP+VDP+DL++   +
Sbjct: 136 ILTSPSKRKRKLKIAD---IDTSDRNDLEDSIIMENVYRMFGITFFPLVDPADLKIKDVS 192

Query: 173 QEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEE 232
            E+   REMLGIRL++F E   K++KP YILLKK+IKS++W +FKHTIPS+I V+ IF E
Sbjct: 193 DEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNE 252

Query: 233 VSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISNLRISLSSTKVSFSIGT 292
            + GL IS++++YLF+K ++LQL++   R            I +L + L S+ VSF +  
Sbjct: 253 TNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVKD 312

Query: 293 FEIELYLQDNIIISCSFVKGIRDASV--RSKWEVLFNGPLEDLEYKLRQ 339
            ++EL+++ N I+SCS +  I D S   +SKWE++  G L+DLE KL  
Sbjct: 313 VKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLELKLNH 361

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  270 bits (690), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 151/370 (40%), Positives = 230/370 (62%), Gaps = 40/370 (10%)

Query: 1   MSNIEELEQDIASL---------------------RREKQPANTVMREFEELFQQFPQLR 39
           MS I++L+QDI SL                     R+ ++ AN +++EFE+LF QFPQL 
Sbjct: 1   MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60

Query: 40  DLLYKEYKGPGDETLLEPLQDQNL----VEKFQTP----SRKRPKTKSSDNLPEDEWVLQ 91
           + L+ E+        LE   D+++     +   TP     +KR K ++ + LPE EWVL+
Sbjct: 61  NFLFNEHPE------LEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLK 114

Query: 92  NQVPLEHNLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFR 151
            Q  ++H +FD  V D+LDT+IL+SPSKR+++L  DD S+        L D I++EN++R
Sbjct: 115 TQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDR---SELEDYIVLENVYR 171

Query: 152 LFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSD 211
           +FGITFFP+VDP DL++   + E+   REMLGIRL++F E + +++KP Y+LLKK+IKS+
Sbjct: 172 MFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSN 231

Query: 212 TWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXX 271
           +W +FKHTIPS+I V+ IF++ + GL IS++D YLF+K ++LQL++   R          
Sbjct: 232 SWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAK 291

Query: 272 XXISNLRISLSSTKVSFSIGTFEIELYLQDNIIISCSFVKGIRDASV--RSKWEVLFNGP 329
             I +L + L S+ VSF +   ++EL+++ N I+SCS +  I D S   +SKWE+   G 
Sbjct: 292 KIIHDLDLDLESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGS 351

Query: 330 LEDLEYKLRQ 339
           L+DLE KL  
Sbjct: 352 LDDLELKLNH 361

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  261 bits (667), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 219/350 (62%), Gaps = 38/350 (10%)

Query: 1   MSNIEELEQDIASL---------------------RREKQPANTVMREFEELFQQFPQLR 39
           MS I++L+QD+ SL                     R+ +   N +++EFE+LF QFPQL 
Sbjct: 1   MSKIDDLQQDVESLLSEIKSLEKSREELKTKLRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60

Query: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQ-TPS-------RKRPKTKSSDNLPEDEWVLQ 91
           + L+ E+        L+ + D+++    + TP+       +K+ K ++ +NLPE EWVL+
Sbjct: 61  NFLFNEHPE------LDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLK 114

Query: 92  NQVPLEHNLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFR 151
            Q  ++H +FD  V D+LDTEIL+SPSKR+++LN ++   I       L D I++ENI+R
Sbjct: 115 TQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEE---INTSDKSMLEDSIILENIYR 171

Query: 152 LFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSD 211
           +FGITFFP+VDP DL+M   + E+   REMLGIRL++F+E + K++KP YILLKK+IKS+
Sbjct: 172 MFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSN 231

Query: 212 TWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXX 271
           +W +FKHTIPSYI V+ IF + + GL IS +D YLF+K +++QL++   R          
Sbjct: 232 SWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAK 291

Query: 272 XXISNLRISLSSTKVSFSIGTFEIELYLQDNIIISCSFVKGIRDASVRSK 321
             I NL + L S+ VSF +   ++EL+L+ N I+SCS +  I D + ++K
Sbjct: 292 KIIHNLDLDLQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNK 341

