Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C018505.352ON64664630470.0
ZYRO0D10186g5.352ON63568610871e-139
TDEL0E027505.352ON56466110471e-134
KNAG0C055005.352ON58567010421e-133
Smik_4.5795.352ON66769110421e-132
CAGL0H07095g5.352ON66170110001e-126
YDR320C (SWA2)5.352ON6687059961e-125
Skud_4.5865.352ON6426949731e-122
NCAS0F028705.352ON7003028941e-110
NDAI0C043205.352ON7063048771e-107
TBLA0H019705.352ON8402988521e-102
Suva_2.4895.352ON6592998291e-101
Kpol_339.135.352ON6862978271e-100
TPHA0E011105.352ON6933018071e-97
Kwal_34.159775.352ON5975887154e-85
SAKL0G08822g5.352ON5823046935e-82
Ecym_81815.352ON6613055972e-67
KLLA0B10197g5.352ON6212995917e-67
KLTH0H14872g5.352ON6233055662e-63
AGR352C5.352ON6483095463e-60
SAKL0A01672g6.328ON128901021e-04
Ecym_20906.328ON1721011032e-04
TDEL0B051402.152ON5991041064e-04
Kpol_1028.516.328ON11795975e-04
TPHA0D038606.328ON12070976e-04
YCR060W (TAH1)6.328ON11170930.002
Kpol_1048.212.152ON5971041000.002
NCAS0B070102.152ON625104990.003
TBLA0I023106.328ON11684900.004
Skud_3.1356.328ON11870890.006
ZYRO0G06512g2.152ON604104960.007
KAFR0F007202.152ON608124960.007
Smik_14.2072.152ON617122950.008
TPHA0I015102.152ON603104950.008
NCAS0H008306.21ON33863930.010
KAFR0J025706.328ON12171870.011
Suva_14.2192.152ON617122910.026
YNL121C (TOM70)2.152ON617122880.049
Skud_14.2112.152ON617122880.061
Smik_3.1596.328ON11560800.078
KAFR0C058905.617ON575120850.13
KLTH0B05170g2.152ON593104850.14
NDAI0F028102.152ON609104840.17
NCAS0F034903.481ON51268830.18
NCAS0G024802.152ON596104830.22
KLLA0F24046g2.152ON604104820.27
Ecym_55825.617ON58463810.37
TBLA0C055302.152ON610104810.42
NDAI0B043402.152ON664107800.47
NDAI0I004406.328ON12867750.48
TPHA0D032203.481ON51369790.57
CAGL0H07425g8.506ON38068790.59
CAGL0D05060g3.481ON51069790.61
Kwal_33.147672.152ON594104790.71
NDAI0D008106.21ON349132780.79
CAGL0K09240g6.328ON14251740.90
TPHA0M002706.21ON37757770.94
KNAG0H035302.152ON614121780.95
KNAG0A056502.350ON17564741.2
KLTH0H02068g7.313ON370119751.5
Suva_3.956.328ON11161711.5
YHR117W (TOM71)2.152ON639104761.6
YOR007C (SGT2)6.21ON34664751.6
TDEL0A048405.617ON576125751.8
Kpol_1018.695.617ON59079751.9
Smik_8.1952.152ON635104752.1
TBLA0H033808.506ON37570742.3
Skud_8.1782.152ON638104742.4
YBR155W (CNS1)8.506ON38568733.1
Suva_15.3142.152ON644104733.5
KAFR0B066103.481ON51165723.8
Smik_2.3596.112ON674112724.0
Kpol_1032.86.21ON34355714.5
AAR054C6.328ON133106684.9
Suva_15.1826.21ON34664714.9
CAGL0L04048g2.152ON587113715.4
ZYRO0B04224g3.481ON51366715.4
Suva_7.4083.481ON51369715.5
Skud_2.2828.506ON38568705.9
Skud_15.4208.698ON66548716.0
Kpol_505.413.481ON51366716.3
Smik_15.1766.21ON34564706.7
Ecym_44133.481ON51066707.0
Skud_5.2197.386ON52582707.6
TBLA0C039503.481ON51272707.6
Ecym_23748.698ON66148708.0
TDEL0D055003.481ON51264698.7
CAGL0L12936g2.152ON600109698.8
TPHA0J003406.21ON33863699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01850
         (646 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...  1178   0.0  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   423   e-139
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   407   e-134
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   405   e-133
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   405   e-132
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   389   e-126
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   388   e-125
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   379   e-122
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   348   e-110
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   342   e-107
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   332   e-102
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   323   e-101
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   323   e-100
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   315   1e-97
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   280   4e-85
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   271   5e-82
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   234   2e-67
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   232   7e-67
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   222   2e-63
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   214   3e-60
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    44   1e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    44   2e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    45   4e-04
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    42   5e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    42   6e-04
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    40   0.002
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    43   0.002
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    43   0.003
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    39   0.004
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    39   0.006
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.007
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    42   0.007
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    41   0.008
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    41   0.008
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    40   0.010
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    38   0.011
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    40   0.026
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    39   0.049
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    39   0.061
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    35   0.078
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    37   0.13 
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    37   0.14 
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    37   0.17 
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    37   0.18 
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    37   0.22 
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    36   0.27 
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    36   0.37 
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    36   0.42 
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    35   0.47 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.48 
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    35   0.57 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    35   0.59 
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    35   0.61 
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    35   0.71 
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    35   0.79 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    33   0.90 
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    34   0.94 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    35   0.95 
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    33   1.2  
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    33   1.5  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    32   1.5  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    34   1.6  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    33   1.6  
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    33   1.8  
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    33   1.9  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    33   2.1  
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    33   2.3  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    33   2.4  
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    33   3.1  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    33   3.5  
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    32   3.8  
Smik_2.359 Chr2 complement(641781..643805) [2025 bp, 674 aa] {ON...    32   4.0  
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    32   4.5  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    31   4.9  
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    32   4.9  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    32   5.4  
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    32   5.4  
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    32   5.5  
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    32   5.9  
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    32   6.0  
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    32   6.3  
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    32   6.7  
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    32   7.0  
Skud_5.219 Chr5 (345754..347331) [1578 bp, 525 aa] {ON} YER096W ...    32   7.6  
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    32   7.6  
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    32   8.0  
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    31   8.7  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    31   8.8  
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    31   9.4  

