Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C018605.350ON25924012561e-177
NCAS0F028605.350ON2532386204e-80
ZYRO0D10142g5.350ON2552376101e-78
TDEL0E027705.350ON2582386082e-78
NDAI0C043105.350ON2592395988e-77
Kpol_339.115.350ON2582395856e-75
SAKL0G08866g5.350ON2552245734e-73
CAGL0H07117g5.350ON2602385701e-72
KLTH0H14828g5.350ON2512375587e-71
Suva_2.4885.350ON2742525591e-70
YDR319C5.350ON2742535485e-69
Kwal_34.159845.350ON2512215457e-69
Skud_4.5855.350ON2742525442e-68
Smik_4.5785.350ON2742435433e-68
TPHA0E011305.350ON2772464991e-61
TBLA0A031105.350ON2752324947e-61
KNAG0C055105.350ON2642494921e-60
KLLA0B10153g5.350ON2672404581e-55
Ecym_81835.350ON2652434546e-55
AGR350C5.350ON2612344293e-51
KAFR0A046406.117ON2371631356e-09
Skud_7.1466.117ON3161061129e-06
AAR165W6.117ON3621921013e-04
KNAG0F025106.117ON246126968e-04
TDEL0G035306.117ON368163950.001
SAKL0A07062g6.117ON42939890.010
TPHA0J018106.117ON39064880.010
TBLA0F025006.117ON32727840.036
Kwal_14.17966.117ON36341830.046
Ecym_30686.117ON36741800.10
KLLA0F09526g6.117ON33760800.11
Kpol_461.26.117ON39725800.12
YGL126W (SCS3)6.117ON38045790.15
Smik_7.1456.117ON38045790.16
KLTH0H06556g6.117ON36342780.21
CAGL0I00330g6.117ON371150770.27
NCAS0D031606.117ON39070760.38
ZYRO0A09240g6.117ON37221721.2
NDAI0I017506.117ON38140701.9
TDEL0D046903.153ON83727702.2
NDAI0C019905.346ON49962683.4
NCAS0C020008.564ON325117657.5
AGL041Cna 1ON123333668.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01860
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   488   e-177
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   243   4e-80
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   239   1e-78
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   238   2e-78
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   234   8e-77
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   229   6e-75
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   225   4e-73
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   224   1e-72
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   219   7e-71
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   219   1e-70
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   215   5e-69
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   214   7e-69
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   214   2e-68
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   213   3e-68
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   196   1e-61
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   194   7e-61
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   194   1e-60
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   181   1e-55
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   179   6e-55
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   169   3e-51
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    57   6e-09
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    48   9e-06
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    44   3e-04
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    42   8e-04
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    41   0.001
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    39   0.010
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    39   0.010
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    37   0.036
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    37   0.046
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    35   0.10 
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    35   0.11 
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    35   0.12 
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    35   0.15 
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    35   0.16 
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    35   0.21 
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    34   0.27 
NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {O...    34   0.38 
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    32   1.2  
NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.1...    32   1.9  
TDEL0D04690 Chr4 (861474..863987) [2514 bp, 837 aa] {ON} Anc_3.1...    32   2.2  
NDAI0C01990 Chr3 complement(446632..448131) [1500 bp, 499 aa] {O...    31   3.4  
NCAS0C02000 Chr3 (367247..368224) [978 bp, 325 aa] {ON} Anc_8.56...    30   7.5  
AGL041C Chr7 complement(628428..632129) [3702 bp, 1233 aa] {ON} ...    30   8.1  

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  488 bits (1256), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/240 (100%), Positives = 240/240 (100%)

Query: 20  FLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSH 79
           FLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSH
Sbjct: 20  FLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSH 79

Query: 80  TFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA 139
           TFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA
Sbjct: 80  TFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA 139

Query: 140 TRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKR 199
           TRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKR
Sbjct: 140 TRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKR 199

Query: 200 SLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYAF 259
           SLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYAF
Sbjct: 200 SLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYAF 259

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  243 bits (620), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 118/238 (49%), Positives = 164/238 (68%), Gaps = 4/238 (1%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           LG  ++ ++ +ET   QK   Y+L S NI+N +FAYNGNL+W +LF  +A  Q++IR  T
Sbjct: 20  LGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQVWIRIRT 79

Query: 81  FILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGAT 140
             LLP D   ++ +   R  L+K+Y+VKF+LK  +LF+ FL ID +F+ TGG C  G   
Sbjct: 80  QDLLPRDAQIINRQRLQR--LIKQYIVKFVLKYLLLFITFLFIDGLFLFTGGQCTYGLGI 137

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRS 200
            SAE+CK  GG W GGFDISGHFCFL N+SLILW EL    +Y  +EEL+  +   I   
Sbjct: 138 WSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELE--METIITNY 195