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  245 bits (626), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 210/362 (58%), Gaps = 40/362 (11%)

Query: 1   MSNIEELEQDIASLRRE---------------------KQPANTVMREFEELFQQFPQLR 39
           MS +E+L+QDI +L RE                     K   + V++ F+ +F QFPQL 
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60

Query: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPL-EH 98
           D+L +E     +E+  +P+            S KR +    ++  +D+    +  P+ +H
Sbjct: 61  DVLSEETTARHEESTQDPI------------SLKRKRNTDVNSPKKDKSFRGDHPPVFQH 108

Query: 99  NLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFF 158
            +FD+S+   +DT IL+SPSK R+R+             D   +Q+++EN++R+FGIT+F
Sbjct: 109 QMFDESIAQFIDTNILTSPSKARRRMKDTKYDE------DAPRNQVLLENVYRMFGITYF 162

Query: 159 PVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKH 218
           PVVDP+DL++N ET + +  REM+GIRL++F+E   +++KP YILLKKKIKSD+W +FKH
Sbjct: 163 PVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKH 222

Query: 219 TIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISNLR 278
           T+P +I V  +F + + G  IS+E+IYLF+K +Y QL++ +AR            I NL 
Sbjct: 223 TVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLD 282

Query: 279 ISLSSTKVSFSIGTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLR 338
           + L +  VSFS    +  L L  + I+SCS V    D +V+ + E +F GPL +LE KL+
Sbjct: 283 LDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLK 342

Query: 339 QL 340
            L
Sbjct: 343 HL 344

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  238 bits (608), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 221/366 (60%), Gaps = 27/366 (7%)

Query: 1   MSNIEELEQDIASLRREKQP------------ANT---------VMREFEELFQQFPQLR 39
           MS++ ELEQD+ +LRRE +             AN          + ++FE+LFQ  PQL 
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSD-NLPEDEWVLQNQVPLEH 98
           DLL  +      +      +           S KR K    D ++ EDEW+L++Q  ++H
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDEGKHMTSEISNKRVKPNEQDTDISEDEWILKSQPLVQH 120

Query: 99  NLFDKSVGDILDTEILSSPSKRRQRLNG---DDRSSIGNLPLDNLHDQIMVENIFRLFGI 155
            +F+  + D+++T+IL+SPSKR+ +L     D  +S GN    NL+ +I +EN+FRLFGI
Sbjct: 121 KMFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGN-KQKNLNKKIRIENLFRLFGI 179

Query: 156 TFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDI 215
           TFFP+VDP+DL+MN E + M+  REMLGIRL+I++E +  ++KP YILLKKK+K D+W I
Sbjct: 180 TFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDSWMI 239

Query: 216 FKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXIS 275
           FKHTIPSYI +E  +  ++ G+  +Y++I +F+KE+Y++L+  + R            I 
Sbjct: 240 FKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQKIQKLTELEYIR 299

Query: 276 NLRISLSSTKVSFS-IGTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLE 334
           + +  ++S++V  + I  +EIEL+L++  I+SC       +  +++KW+++  G +++L 
Sbjct: 300 DCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPTDRMEPMLKNKWQIILLGTIDELP 359

Query: 335 YKLRQL 340
            KL QL
Sbjct: 360 NKLSQL 365

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  229 bits (585), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/368 (38%), Positives = 211/368 (57%), Gaps = 44/368 (11%)

Query: 3   NIEELEQDIASLRRE---------------KQPA-----NTVMREFEELFQQFPQLRDLL 42
            +EEL QD+ +L  E               K P      +    +F ++F++ P LRDLL
Sbjct: 5   TVEELLQDVEALTSEINGLQEKSKKLREQLKHPEQFIKFDKAFGDFNDIFEKNPGLRDLL 64

Query: 43  --YKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSS------DNLPEDEWVLQNQV 94
             Y+  K   D      + D N++     P   + K++SS       +LPE EWVL+ Q 
Sbjct: 65  LGYEIDKSATD------VDDTNII-----PVTPQKKSRSSVVNEKLHSLPEHEWVLKTQP 113