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/646 (91%), Positives = 588/646 (91%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST
Sbjct: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60

Query: 61  NSVPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTNNFKTVTDVPNVTYEAK 120
           NSVPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTNNFKTVTDVPNVTYEAK
Sbjct: 61  NSVPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTNNFKTVTDVPNVTYEAK 120

Query: 121 QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFG 180
           QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFG
Sbjct: 121 QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFG 180

Query: 181 GNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRDISEIS 240
           GNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRDISEIS
Sbjct: 181 GNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRDISEIS 240

Query: 241 SMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDN 300
           SMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDN
Sbjct: 241 SMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDN 300

Query: 301 KEELSKESVLLDIDNXXXXXXXXXXXXXXXXXFQDENVLEXXXXXXXXXXXXELSGYNEY 360
           KEELSKESVLLDIDN                 FQDENVLE            ELSGYNEY
Sbjct: 301 KEELSKESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELSGYNEY 360

Query: 361 NSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADK 420
           NSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADK
Sbjct: 361 NSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADK 420

Query: 421 ALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENN 480
           ALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENN
Sbjct: 421 ALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENN 480

Query: 481 VFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQKYESVXXXXXXXXXXXX 540
           VFSDKIMDGKRRCQKVLNPEIA            AAVPTPSTQKYESV            
Sbjct: 481 VFSDKIMDGKRRCQKVLNPEIAKKTQQKPSSSKPAAVPTPSTQKYESVERIKEQNRQEEE 540

Query: 541 XXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVT 600
                LKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVT
Sbjct: 541 NEAEKLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVT 600

Query: 601 YLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           YLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN
Sbjct: 601 YLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  423 bits (1087), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 268/686 (39%), Positives = 369/686 (53%), Gaps = 91/686 (13%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVK--SNDVSSISLNSTLQPKKLNGINTKVSTL 58
           M DPFA+LL  FK    KP  +   P+  +   N+    S + +LQP+            
Sbjct: 1   MGDPFADLLTQFKGGESKPQNQGNKPLAAQYSENNTRETSSSLSLQPE------------ 48

Query: 59  STNSVPTFANVSSLNSLQTTPIHDDFEELFG---SSTSNNFSVSPEPT----NNFKTVTD 111
               V T +N           I DDFE+LFG   ++ +NN  V+  P     N F +  D
Sbjct: 49  ---PVTTASNYK---------IDDDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAID 96

Query: 112 VPNVTYEAKQDS-------VVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLL---- 160
           +  +T E ++ S       +VDEV+DME+A+LMSLG SI+ AN+ Y +G+ YD ++    
Sbjct: 97  LLQITPEKQRQSAEREPEQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERK 156