Query: 201 LIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYA 258
            ++++ +LY+WM +L VT+IYYHT+LEKILGC++GY CPL+MYWLIPN  ++  +LY+
Sbjct: 196 SVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHYKLNHILYS 253

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  239 bits (610), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 118/237 (49%), Positives = 156/237 (65%), Gaps = 2/237 (0%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           +G  L+ ++  E    Q+   Y L  +N IN+IFAY GN +W ILF  +A LQ+Y+++H 
Sbjct: 21  VGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAGLQVYMKTHV 80

Query: 81  FILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGAT 140
             ++P D   +  K      LLKEY VK +LK  +L + FL IDNIFILTGGSC+    T
Sbjct: 81  PDVIPRDARTIVRKP--MTSLLKEYAVKIILKNLLLAIIFLFIDNIFILTGGSCSDHSGT 138

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRS 200
            SAE+C   GG W GGFDISGHFCFL +IS+ILW+EL H   +  EE++  R+N W K  
Sbjct: 139 HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMVKRLNVWGKTI 198

Query: 201 LIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
           + +    L  W F+L+VTSIYYHT+LEKILGC MGY CP++MYWLIPN   ++ +LY
Sbjct: 199 IGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHDIVRKVLY 255

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  238 bits (608), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 118/238 (49%), Positives = 159/238 (66%), Gaps = 2/238 (0%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           LG  ++ ++ ++    Q+   YLL S NIIN IFAY GNLVW + F  +A +QIY++   
Sbjct: 23  LGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQIYVKCRN 82

Query: 81  FILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGAT 140
             LLP D    +S   +++ LLK+Y  K +LK  +L + F IID+IF+LTGGSC  G  T
Sbjct: 83  HALLPRD-ARTNSSGPLKS-LLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCLNGDVT 140

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRS 200
           RSAE+C+  GG W GGFDISGHFCFL NIS+ILW+EL  +  Y E E +   ++K +   
Sbjct: 141 RSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPVSKVVNGV 200

Query: 201 LIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYA 258
           L+V   VL IW+ +L+VT++YYHT+LEK+LGC +GY C LVMYWLIP   R   LLY+
Sbjct: 201 LVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGLLYS 258

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  234 bits (598), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 117/239 (48%), Positives = 164/239 (68%), Gaps = 1/239 (0%)

Query: 20  FLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSH 79
           F+G+ +++++ +ET    K   Y+L S NI N++ AYNGN VW ILF  ++ +QI ++S 
Sbjct: 20  FIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVIQIRLQST 79

Query: 80  TFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA 139
              LLP  +    SK      L+K+Y++KF+LK  +L   FLIID++FILTGG C     
Sbjct: 80  NINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVLLAFLFLIIDSLFILTGGECNLIED 139

Query: 140 TRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEE-EELQSRINKWIK 198
             SAE CKA GG W GGFDISGHFCFL NISLILW EL   +K  E+ EE  ++I+KW++
Sbjct: 140 IWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLNKVLEDREETFTKIDKWME 199

Query: 199 RSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
             ++++   LY+WM +L VT++YYHT+LEKILGCI+G+ CP+VMY+ IPN  ++K  LY
Sbjct: 200 GVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPNNVKLKQTLY 258

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  229 bits (585), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 161/239 (67%), Gaps = 2/239 (0%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           +G  LS +I D     Q++  Y+LRSSNI+NE+FAY+GN VW +LF F+  +QIY RS  
Sbjct: 19  IGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIFLCLVQIYYRSKR 78

Query: 81  F-ILLPHDIVDVDSKENVRAK-LLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGG 138
           F +L+  +  +   +   R K L+K+Y+ K +LK  +L + F +IDN+FI +GG C  G 
Sbjct: 79  FSLLISSESFNGRDQLIARGKPLVKQYICKLILKNLMLILVFSVIDNVFIFSGGECTSGS 138

Query: 139 ATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIK 198
            TRS+++C+   G W GGFDISGHFCFL  IS+ILWIELH + K+ + E L  +++ + K
Sbjct: 139 GTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHVDLEGLSGQLSLYSK 198

Query: 199 RSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
             L+ V  VL IW+F+L +TS+YYHT +EK+LGC MGY  P VMY +IPN   + S+LY
Sbjct: 199 IILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHIIPNNEFLYSILY 257

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  225 bits (573), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 116/224 (51%), Positives = 152/224 (67%), Gaps = 11/224 (4%)

Query: 37  QKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHTFILLPHDIVDVDSKEN 96
           QK   YLL S N+IN++FAY GN ++ I F  +A+LQI+I S    LLP +     S   
Sbjct: 40  QKHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQIHIHSKNQDLLPRN--SSSSPRT 97