Query: 95  PLEHNLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFG 154
            +EH LFD+SV D++DT+IL SPSKR+Q++   + +S G +      + I  ENI+RLFG
Sbjct: 114 LVEHRLFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVS----KEPIQYENIYRLFG 169

Query: 155 ITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWD 214
           I++FP+VDPSDL  + +T++M   R+MLGIR DIF+E SK ++KP YILLKK  KSD W 
Sbjct: 170 ISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKSAKSDDWK 229

Query: 215 IFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXI 274
           +FK+T+P+YI VE IF EV+ GL  +Y+D+YLF+K IYL L++   R            I
Sbjct: 230 LFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFLQLEKDGII 289

Query: 275 SNLRISLSSTKVSFSI-GTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDL 333
            +L + L S  +  ++ GT +IE ++    II+C+    I     + +  ++  G L DL
Sbjct: 290 DDLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTIKSKIMSDDEKERLAMMLQGSLHDL 349

Query: 334 EYKLRQLK 341
           +YKL  L+
Sbjct: 350 KYKLISLR 357

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  216 bits (549), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 209/371 (56%), Gaps = 32/371 (8%)

Query: 1   MSNIEELEQDIASLRREKQPANT---------------------VMREFEELFQQFPQLR 39
           MS ++ L QDI +LR+E +  NT                     +++EF  LF QFP L 
Sbjct: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60

Query: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKT-KSSDNLPEDEWVLQNQVPLEH 98
           +LL KE K    E L +  +D+    + +   RK+ +     DN+PE EW+L  Q  +EH
Sbjct: 61  ELLSKE-KIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEH 119

Query: 99  NLFDKSVGDILDTEILSSPSKRRQRLNGDD-RSSIGNLPLDN------LHDQIMVENIFR 151
            +F   + + ++T+IL+SPSKR++ + G +   +  N+   N      L  +I+ EN FR
Sbjct: 120 KIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFR 179

Query: 152 LFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSD 211
           LFGI++FPVVDP DL  +    E++  REM+GIRL++FD+    ++KP YILLKKK KS+
Sbjct: 180 LFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSN 239

Query: 212 TWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXX 271
            W +FK+TIP+YI +  IF+ ++ G+ ++YEDIY+F+K++Y+QLL    R          
Sbjct: 240 NWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEA 299

Query: 272 XXISNLRISLSSTKVSFSI--GTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGP 329
             +S++ I L+   +  +I   T ++ LYL+ + + S S      D   + +W++   GP
Sbjct: 300 NIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGP 359

Query: 330 LEDLEYKLRQL 340
           +  +  K+R L
Sbjct: 360 VSGISRKIRYL 370

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  208 bits (530), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 123/352 (34%), Positives = 200/352 (56%), Gaps = 28/352 (7%)

Query: 3   NIEELEQDIASLRREKQPANTV---MREFEELFQQFPQLRDLLYKEY------KGPGDET 53
           +I++ E  +  LR E +    +     E+  +F+ FP L  LL ++       +G  +  
Sbjct: 31  HIQKYEDQLERLRHESEKVPVIELTTDEYGPIFEAFPHLHKLLSEKLFQQESNRGHDNTA 90

Query: 54  LLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEI 113
           L  P +   +     +P ++        ++PE EWVL+ Q  +EH +FD  + D++DTEI
Sbjct: 91  LSTPKKSTTI-----SPRKRVVNQVLPPSMPEHEWVLRMQPAVEHKMFDSDIADLIDTEI 145

Query: 114 LSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQ 173
           L+SPSKR+++L     S + N    NL D + +EN++R+ GIT FPVVDPSDL++N ET+
Sbjct: 146 LTSPSKRKEKL-----SKVHNNK-QNLIDYVRLENVYRMTGITVFPVVDPSDLKVNKETK 199

Query: 174 EMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEV 233
           E + +REM+G+RL++F+E+   ++KP Y+LLKK  K D+WDIFKHTIP+YI ++ +FE+ 
Sbjct: 200 EYEILREMMGVRLEVFNEVLSTFEKPYYVLLKKSSKRDSWDIFKHTIPNYIDIQLLFEKT 259