Query: 161 -KKLERRRYGSRKG-----RDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGK 214
            KKL RR            R+TP     TN D+           N +LFS+ASG+FNKGK
Sbjct: 157 KKKLHRRELQRLMAETNWERETP----ETNNDESG-------KNNVDLFSIASGIFNKGK 205

Query: 215 EFIDQMTAYPEETDRLSRYRD--ISEISSMKP-----LRKSPGIVDGFDMDRISQHQDTD 267
           + +D ++ +P+E + L  YR   + +  + +P      RK P            +++ T 
Sbjct: 206 KIVDHLSLFPDEENDLLPYRSERLKQRQTFEPELPRRPRKDPTPNPRTQGTPQVEYESTL 265

Query: 268 KGKAPTREVQQESPPPSHDLLDNFQNNLKL--DDNKEELSKES----VLLDIDNXXXXXX 321
           + + PT + Q+       DLL +FQ+ L L    NK   + +S     LLD D       
Sbjct: 266 QYQQPTIQAQE------GDLLGDFQDKLSLRSQGNKSTSASQSPSNETLLDFDAPSANST 319

Query: 322 XXXXXXXXXXXFQDENVLEXXXXXXXXXXXXELSGYNEYNSRGSSFFKNGDYISALEEYE 381
                             +            ELSGYNE+  R    FK GDY++AL+EYE
Sbjct: 320 SASVSVSR----------QGSVVPTVPITEIELSGYNEFKDRAGELFKTGDYVAALQEYE 369

Query: 382 KSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDSEP 441
           KS NTLP  HPLRII+YSN+ A++LK G+Y   +  A  ALKLFP++  +W  +IQ+SEP
Sbjct: 370 KSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEP 429

Query: 442 HKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNPEI 501
            K+Y+D+W K+V R+AEA EH ENF+ A+  Y SLIE N  ++KIMDGKRRCQKVLNPE 
Sbjct: 430 SKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQKVLNPEK 489

Query: 502 AXXXXXXXXXXXXAAVPT-PSTQKYESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWK 560
                         +     S +KY+++                   LYD V  +I  W+
Sbjct: 490 PKVVQKKPASSKSPSPSPNHSDKKYKNLQKVKEDNRKQAEEDTQRHALYDRVYDQIKLWE 549

Query: 561 SNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLE 620
           S K  DIRHLL+NL T+LTW +WKP+S  DLVMPKKVK+TYL+A+AKTHPDKIS SL L+
Sbjct: 550 SGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKISDSLPLD 609

Query: 621 SKMIAENAFSTLSVAWDKFKEENNMN 646
            KMIAE+ FS+LS AW+KFK EN++N
Sbjct: 610 KKMIAESVFSSLSSAWEKFKSENDIN 635

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  407 bits (1047), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/661 (37%), Positives = 346/661 (52%), Gaps = 112/661 (16%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           MSDPFA+LL SF+  G               +D  S      ++ +KL G N        
Sbjct: 1   MSDPFADLLSSFRSGG---------------SDSVSKEATPEVKQEKLPGRN-------- 37

Query: 61  NSVPTFANVSSLNSLQTTPIHDDFEELFG-----------SSTSNNFSVSPEPTNNFKTV 109
                      +N      +HDD +ELFG               ++F  + E  +  + V
Sbjct: 38  ----------QIN------VHDDLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKV 81

Query: 110 TDVPNVTYEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYG 169
                 + E   + VVDEVKDME+A+LMSL L I++A  YY +G+ Y+    +L R+R  
Sbjct: 82  EK----SLEESPEMVVDEVKDMEVAKLMSLNLDIDQATDYYERGVLYE----QLSRQRRE 133

Query: 170 SRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDR 229
               R          +  +   + FDS    + FS+ASG+  KG++F+DQ + +P+E DR
Sbjct: 134 QELIRRREQMLRQQQQQQQTPEEKFDSG---SFFSLASGILEKGRQFVDQFSGFPQEQDR 190

Query: 230 LSRYRDISEISSMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPPPSHDLLD 289
           L+R R   ++   +P    P                      PT EV++       +LL 
Sbjct: 191 LTRVRVEQDLPVERPKSVEP----------------------PTVEVEE------GNLLG 222

Query: 290 NFQNNLKLDDNKEELSK--ESVLLDIDNXXXXXXXXXXXXXXXXXFQDENVLEXXXXXXX 347
            FQ  + L++ K   +   ++ LLD DN                                
Sbjct: 223 EFQEKINLEEPKRSPTPPPQATLLDFDNGTPPERIKTITPVPISHL-------------- 268