Query: 97  VRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGATRSAEQCKALGGDWLGG 156
             A L ++Y +KFLLK  +L+V F IID++FI TGG C+    TRSAE+C+ LGG W GG
Sbjct: 98  EAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSIS-KTRSAERCRVLGGSWEGG 156

Query: 157 FDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINK---WIKRSLIVVEVVLYIWMF 213
           FDISGHFCFLTN+SLILW EL+HY KY  + EL  R+N+   WIK    +   VL +W+F
Sbjct: 157 FDISGHFCFLTNVSLILWYELYHYQKYISDNEL--RVNRKFAWIK---YLTLFVLVVWLF 211

Query: 214 LLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
           +L VT+ YYHT+ EK+LG +MGY CP VMY LIP+  ++  L+Y
Sbjct: 212 VLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  224 bits (570), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 116/238 (48%), Positives = 155/238 (65%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           LG FLS ++S+E K  Q+   YLL S N+ N+I AY GN VW  LF  VA++Q  +R+ +
Sbjct: 19  LGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMGVAAVQYNLRTKS 78

Query: 81  FILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGAT 140
             LLP D   +      + +++KEY  K+ LK+FIL V FL+ID +FI+TGGSC     +
Sbjct: 79  QSLLPTDTRALVVSNKTKLQIIKEYFCKYFLKLFILDVIFLVIDGVFIMTGGSCTVPNRS 138

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRS 200
            SAE CK+LGG W+GGFDISGHFCFL NIS+ILW+EL   +++    +    ++   K  
Sbjct: 139 ISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYDTVISLSSLQKHV 198

Query: 201 LIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYA 258
           + V  VVL  WM +LLVT+ YYHTI EK++GC+ GY CP VMY LIPN   +  L YA
Sbjct: 199 ITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPNSHDLNKLFYA 256

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  219 bits (558), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 153/237 (64%), Gaps = 7/237 (2%)

Query: 22  GLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHTF 81
           GL +  + +  T  +QKD  YLL  +N+IN +FAY GNL+W ILF  +A+ QI IR    
Sbjct: 21  GLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLIWTILFVSLAAYQIKIRVSRS 80

Query: 82  ILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGATR 141
            LLP D          R  L KEY VK +LK  +L+V F +ID +F+ TGGSC+   AT+
Sbjct: 81  DLLPRDARTTYPARWHR--LGKEYAVKIILKNLLLYVIFFVIDCVFVWTGGSCS-SSATK 137

Query: 142 SAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRSL 201
           SAE+C+  GG W  GFDISGHFCFLTN+SLILW+EL    KY   +E   R    + R L
Sbjct: 138 SAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKYLNSDE---RTPSKLWRVL 194

Query: 202 IVVEV-VLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
           +   V VL IW F+L VT+IYYHT LEKILG +MGY CP++MYWL+P+   ++ LLY
Sbjct: 195 LYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMYWLVPSHTALRQLLY 251

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  219 bits (559), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 162/252 (64%), Gaps = 15/252 (5%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           +G  +S ++S+ET ++QK    LL+SSN++N IFAY  N +W I F  +A LQIY     
Sbjct: 22  VGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFFFSLALLQIYFHYLA 81

Query: 81  FI-LLPHDIVDVDS--------------KENVRAKLLKEYMVKFLLKVFILFVCFLIIDN 125
            + +LP  I   D+              K+ V   +  +Y  KF+LK  +LF+ F  ID+
Sbjct: 82  RLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQYACKFVLKNLLLFLSFQFIDH 141

Query: 126 IFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTE 185
           +F+ TGG C+ G  T SAE+C+   G W GGFDISGHFCFL NIS+ILW+ELH +S++ +
Sbjct: 142 VFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNISMILWMELHLFSRFVQ 201

Query: 186 EEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWL 245
            E++   +NKW++  L+++ VVL IW+ +L VT+IYYHTILEK+LGC+MGY CP+ +Y +
Sbjct: 202 AEDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKMLGCLMGYICPVFIYHI 261

Query: 246 IPNQPRMKSLLY 257
           +P    +   LY
Sbjct: 262 LPRIELLHDYLY 273

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  215 bits (548), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 162/253 (64%), Gaps = 15/253 (5%)

Query: 20  FLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSH 79
           F+G  LS V+S ET ++QK+   LL+SSNI N IFAY  N +W  LF  +A LQIY    
Sbjct: 21  FVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFFSLAFLQIYFHYL 80

Query: 80  TFI-LLPHDIVDVDS--------------KENVRAKLLKEYMVKFLLKVFILFVCFLIID 124
             + +LP  I   ++              K  + + ++ +Y  KF+LK  +LF+ F  ID
Sbjct: 81  ARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVLKYLLLFLNFQFID 140

Query: 125 NIFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYT 184
           ++FI TGG C+ G  T SAE+C+   G W GGFDISGHFCFL +IS+ILW+ELH +S++ 
Sbjct: 141 HVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISMILWMELHLFSRFV 200

Query: 185 EEEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYW 244
           + E++   +NKW++  L +V  VL IW+ +L VT+IYYHTILEK+LGC+MG+ CP+ +Y 
Sbjct: 201 QAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCLMGFICPVFIYH 260

Query: 245 LIPNQPRMKSLLY 257
           ++P    + + LY
Sbjct: 261 ILPKIGILHNYLY 273

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  214 bits (545), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 145/221 (65%), Gaps = 5/221 (2%)

Query: 37  QKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHTFILLPHDIVDVDSKEN 96
           Q+   YLL S NI+N++FAY GNL W ILF+ +A  Q+++ +    LLP D   V     
Sbjct: 36  QRSSYYLLSSGNIVNKLFAYRGNLTWTILFTLLAVFQVWLHAEQSDLLPRDARSVHRVGG 95

Query: 97  VRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGATRSAEQCKALGGDWLGG 156
           VR  L K+Y VK +LK  +L++ FL IDN+F+ TGGSC+   +TRSAE+C+  GG W  G
Sbjct: 96  VR--LAKQYTVKLILKNVLLYLAFLFIDNLFVWTGGSCSTS-STRSAERCRKEGGSWDNG 152

Query: 157 FDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRSLIVVEVVLYIWMFLLL 216
           FDISGHFCFLTNISLILW EL    K    +++ S    WI      + +VL  W F+L 
Sbjct: 153 FDISGHFCFLTNISLILWYELRSIQKKISSDDI-SPTKTWIVLRWSTL-IVLITWSFILS 210

Query: 217 VTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
           VT++YYHT+LEK+LG  MGY CP +MY +IPN   ++SLLY
Sbjct: 211 VTAVYYHTLLEKVLGLTMGYLCPTIMYLVIPNHSGLRSLLY 251

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  214 bits (544), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 156/252 (61%), Gaps = 15/252 (5%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           +G  +S ++S ET  +QK    LL+SSN+ N +FAY  N +W  LF  +A LQIY     
Sbjct: 22  VGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFFSLAFLQIYFHYLA 81

Query: 81  FI-LLPHDIVDVDS--------------KENVRAKLLKEYMVKFLLKVFILFVCFLIIDN 125
            + +LP  I   ++              K+ V   +  +Y  KF+LK  +L+VCF  ID+
Sbjct: 82  RMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFILKSLLLYVCFQFIDH 141

Query: 126 IFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTE 185
           +FI TGG C+ G  T SAE+C+   G W GGFDISGHFCFL NIS+ILW+ELH +SK+ +
Sbjct: 142 VFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISMILWMELHLFSKFVQ 201

Query: 186 EEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWL 245
            E++    NKW++  L V+  +L IW+ +L VT+IYYHT+LEKILGC MGY CP+ +Y +
Sbjct: 202 AEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCFMGYICPIFIYHV 261

Query: 246 IPNQPRMKSLLY 257
           +P    +   +Y
Sbjct: 262 LPKIGLLHDYIY 273

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  213 bits (543), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 154/243 (63%), Gaps = 15/243 (6%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           +G  +S ++S +T  +QK    LL+SSN+ N IFAY  N +W ILF  +A LQ+Y     
Sbjct: 22  VGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQVYFHYLA 81

Query: 81  FI-LLPHDIVDVDS--------------KENVRAKLLKEYMVKFLLKVFILFVCFLIIDN 125
            + +LP  I    +              K  V   ++ +Y  KF+LK  +LF+ F  ID+
Sbjct: 82  RMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLFLSFQFIDH 141

Query: 126 IFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTE 185
           +FI TGG C+ G  TRSAE+C+   G W GGFDISGHFCFL NIS+ILW+ELH + ++ +
Sbjct: 142 VFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQ 201

Query: 186 EEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWL 245
            E++   +NKW++  L V+  VL IW+ +L VT+IYYHTILEKILGC+MGY CP+ +Y +
Sbjct: 202 SEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYICPIFIYHI 261

Query: 246 IPN 248
           +P 
Sbjct: 262 LPK 264

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  196 bits (499), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 144/246 (58%), Gaps = 9/246 (3%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRS-H 79
            G FL  ++  ET  Y K   Y L S N IN+IFAYNGNLVWF+LF  V  L ++  + +
Sbjct: 31  FGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVN 90

Query: 80  TFILLPHDI---VDVDSK-----ENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTG 131
           +  LLP      V + S+     +     L K+Y  K+ +K   LFV F  ID +F+L+G
Sbjct: 91  SKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDTLFVLSG 150