Query: 234 SAGLAISYEDIYLFSKEIYLQLLKESARXX-----XXXXXXXXXXISNLRISLSSTKVSF 288
           + G+   Y   YLF+K++Y  LL+ S +                  S+L +++ S KVSF
Sbjct: 260 NGGIITDYSGTYLFAKKVYQLLLQTSLKAQVFEVLAREDSRISQIESDLAVNVVSFKVSF 319

Query: 289 SIGTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLRQL 340
              +F+  L +  N +   S    +    VR +WE    GP+++   KL Q+
Sbjct: 320 KNLSFKTVLQMDWNNVHGASI--KLNSEHVR-RWENYLLGPVDEFPRKLAQV 368

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  201 bits (511), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 188/338 (55%), Gaps = 36/338 (10%)

Query: 14  LRREKQPANTVMREFEELFQQFPQLRDLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRK 73
           L+ +K+  + V  EFE LFQ+ P+L+  L ++     D     P         + +P +K
Sbjct: 32  LQAQKKGVSEVPVEFEGLFQKNPELKHTLSQKIFKETDSFPQTP---------YSSP-KK 81

Query: 74  RPKTKS-------SDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSSPSKRRQRLNG 126
           RP   S       S ++PE EWVL+ QVP+EH  FD +V D+++T+IL+SPSKR++    
Sbjct: 82  RPLKSSAAQLSNLSPDIPESEWVLKTQVPVEHKFFDSAVADLIETDILTSPSKRKRAAQS 141

Query: 127 DDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRL 186
                      + L  ++ +ENI+R+ GI+ FPVVDPSDL+   E  E++  R+MLG+RL
Sbjct: 142 RAH--------EELVQKVQIENIYRMLGISTFPVVDPSDLE-GTEEDEINIKRKMLGLRL 192

Query: 187 DIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEV-SAGLAISYEDIY 245
           ++F+EL + ++ P YIL K+  K+  W+IF+HT+PSY+GVE++F++V S GL  +  +IY
Sbjct: 193 ELFNELERSFEPPYYILFKQNPKNSYWNIFRHTVPSYVGVEQMFQQVRSNGLLANQSEIY 252

Query: 246 LFSKEIYLQLLKESARXXXXXXXXXXXXISNLRISLSSTKVSFSI---GTFEIELYLQDN 302
            F+K++Y  LL  S +            IS L I  S T VSF I   G F ++L L   
Sbjct: 253 TFAKKVYKSLLSISVKTQIFRRTEKKEAISQLEIDPSCTSVSFHIEKLGCF-VKLKLDAT 311

Query: 303 IIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYKLRQL 340
            +I+CS +           W     GP+  L  ++  L
Sbjct: 312 DVIACSCI-----PHENVSWNAQMLGPVVSLPDRIESL 344

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  200 bits (508), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 133/367 (36%), Positives = 201/367 (54%), Gaps = 68/367 (18%)

Query: 1   MSNIEELEQDIASLRRE---------------------KQPANTVMREFEELFQQFPQLR 39
           M ++EELEQDI SL RE                     +   + V++EFE +F +FP+L 
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKFPKLY 60

Query: 40  DLLYKEYK---GPGDETLLEP-LQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVP 95
           ++L +E +      ++T  EP   D + V        KR K + SD              
Sbjct: 61  EVLARENQIVDSNDNDTSDEPSTVDSSFV--------KRRKLEFSDG------------S 100

Query: 96  LEHNLFDKSVGDIL-DTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFG 154
           +++ +FDKS+ D+L DT   +SP KRR +L               L  Q+ +EN +RLFG
Sbjct: 101 VQNKMFDKSIADLLGDTSSSTSPGKRRSKLQN----------FKGLESQVSIENAYRLFG 150

Query: 155 ITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWD 214
           ITFFP+VDPSD    I  Q  D  R+MLGIRL++F+E  ++++KP YILLK+ +K ++W 
Sbjct: 151 ITFFPLVDPSD----INFQRNDINRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWS 206