Query: 348 XXXXXELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELK 407
                E+SGY EY  RG+ FFK GDY+SA +EYEKSLN+LPQ+H LRI+AYSN+TAA  K
Sbjct: 269 -----EISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFK 323

Query: 408 IGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFE 467
           +GEY   +   + AL++FPK+   W+  IQDS+P +++K++W K+V R+AEA EH+EN+E
Sbjct: 324 VGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYE 383

Query: 468 LAYKQYHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVP--TPSTQKY 525
            A + Y SLIE N F+DKIM GKRRCQKVLNP                 V   T   + Y
Sbjct: 384 RALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPKTY 443

Query: 526 ESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKP 585
            +V                   LYD V  +I +WK+ K +DIRHLLANL T+LTW +WKP
Sbjct: 444 ANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKP 503

Query: 586 ISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNM 645
           +S +DLVMPKKVK+TY+KA+AKTHPDKI SSL LE +MIAE+ FS+LSVAW+KFK  N++
Sbjct: 504 VSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDI 563

Query: 646 N 646
           N
Sbjct: 564 N 564

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  405 bits (1042), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 257/670 (38%), Positives = 351/670 (52%), Gaps = 109/670 (16%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           M+DPFA+LL SFKE+ KKP  + ++P PV        ++    +P          +T ST
Sbjct: 1   MADPFASLLTSFKESSKKPAAKSESPEPV--------TVKGGGEP----------ATAST 42

Query: 61  NSV---PTFANVSSLNSLQTTPIHDD--FEELFGSSTSNNFSVSPEPTNNFKTVTDVPNV 115
           ++V   P   +     S Q  P   D  F+++F    S       EP    K    VP+ 
Sbjct: 43  HAVFMEPLIPSGGGQGSFQQKPAGSDDKFDDVFDLFNS-------EPAAEVKEPDRVPSD 95

Query: 116 TYEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERR-------RY 168
               +  +VVDEV+DME+A++MSLG  I+KA  +Y  G+ YD L+++ +RR       R+
Sbjct: 96  ESVHENVAVVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDELVERRDRRHIRHTHTRH 155

Query: 169 GSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYP-EET 227
             R+  + P   GN+                   FS A GL NKGK+F+D +TAYP EE 
Sbjct: 156 SVREVTEVPKHTGNS------------------FFSAAVGLLNKGKDFVDHLTAYPDEEG 197

Query: 228 DRLSRYR----DISEISSMKPL-RKSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPP 282
           DRL+RYR    D +      P  R+   ++D F+    S+   TDK   P  +       
Sbjct: 198 DRLARYRQEHADAAHFGDFTPGEREQDLLIDDFE----SKVSITDKHNPPLAQT------ 247

Query: 283 PSHDLLDNFQNNLKLDDNKEELSKESVLLDIDNXXXXXXXXXXXXXXXXXFQDENVLEXX 342
           P   LLD        DD+ +  S+  V                           N     
Sbjct: 248 PDETLLD-----FGEDDSSKSGSRTHV---------------------------NNSPSI 275

Query: 343 XXXXXXXXXXELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNIT 402
                     ELSGYNE+ ++G+  FK GDY +A+ EYEKSLNTLP+ HPLRIIA SN+ 
Sbjct: 276 ELPIVPISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMM 335

Query: 403 AAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEH 462
              LKIGEY+  +K A  AL+L P++   W  +IQ SEP ++Y+DIWSKLV+R AEA EH
Sbjct: 336 LPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEH 395

Query: 463 LENFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNP----EIAXXXXXXXXXXXXAAVP 518
            EN+  A+  Y  L+ N + ++K+MDGKRRCQKVLNP    E              A  P
Sbjct: 396 AENYTGAFDNYQLLVANGITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPARTP 455

Query: 519 TPSTQK--YESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPT 576
            P+T K  YE+                  ++ YD+VE K+N WK +K  DIR+LL++L  
Sbjct: 456 DPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDIRYLLSHLTE 515

Query: 577 ILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAW 636
           I+TW EW  +S  DLVMPK+VK+TYLKAIAK HPDKI + L LE +MIA+  FS L+ AW
Sbjct: 516 IVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVFSVLNNAW 575

Query: 637 DKFKEENNMN 646
           +KFK +NN+N
Sbjct: 576 EKFKLDNNIN 585

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  405 bits (1042), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 271/691 (39%), Positives = 379/691 (54%), Gaps = 69/691 (9%)