Query: 132 GSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQS 191
           GSC  G  T  +E C++  G W GGFDISGHFCFL  ISLILW EL+   K  E E  + 
Sbjct: 151 GSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEV 210

Query: 192 RINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPR 251
            +N      + ++  V+ +W  LL +T+IYYHT  EK+LGC++G+  PL+MY+ IP+   
Sbjct: 211 ELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPSNEF 270

Query: 252 MKSLLY 257
           +  LLY
Sbjct: 271 LNGLLY 276

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  194 bits (494), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 146/232 (62%), Gaps = 5/232 (2%)

Query: 31  DETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYI-RSHTFILLPHDIV 89
           D+  S   D+ +L+RS++  N++FAYNGN V+  LF  + SLQ+Y  R    + LP +I 
Sbjct: 43  DDLPSEPSDKFWLIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYFSREDARLSLPIEIR 102

Query: 90  DVDSKENVRAK----LLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGATRSAEQ 145
            +   +  + K    + KEY+ K +LK F L++ FL ID++F+LTGG C  G  TR A  
Sbjct: 103 TISRIKQFQTKHYLRIAKEYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMI 162

Query: 146 CKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRSLIVVE 205
           C++  G+W+GGFDISGHFCFL  +SLI+W+EL    ++    +L+S +   +   +  + 
Sbjct: 163 CRSGNGEWVGGFDISGHFCFLVTLSLIIWLELFKLEEFIRSRDLKSNVTNEVIFMVFFIV 222

Query: 206 VVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLY 257
            +L +W+ +L VTS+YYHT +EK+LGCIMGY CP+VMY ++P        +Y
Sbjct: 223 SILILWIVMLCVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIY 274

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  194 bits (492), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 147/249 (59%), Gaps = 16/249 (6%)

Query: 21  LGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHT 80
           +GL L  ++ ++ +   K  +Y   S N++N++FAY GNLVW +LF ++A L  +I++  
Sbjct: 21  IGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAVLSYFIKT-- 78

Query: 81  FILLPHDIVDVDSK-ENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA 139
              +  D ++  +    V  +++++Y  K LLK  +L++CFL+ID +FI TGG C   G 
Sbjct: 79  ---MSRDPLEQRAGGRQVDWQIVRQYCWKLLLKNGLLYLCFLVIDGVFIATGGVCTTMGG 135

Query: 140 T----RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRIN- 194
                RSAE CK  GG W  GFDISGHFCFL NISLILW EL         EEL      
Sbjct: 136 EMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDAIRREELGEEELN 195

Query: 195 -----KWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQ 249
                KW++  L  V++ LYIW+FLL VT+ +YHT  EK++GC  GY CP VMY LIP  
Sbjct: 196 LWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYVCPFVMYHLIPTS 255

Query: 250 PRMKSLLYA 258
           PR+    Y 
Sbjct: 256 PRLNEFFYG 264

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  181 bits (458), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 150/240 (62%), Gaps = 8/240 (3%)

Query: 22  GLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIR-SHT 80
           G F+S +I ++    ++   Y +   N++N +FAY G  ++ +LF  +  LQ+Y+R  H 
Sbjct: 29  GYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQVYVRMKHE 88

Query: 81  FILLP--HDIVDVDSKENVR--AKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCAP 136
             LLP  +   D +S + ++   K+LK Y +KF+L   +L+ CFL ID++F+ TGG+C  
Sbjct: 89  ESLLPTSNGEQDRNSPDLLKQVGKVLKVYSIKFVLVYLVLWACFLFIDHLFVWTGGNCDL 148

Query: 137 GGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKW 196
              T+SAE+C++LGG W+GGFDISGHFCFLTNISL LW EL    +Y  +  +    N  
Sbjct: 149 SD-TKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHTIS--WNSP 205

Query: 197 IKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLL 256
             +   +V +VL IW+ +L +TSIYYHT  EK+LGC  GY+C LV+Y+++P    +   L
Sbjct: 206 SSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPRIKHVNKFL 265

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  179 bits (454), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 148/243 (60%), Gaps = 9/243 (3%)

Query: 20  FLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSH 79
           F G  +  +   E     +   YLL   N++N +F  NGN VW +L+  +A +Q YIR+ 
Sbjct: 27  FGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQCYIRTK 86

Query: 80  TFILLP--HDIVDVDSKE--NVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSCA 135
               LP    +    S+E   +   L+K+++VK  LK+ +L   F +ID++FI TGG C 
Sbjct: 87  ESDSLPLGGSVPGSSSRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFIWTGGRCT 146

Query: 136 PGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINK 195
               T+S+ +C  L G W+GGFDISGHFCF+TN+SLILW EL    +Y    E++ R   
Sbjct: 147 VSD-TKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEIRLRKRL 205