Query: 215 IFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXI 274
           +FKHTIP++I +E IF+++  G+  +Y+ +YLF+K++Y+QLL  S R            I
Sbjct: 207 LFKHTIPAFIDLESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLI 266

Query: 275 SNLRISLSSTKVSFSI-GTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDL 333
           SNL I L    VSF I G   + L+LQD+ +ISC       D     + ++L  GP+++L
Sbjct: 267 SNLEIDLQIAAVSFDIQGMKRVRLFLQDDQVISC-------DTFDDDELKMLLLGPVKEL 319

Query: 334 EYKLRQL 340
           + KL +L
Sbjct: 320 KLKLGRL 326

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  160 bits (404), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 117/371 (31%), Positives = 189/371 (50%), Gaps = 48/371 (12%)

Query: 1   MSNIEELEQDIASLRRE----KQPANTVMREFE---EL----------FQQF-PQLRDLL 42
           MS + ELE+ I  L  E     +  N + ++FE   E+          F  F P+L+++L
Sbjct: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIPELQNVL 60

Query: 43  YKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFD 102
                   DE+      D N +      +R R +   S         +  Q+ LEH LFD
Sbjct: 61  TSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRS---------IPGQLTLEHKLFD 111

Query: 103 KSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLH------DQIMVENIFRLFGIT 156
             +  +L  E++S PS+RR+R+          L   NLH      + +++E ++R+ GIT
Sbjct: 112 DEISRLLSPEVVSLPSQRRKRMK---------LERPNLHIREILKNFVILEIVYRMVGIT 162

Query: 157 FFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIF 216
           FFPVVDP+DL+     + +   REMLGIRL+I+++L   ++KP YILLK+  KS  W IF
Sbjct: 163 FFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIF 222

Query: 217 KHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISN 276
           K+TIP+YI +  +F +++ G+  +  DI+LF+K++Y  L   S +              N
Sbjct: 223 KYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFEN 282

Query: 277 LRISLSSTKVSFSIGT-FEIELYLQDNIIISCSF--VKGIRDASVRS---KWEVLFNGPL 330
           L I L   ++SF   + + I + L++  II+C+    +   +   R+   KWE+ F GP+
Sbjct: 283 LNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPI 342

Query: 331 EDLEYKLRQLK 341
           + L  KL Q +
Sbjct: 343 KKLVSKLEQFR 353

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  157 bits (397), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 162/298 (54%), Gaps = 64/298 (21%)

Query: 1   MSNIEELEQDIASLRREKQP---------------------ANTVMREFEELFQQFPQLR 39
           M+ I +LEQDIA+L+ E Q                      ++ ++ E  +L  QFPQL 
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 40  DLLYKE--------YKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQ 91
           ++L  +             +E+  +   D   ++ FQ  ++K      +D+LPE EWVL+
Sbjct: 61  EILLSKPSVTESSRSTSNEEESDKKRKLDNEKIQAFQD-AKKSKLNNENDDLPEHEWVLK 119

Query: 92  NQVPLEHNLFDKSVGDILDTEILSSPSKRRQRL-NGDDRSSIGNLPLDNLHDQI---MVE 147
           NQ P+EH +FD SV D+L+TE+LSSPSKRR  L NG D         +N H Q    ++E
Sbjct: 120 NQRPVEHKMFDTSVADVLNTEMLSSPSKRRLILKNGQDEME------ENKHLQKEYRLLE 173

Query: 148 NIFRLFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKK 207
           N+FR+ GI+FF  VDP+DL+            +M+GIRLD F++ SK Y    YI+LKK+
Sbjct: 174 NVFRIVGISFFDAVDPNDLE-----------SDMIGIRLDPFNQPSKVY----YIILKKE 218

Query: 208 IKSDT---WDIFKHTIPSYIGVEKIFEEVS-----AGLAI-SYEDIYLFSKEIYLQLL 256
            K++    W I KHTIP YI V   F E         + I +++DIYL +KE+Y++LL
Sbjct: 219 AKNNREGLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYVKLL 276