Query: 1   MSDPFANLLESFKEN-----GKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKV 55
           MSDPFA+LL SFK        KK  +   N   +  + V+ IS         L+ I+   
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLRSSNSPSLPDSVVADISKTDKTINDSLHSISASP 60

Query: 56  STLSTN---SVPTFA---NVSSLNSLQTTP------IHDDFEELFGSSTSNNFSVSPEPT 103
              S+    SVP      N  S NS  ++P      I DDF ELFG+ T+         T
Sbjct: 61  LIPSSKVGFSVPPLVSSNNTISANSTNSSPRPPLDHIDDDFNELFGNGTT-------AAT 113

Query: 104 NNFKTVTDVPNVTYEAKQ----DSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTL 159
           +  + V D      E ++    +++VDEVKDMEIA+LMSLGLSIEKA  +Y+  I+Y+  
Sbjct: 114 DTLQKVNDDYCRNNEGRKSNGDEALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERY 173

Query: 160 LKKLE--RRRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFI 217
           LK L+  +++   R  R++P   G+ N +    +  F  SEN NLFS+A+  FNKGKE +
Sbjct: 174 LKVLKSNQKKSKDRTARESP---GDVNFERSELSNNF-GSENNNLFSIATNFFNKGKELV 229

Query: 218 DQMTAYP-EETDRLSRYRDISEISSM--KPLRKSP-------------GIV--DGFDMDR 259
           DQ T++P EE DRL+ + ++   S     PL   P             G++  +  D D 
Sbjct: 230 DQWTSFPPEENDRLNNHPNLRNKSEDYDSPLENDPYNGFSIEDDKSEKGLLSENNLDEDL 289

Query: 260 ISQHQDTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDNKEELSKESVLLDIDNXXXX 319
           ++  +   +    T      SP PS  +L   +N L+    KE L  E+ LLD       
Sbjct: 290 LTDFETKIEITKRTVSDVDPSPSPSSGILIE-ENPLR----KEPLV-ENNLLDFSEGNVT 343

Query: 320 XXXXXXXXXXXXXFQDENVLEXXXXXXXXXXXXELSGYNEYNSRGSSFFKNGDYISALEE 379
                         ++ N               ELSGYNE+ ++GS+FFKNGDY+++L+E
Sbjct: 344 KSNSSESNSLFNGNRNPN-------SAIPISDIELSGYNEFKAKGSNFFKNGDYVNSLQE 396

Query: 380 YEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDS 439
           YEKSLN+LP +HPLRIIA SNI A++LK+GEYS  ++ +  AL LFP     W+ +I DS
Sbjct: 397 YEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSSMALALFPPTKANWSNMISDS 456

Query: 440 EPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNP 499
           +P +S+ DIW K+++R+AE+ EHLE+F  A + Y  LI  N F +KIM GKRRCQ  +NP
Sbjct: 457 DPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQELINKNFFDEKIMQGKRRCQNFINP 516

Query: 500 ----EIAXXXXXXXXXXXXAAVPTPSTQKYESVXXXXXXXXXXXXXXXXXLKLYDIVEAK 555
               + +                  S+    S                  L LYD V  +
Sbjct: 517 PPVKKFSPVKKATSTQSPTEKSTPTSSSSTSSNSPDTTSKIKKQELENAKLALYDKVFER 576

Query: 556 INAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISS 615
           I++WK++K +DIRHLLANL  +LTW  WK I + DLVMPK+VK+TY+KA+AKTHPDKI  
Sbjct: 577 ISSWKNDKGDDIRHLLANLSGLLTWCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPE 636

Query: 616 SLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           SL+LE+KMIAEN FS+LS+AWDKFK++N++N
Sbjct: 637 SLSLENKMIAENVFSSLSIAWDKFKQQNDIN 667

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  389 bits (1000), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 253/701 (36%), Positives = 373/701 (53%), Gaps = 95/701 (13%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           MSDPF +LL S KE G  P  +  +    K N V+  +L  T Q KKL  ++T+ S +  
Sbjct: 1   MSDPFGHLLASLKE-GNVPSSKPGS----KENSVTPGAL--TPQKKKLTPLHTE-SIVHG 52

Query: 61  NSVPTFANVSSLNSLQTTPIHDDFEELFGS---------------------STSNNFSVS 99
           N           N +  T IHDD ++LFGS                      +S++    
Sbjct: 53  NG----------NVVSNTNIHDDLDDLFGSIPKKEDVVQDNHTSIDGLDLFQSSSHVVSK 102