Query: 196 -WIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKS 254
            WIK  +++  V    W+F+L VT+++YHT+LEK+LG I+GY CP+VMY +IP  P+++ 
Sbjct: 206 IWIKYMILLALVT---WIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPYYPKLQR 262

Query: 255 LLY 257
           +LY
Sbjct: 263 ILY 265

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  169 bits (429), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 141/234 (60%), Gaps = 8/234 (3%)

Query: 22  GLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIRSHTF 81
           G  +  ++ +ET  + +   YLL   N +N++F ++G L+W +L   V +LQ ++R+  F
Sbjct: 27  GEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLLWTLLMGLVLALQYHVRTTEF 86

Query: 82  ILLPHDIVDVDSKENVRAKLLK----EYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPG 137
             LP D  ++   +    K+L     + ++K LL V +L   F  +D++F+ TGG C   
Sbjct: 87  DPLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLVVTVLQALFWFMDHLFVWTGGRCTVS 146

Query: 138 GATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWI 197
             T+ +  C+ LGG+W+GGFDISGHFC + N+SL+LW+EL    +Y   +E+Q R   W 
Sbjct: 147 -DTKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQRYMHSQEIQLRKFAWA 205

Query: 198 KRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPR 251
           + +++     L +W+ LL +T+IYYHT +EK+LG I GY+  LV+Y+++P   R
Sbjct: 206 RTTVL---GALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLVIYYVLPRINR 256

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 74/163 (45%), Gaps = 26/163 (15%)

Query: 109 FLLKVFILFVCFLIIDNIFILTGGSCAPGGATRSAE----QCKALGGDWLGGFDISGHFC 164
           FL     +F    I+D IF+ TGG C  G  +         CK +GG+W+ G D SGH  
Sbjct: 78  FLFTQDNMFSNHAIMDLIFVWTGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGHIF 137

Query: 165 FLTNISLILWIELHHYSKYTEEEELQSRIN----KWIKRSLIVVEVVLYI---------- 210
            L+ ++  +   ++ +SK       Q R +     W     + V+++L+I          
Sbjct: 138 LLSIMTTFM---INEFSKIRRVSMTQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLS 194

Query: 211 ----WMFLLLVTSI-YYHTILEKILGCIMGYACPLVMYWLIPN 248
               W   L++TSI YYHT+ E++ G +  Y     +Y  +P+
Sbjct: 195 FILLWWHSLVITSINYYHTLSEQLSGLLFAYIIMGPLYLFLPS 237

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 138 GATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWI 197
           G   ++ QC+  GG W GG D SGH    T + + L  EL  + +            KW 
Sbjct: 209 GPLTTSAQCRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFGRRALAHLY---AQKW- 264

Query: 198 KRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMY 243
                ++ +V ++W  LL   + ++HT+ E I G +  Y    V+Y
Sbjct: 265 ----HLLGMVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 67/192 (34%), Gaps = 73/192 (38%)

Query: 128 ILTGGSCAPGG-----------------ATRSAEQCKALGGDWLGGFDISGHFCFLTNIS 170
           +LTGG C   G                 A RS+  C  LGG W+GG D SGH   +T + 
Sbjct: 171 MLTGGQCENTGLDPTELNSYIQDSVTASAIRSSHACSRLGGHWMGGHDPSGHVFLITLMC 230

Query: 171 LILWIELHHYSKY------TEEEELQSRINKWIKRSL----------------------- 201
           + +  EL  + +        + ++LQ    K + R L                       
Sbjct: 231 MFMLGELQVFGRRAIGKLSADCQQLQGAPGKIVARILQASPIRELINSEAPQHILRRLFV 290

Query: 202 --------IVVEVVLY-------------------IWMFLLLVTSIYYHTILEKILGCIM 234
                   I+V  V++                    W + LLVT + +H+  E + G + 
Sbjct: 291 QLPLESLAILVSAVVFGFRFIVLENPILLLVGLILTWTWSLLVTILSFHSFAEHLTGLLF 350

Query: 235 GYACPLVMYWLI 246
            Y   L +YW I
Sbjct: 351 AYLLVLALYWYI 362

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 17/126 (13%)

Query: 122 IIDNIFILTGGSCAPGGAT-------RSAEQCKALGGDWLGGFDISGHFCFLTNISLILW 174
           ++D +F+ +GGSC    AT        ++  C+  GG W GG D SGH   L+ + + L 
Sbjct: 107 LMDLVFVWSGGSCLLDPATTPGTLWLSTSAACRRHGGLWQGGHDPSGHMFLLSLMLMFLL 166

Query: 175 IELHHYSKYTEEE---------ELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTI 225
            EL   S                  +R   W +  ++ + +    W + LLVT+  +HT+
Sbjct: 167 SELPAGSSGGRRRGKHAAFASAAAAARFILWDEPGVLALALT-ACWTWALLVTAARFHTL 225