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  155 bits (393), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 159/294 (54%), Gaps = 54/294 (18%)

Query: 1   MSNIEELEQDIASLRRE-----------KQPANTVM-----------REFEELFQQFPQL 38
           MS+I +LEQDIA+L+ E           K P   +            R+ + L  QFPQL
Sbjct: 1   MSDITDLEQDIAALKVELEGLRAKRDALKDPGKDIQKDTSIAETNADRQLQSLLDQFPQL 60

Query: 39  RDLLYKEY-----------KGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDE 87
            D+L  +             G  D +LL     +    +  +P+ K  +   S NLPE E
Sbjct: 61  HDILLSDNAIDKSSPVLHNNGEDDTSLLS----RKRKSEHGSPNTKHKRLSLSANLPEHE 116

Query: 88  WVLQNQVPLEHNLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQ-IMV 146
           WVL+ Q P+EH +FD SV D+L T+ILSSPSKR   +   +R S      DNL    I++
Sbjct: 117 WVLKMQPPIEHKMFDTSVADVLGTDILSSPSKR--IIETKERQS------DNLQRTLILL 168

Query: 147 ENIFRLFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDI-FDELSKKYDKPMYILLK 205
           E+ ++  G+ F  + DP+DL+MN + + +    +MLG+R ++   E ++KY    Y+LLK
Sbjct: 169 EDFYKKLGVNFLQLFDPNDLEMNEKMEALQMKGDMLGVRFELPSSEGAQKY----YLLLK 224

Query: 206 KKIKSDTWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKES 259
           K+  SD W  +KH++P+ I V + F  V+A    S+EDIYL +K+IYLQLL  +
Sbjct: 225 KETASDYWIPYKHSLPNIIDVNEYFVNVAAE---SHEDIYLIAKDIYLQLLTSA 275

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  153 bits (387), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 137/244 (56%), Gaps = 17/244 (6%)

Query: 100 LFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFP 159
           +FD +V D+ +T+IL+SPSKR++ +N              L  ++ +EN++R  G++ FP
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKH--------QELIKKLDIENLYRTIGLSTFP 52

Query: 160 VVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHT 219
           VVDPSD++ + E  E    R M+G+RL+IF+EL K ++ P Y+L K+ +K+  W+IF+HT
Sbjct: 53  VVDPSDVEQD-EDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHT 111

Query: 220 IPSYIGVEKIFEEVSAGLAIS-YEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISNLR 278
           IPSY+GVE++FE+      ++    IY F K++Y  LL  S +            +S L 
Sbjct: 112 IPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLV 171

Query: 279 ISLSSTKVSFSI--GTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYK 336
           I  S T  SF +  G+  ++L L +  I +CS +          KW     GP++ L  +
Sbjct: 172 IDPSCTSASFQMMQGSVSVKLKLSETDITACSSI-----PRSSQKWTATILGPVQSLPRR 226

Query: 337 LRQL 340
           L+ L
Sbjct: 227 LQTL 230

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  140 bits (353), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 86/254 (33%), Positives = 139/254 (54%), Gaps = 15/254 (5%)

Query: 93  QVPLEHNLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDN-LHDQIMVENIFR 151
           Q  +EH +FD ++    DTEI+ SPSKR + +    +SS  ++  DN L   + +EN +R
Sbjct: 2   QHDVEHRMFDPTIASFFDTEIVRSPSKRNKLM----KSSATSIRPDNELEKFVEIENCYR 57

Query: 152 LFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSD 211
           + GITFFP+VDP  L  N        + E+LGIRL++F+E + KY+ P YI+LK++ K++
Sbjct: 58  MSGITFFPLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKAN 117

Query: 212 -TWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXX 270
             WD++KHTIP  I +E+I+     G+    +++Y+F+K+ Y++LL    R         
Sbjct: 118 QIWDLYKHTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYR-LQFICNLD 176

Query: 271 XXXISNLRISLSSTKVSFSIGTFEI---ELYLQDNIIISCSFVKGIRDASVRSKWEVLFN 327
                N+++   +  +SF +   EI      L+D  II C       D    ++W  +  
Sbjct: 177 PQLFENIKVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCDI-----DIERHNEWSKIIL 231

Query: 328 GPLEDLEYKLRQLK 341
           GPL DL  K+  L+
Sbjct: 232 GPLVDLPDKILILQ 245

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  126 bits (316), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 125/247 (50%), Gaps = 16/247 (6%)

Query: 100 LFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFP 159
           +FD ++   LDTE+L SPSKR + L+     S        L + I VEN +R+ GITFFP
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQR----ELRNFIEVENCYRMCGITFFP 56

Query: 160 VVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDT-WDIFKH 218
           +VDP  L    +  E   + EMLGIRL++F+E ++++D P Y+LL++  K  T W +FKH
Sbjct: 57  LVDPGRLGGQDKDNE-GIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKH 115

Query: 219 TIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXXXXXXXXXXXXISNLR 278
           T+P  +  E+I+     G   S  D+YLF+K+ Y +L+    R              N+R
Sbjct: 116 TLPKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFR-LQFIARLDPYLFENIR 174

Query: 279 ISLSSTKVSFSIGT----FEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLE 334
               +  +SF I        + + L+   + SC       D     +W  +  G L DL 
Sbjct: 175 TDSYAAMLSFLISGGAQPLAVTVLLEGREVRSCQL-----DQQQHDEWAHVLVGALADLP 229

Query: 335 YKLRQLK 341
            K+R LK
Sbjct: 230 NKVRVLK 236

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 79.0 bits (193), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 95/210 (45%), Gaps = 31/210 (14%)

Query: 117 PSKRRQRLNGDDRSSIGNLPLDNLHDQIMV----------ENIFRLFGITFFPVVDPSDL 166
           P     ++ G D S   N  + + H+++            EN  RL G++ FPV      
Sbjct: 74  PGTTTGQIQGIDSSIRSNFGVSSGHNEVAGFKSITDFVQWENSVRLIGVSLFPV------ 127

Query: 167 QMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKS-DTWDIFKHTIPSYIG 225
                    D + E +GIRL++FDELS KYD P Y++LK  +K    W++FKH +P YI 
Sbjct: 128 -------NYDNI-EFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYIN 179

Query: 226 VEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARXX----XXXXXXXXXXISNLRISL 281
           + + ++ ++     S  +I  F+   Y  LLK  +R                 S L I  
Sbjct: 180 IHQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDN 239

Query: 282 SSTKVSFSIGT--FEIELYLQDNIIISCSF 309
               VSF +G    +I++   D+ II C+F
Sbjct: 240 MGLNVSFRLGADIIKIKVDDGDDEIIDCTF 269

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 10  DIASLRREKQPANTVMREFEELFQQFPQLRD--LLYKEYKGPGDETLLEPLQDQNLVEKF 67
           D+ SLRR +Q A+    E     + FPQLR   ++ +    P    +  P   QN +  +
Sbjct: 77  DLVSLRRLQQLASNTASEQNMPARMFPQLRPYGIVVQPAAHPQTLPIASPATAQNTIALY 136

Query: 68  QTPSRKRPKTKSSDNLPE---------DEWVLQNQVPLEHNLFDKSVGDILDTEILSSPS 118
            +P    P   +   LP+          + +  NQ+P+++    +   DI DT   +SPS
Sbjct: 137 ASPYYPHPLPSAPMALPQLPPPPIYGYIQPMFLNQLPIQNRDIVELPPDIGDTS--ASPS 194

Query: 119 KRRQRLNGDDRSSIGN 134
           + R   +  D S   N
Sbjct: 195 RVRGLNHAKDASPDAN 210

>Kpol_1048.67 s1048 (189209..193930) [4722 bp, 1573 aa] {ON}
            (189209..193930) [4722 nt, 1574 aa]
          Length = 1573

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 130  SSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIF 189
            S IG +   +  D I+VE   R+   + FPVV P  +Q NI+     + +E+  I   + 
Sbjct: 1142 SKIGTIVDKDNEDAILVEKNIRMKDQSIFPVV-PKLIQKNIDFSRSASYKELFEITRLVL 1200