Query: 226 LEKILG 231
            E+  G
Sbjct: 226 PEQTSG 231

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 68/163 (41%), Gaps = 55/163 (33%)

Query: 137 GGATR-SAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKY------------ 183
            G TR S+  C+ LGG W+GG D SGH   +T + + L  ELH + K             
Sbjct: 195 SGVTRNSSAVCRTLGGYWVGGHDPSGHIFLITLMIMYLLGELHIFGKRAFSRILREKNMS 254

Query: 184 -----------------TEEEELQSRI-------------NKWIKRSLIVVE-------V 206
                            +++ E  S++             N +   SL +++       V
Sbjct: 255 FKPFIDLFDNGAIWNVLSKKPETYSQLFFMTVVQPPLTFANSFTVFSLQLIKFVVLENPV 314

Query: 207 VLYIWMFLL-----LVTSIYYHTILEKILGCIMGYACPLVMYW 244
           +L + +FL+     LVTS+ +HT+ E++ G    Y    V+YW
Sbjct: 315 ILLVGLFLMWWWSFLVTSVVFHTLSEQVSGLAFAYLVAGVIYW 357

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%)

Query: 142 SAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHY 180
           S+++CK+LGG W GG D SGH   +T + + L  EL  +
Sbjct: 266 SSQKCKSLGGHWSGGHDPSGHIFLITLMCMFLLGELQMF 304

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 198 KRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLI 246
           +  +I++  ++++W +  LVT+I +HTI E++ G I  Y    ++YW +
Sbjct: 380 ENPIILLVSLVFVWWWNFLVTTIVFHTISEQLSGLICAYVVAGLVYWKV 428

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 143 AEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRSLI 202
           + +CK  GG W+GG D SGH   LT + +++  EL   ++  ++  +  + +K I+R  I
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPKINRIRKQNMIYQKDSK-IRRVNI 280

Query: 203 VVEV 206
           V ++
Sbjct: 281 VEKI 284

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLT 167
            S+++C+ +GG W GG D SGH   LT
Sbjct: 235 NSSQKCRKIGGAWSGGHDPSGHMFLLT 261

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%)

Query: 142 SAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSK 182
           S+  C++LGG+W+GG D SGH   +T + + L  EL    K
Sbjct: 202 SSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGELQVLGK 242

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 29/47 (61%)

Query: 198 KRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYW 244
           +  +I++ +  ++W + LL+T+I +HT+ E++ G +  Y     +YW
Sbjct: 314 RNPVILLVLFTFLWWWSLLITTIAFHTLWEQLSGLLCAYVVAGFVYW 360

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 142 SAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSK 182
           + + C+ LGG W GG D SGH   +T +++ L  EL  +S 
Sbjct: 204 NGQMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGELRLFSD 244

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRINKWIKRS 200
           +S+  C   GG W+GG D SGH   +T + ++++ EL  Y        LQ+   +++ R+
Sbjct: 173 KSSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLYQS-RAFRHLQNTYKRFLNRA 231

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 143 AEQCKALGGDWLGGFDISGHFCFLT 167
           +  C+A GG W+GG D SGH   LT
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILT 254

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 197 IKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMY 243
           I+  +I++  +L +W +  LVT I +HTI E+I G +  Y   +++Y
Sbjct: 348 IENPVILLTSLLLLWAYSFLVTIIVFHTISEQITGFLSAYIMAVIIY 394

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 138 GATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSK 182
           G   ++ QC+  GG W GG D SGH    T + + L  EL  + +
Sbjct: 211 GPLTTSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVFGR 255

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 138 GATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSK 182
           G   ++ QC+  GG W GG D SGH    T + + L  EL  + +
Sbjct: 211 GPLTTSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVFGR 255

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 141 RSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSK 182
            S+  C+++GG W+GG D SGH   +T + + L  EL    K
Sbjct: 201 NSSNLCRSMGGYWIGGHDPSGHIFLITLMCMFLLGELQAIGK 242

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 29/47 (61%)

Query: 198 KRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYW 244
           +  ++++ +  ++W + LL+T+I +HT+ E++ G +  Y     +YW
Sbjct: 314 ENPVVLLVLFTFLWWWSLLITTIAFHTLWEQLSGLLCAYIVAGFVYW 360

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 60/150 (40%), Gaps = 36/150 (24%)

Query: 131 GGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHY---------- 180
           G S        ++  C+  GG W GG D SGH   LT + L L  E   +          
Sbjct: 220 GNSSGANSTLDNSFACRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMRVVD 279