Query: 190  DELSKKYD 197
            DEL  +Y+
Sbjct: 1201 DELDAQYN 1208

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 10  DIASLRREKQPANTVMREFEELFQQFPQLRD--LLYKEYKGPGDETLLEPLQDQNLVEKF 67
           D+ SLRR +Q AN    E     + FPQLR   ++ +    P +  +  P   QN +  +
Sbjct: 77  DLMSLRRLQQSANNTANEPNATTRMFPQLRPYGIVVQPTPVPYNLPIATPASPQNTISLY 136

Query: 68  QTP 70
             P
Sbjct: 137 APP 139

>KLLA0A07579g Chr1 complement(679469..681631) [2163 bp, 720 aa] {ON}
           weakly similar to uniprot|Q7LGN4 Saccharomyces
           cerevisiae YOR080W DIA2 Protein of unknown function
           involved in invasive and pseudohyphal growth
          Length = 720

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%)

Query: 33  QQFPQLRDLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQN 92
           ++FP L DL  +   G      L+ LQ+ N++++ +  + +   T+S+ +     W  + 
Sbjct: 483 KKFPNLTDLWLERNTGLSLMGFLQSLQEPNVLKRLKYFTFRESSTESNRSFNGQMWTDEQ 542

Query: 93  QVPLEHNLFDKSVGDILDTEILSS 116
             P+  NL      DI+++ I  S
Sbjct: 543 IEPILANLGAVQTLDIMNSAIARS 566

>TBLA0B05600 Chr2 (1333565..1337803) [4239 bp, 1412 aa] {ON} 
          Length = 1412

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 12/97 (12%)

Query: 84  PEDEWV--LQNQVPLEHNLFDKSVGDILDTEILS-SP-----SKRRQRLNGDDRSSIGNL 135
           P++E +  L N   L+  + D +     DT   S SP     S+ ++R+N    S++ N 
Sbjct: 424 PDNEMLDLLSNTFNLQSFMNDNTASSSKDTPNKSPSPKNEIDSELKERINKKLDSTLNN- 482

Query: 136 PLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIET 172
             D+LHD ++  NIF  F     P+  P++ Q N ET
Sbjct: 483 --DSLHDDLLNSNIFN-FNFDSTPIKSPNNKQKNFET 516

>ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa]
          {ON} similar to uniprot|P35207 Saccharomyces cerevisiae
          YLR398C SKI2 blocks translation of non-poly(A) mRNAs
          antiviral protein putative helicase
          Length = 1253

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 1  MSNIEELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEY 46
          +S IE +  D     R  QP N +     +  QQFPQ RD  YK++
Sbjct: 27 LSQIEPVHTDDGVRERFLQPTNVLPWSLLDQVQQFPQSRDTDYKDF 72

>AFL124C Chr6 complement(201644..203533) [1890 bp, 629 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR172W
           (HOT1)
          Length = 629

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1   MSNIEELEQDIASLRREK-QPANTVMREFEELFQQFPQLRD 40
           + NI+  +Q IAS+R E  +   ++M+E  EL QQ P L D
Sbjct: 168 LGNIDAQQQQIASMRSESMEMLGSLMKEVRELKQQVPVLDD 208

>KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} similar
           to uniprot|Q99287 Saccharomyces cerevisiae YOR165W SEY1
           Synthetic Enhancement with YOP1
          Length = 783

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%)

Query: 163 PSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPS 222
           P DL     +     ++E+  + L  +D  + +Y KP+Y+  ++ +     + FK TI  
Sbjct: 319 PVDLHCRELSDLAGKLQELKSLCLQEYDTYASRYAKPVYMDNRRDLSHKIENKFKETISK 378

Query: 223 YIGVEK 228
           ++ V+K
Sbjct: 379 FLDVQK 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,368,370
Number of extensions: 1660260
Number of successful extensions: 5849
Number of sequences better than 10.0: 59
Number of HSP's gapped: 5987
Number of HSP's successfully gapped: 59
Length of query: 341
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 231
Effective length of database: 40,868,139
Effective search space: 9440540109
Effective search space used: 9440540109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)