Query: 181 -SKYTEEE-------------ELQSRINKWIK------------RSLIVVEVVLYIWMFL 214
             KY  ++               + R+ K ++              +I++ ++L IW++ 
Sbjct: 280 TRKYVMDKIKKICNEPMANASVYERRVRKLMRCLSFSASYILWENPVILLLLLLAIWVWN 339

Query: 215 LLVTSIYYHTILEKILGCIMGYACPLVMYW 244
            ++T I +HT+ E++ G    Y    ++Y+
Sbjct: 340 FVITVIVFHTLTEQLSGLFFAYVVGALLYY 369

>NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {ON}
           Anc_6.117 YGL126W
          Length = 390

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 177 LHHYSKYTEEEELQSRINKWI--KRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIM 234
           L  Y+   E  EL     ++I     +I++  +L +W++  L+T++ +HT+ E++ G   
Sbjct: 318 LPPYTFAKEAAELVVLTGRFIIWDNPIILLITLLVVWLWSFLITTLVFHTVSEQLSGLFF 377

Query: 235 GYACPLVMYW 244
            Y    ++YW
Sbjct: 378 AYMVAGILYW 387

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%)

Query: 138 GATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHY 180
           G   ++  C++ GG W  G D SGH   +T +++ +  EL  +
Sbjct: 222 GRISTSAMCRSHGGYWTMGHDPSGHIFLITLMTMFILGELQFF 264

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 142 SAEQCKALGGDWLGGFDISGH 162
           ++  C+A GG W GG D SGH
Sbjct: 204 TSAACRATGGHWKGGHDPSGH 224

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 211 WMFLLLVTSIYYHTILEKILGCIMGYACPLVMYW-LIPNQPRMKSL 255
           W + L+VT++ +HT+ E++ G    Y     +YW  I N  R + +
Sbjct: 327 WWYSLIVTTLVFHTVSEQLSGLACAYLVAGGLYWYAIKNNARNQPV 372

>NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.117
           YGL126W
          Length = 381

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 142 SAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYS 181
           ++ QC+  GG W  G D SGH   LT + + L  EL  ++
Sbjct: 220 TSAQCRMHGGYWTKGHDPSGHIFLLTLMVMFLSGELSTFA 259

>TDEL0D04690 Chr4 (861474..863987) [2514 bp, 837 aa] {ON} Anc_3.153
           YDL040C
          Length = 837

 Score = 31.6 bits (70), Expect = 2.2,   Method: Composition-based stats.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 173 LWIELHHYSKYTEEEELQSRINKWIKR 199
           ++ +LH  SK TEEE++ SRI+K +KR
Sbjct: 606 IYSKLHDNSKLTEEEDIFSRISKLMKR 632

>NDAI0C01990 Chr3 complement(446632..448131) [1500 bp, 499 aa] {ON}
           Anc_5.346 YHR070W
          Length = 499

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 152 DWLGGFDISGHFCFLTNISLILWIELHHYSKYTEE-----EELQSRINKWIKRSLIVVEV 206
           D+LG F   G +   T  + + WI +H + KY  +     EEL SR+ + I  SL    V
Sbjct: 403 DFLGSF--IGLYSSDTTKNKMPWIHVHCFEKYDNDEDLTMEELHSRVYQRILNSLKTTTV 460

Query: 207 VL 208
           VL
Sbjct: 461 VL 462

>NCAS0C02000 Chr3 (367247..368224) [978 bp, 325 aa] {ON} Anc_8.564
           YBR183W
          Length = 325

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 11/117 (9%)

Query: 151 GDWLGGFDISGHFCFLTNISLI---------LWIELHHYSKYTEEEELQSRINKWIKRSL 201
           G WL    +  HF  L  + ++         L+ E++HY+K    +    R  +WI   L
Sbjct: 82  GSWLFHMTLKFHFQLLDELPMVYATAIPSWSLFTEIYHYTKNDNSKNSPIR-EQWIFGLL 140

Query: 202 IVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPRMKSLLYA 258
           +   V    W++L+L   I +  +L   L   + +    + Y  +   P +K  LYA
Sbjct: 141 VTGFVTFLTWVYLVLQKPIIFQ-VLYGFLNVWVVFISGFLAYKHMEKNPTVKKNLYA 196

>AGL041C Chr7 complement(628428..632129) [3702 bp, 1233 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR270W
           (CCC2)
          Length = 1233

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 190 QSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYY 222
           + R  KW+++ L V  V   IW+ L+L T +Y+
Sbjct: 498 EHRFRKWLEKPLWVKNVPRVIWILLILSTPVYF 530

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.145    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,941,658
Number of extensions: 1012870
Number of successful extensions: 3975
Number of sequences better than 10.0: 48
Number of HSP's gapped: 4030
Number of HSP's successfully gapped: 61
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 64 (29.3 bits)