Query: 100 PEPTNNFKTVTDVPNVT---YEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISY 156
            EP N      D P  T    E+  + V+DEV+DME+A+LMSLGL+I+KA+SYY +GI++
Sbjct: 103 TEPDNQEINPFDNPFETEHKSESPTEEVIDEVRDMELAKLMSLGLNIDKASSYYERGITF 162

Query: 157 DTLLKKLERRR---YGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKG 213
           + +L+K +++    Y  R   D    GG           +FD+   +   S+ SG+ NKG
Sbjct: 163 EDVLRKRKQKASNGYQQRSNIDRKQGGGEIRN-------IFDT-RGSGSESLFSGILNKG 214

Query: 214 KEFIDQMTAYPEE-TDRLSRYRDISEISSMKPLRKSPGIVDGFDMDRISQHQDTDKGKAP 272
           KE ++Q++ Y EE  +R+++++   E S  +   +    +D     R SQ +   +   P
Sbjct: 215 KELVNQLSTYTEEENERMNKFKGYEEYSMSETYLEKENSMDPGVFSRSSQEKIPQRAARP 274

Query: 273 TREVQQES----------PPPSHDLLDNFQNNL---KLDDNKEELSKESVLLDIDNXXXX 319
           + E    S            P     D+ Q++L   K    +  +  E  LLD DN    
Sbjct: 275 SHEKSNSSRSKINKRMTTEAPHKPFNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHA 334

Query: 320 XXXXXXXXXXXXXFQDENVLEXXXXXXXXXXXXELSGYNEYNSRGSSFFKNGDYISALEE 379
                          ++N +             E+SGYNE+ +RG+ +FKNGDY SA+EE
Sbjct: 335 SSPVVNTS-------NQNTV---SITQIPISHIEISGYNEFKARGTDYFKNGDYASAVEE 384

Query: 380 YEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDS 439
           YEKSLNTLP  HPLRIIAYSNI A+ +KIG++S  V  A +A+KL P+E   W   IQ+S
Sbjct: 385 YEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNS 444

Query: 440 EPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNP 499
           +P +SY DIW K++LR+AE+ E +E ++LA   Y +L+E N+FS+K++ GKRRCQ  L  
Sbjct: 445 DPVRSYNDIWPKIILRQAESYEAIEKYKLALDAYQTLLEKNLFSEKVIAGKRRCQHAL-- 502

Query: 500 EIAXXXXXXXXXXXXAAVPTPSTQKYESVXXXXXXXXXXXXXXXXXLK------------ 547
                          +A P P+ ++  +V                  K            
Sbjct: 503 --GLDSKPKSNPPSKSATPAPAPRRAPTVNRQTEVVNKKSVNAEKLKKENERLAKLEDQK 560

Query: 548 --LYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAI 605
             LYD VE  IN+WK+ K +DIR+LL+NL  ++TWT+WKP+  ++LV+P+KVK+TY+KA+
Sbjct: 561 VALYDKVEGIINSWKNGKQDDIRYLLSNLQAVITWTQWKPVQSSELVLPRKVKITYMKAV 620

Query: 606 AKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           AK HPDK+ SSL LE +MIAE+ FSTLS +W+ FK+ N++N
Sbjct: 621 AKLHPDKLPSSLTLEQQMIAESVFSTLSDSWENFKKSNDIN 661

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  388 bits (996), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 265/705 (37%), Positives = 366/705 (51%), Gaps = 96/705 (13%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKK-----LNGINT-- 53
           MSDPFA+LL S K        ++  P    S  ++  ++    +  K     L+ I+   
Sbjct: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60

Query: 54  -----KVSTLSTNSVPTFANVSSLNSLQTTP------IHDDFEELFGSSTSNNFSVSPEP 102
                KV   +   VPT +   S N+   TP        DDF +LFG  T        +P
Sbjct: 61  LIPSPKVDFSAPPLVPTNSTTKS-NTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKP 119

Query: 103 TNNFKTVTDVPNVTYEAKQD-------SVVDEVKDMEIAQLMSLGLSIEKANSYYSKGIS 155
             ++          Y +K+D       ++VDEVKDMEIA+LMSLGLSIE+A  +Y   ++
Sbjct: 120 DEDY----------YGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVT 169

Query: 156 YDTLL-----KKLERRRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLF 210
           Y+  L     K+ ER     RK         +  K +K+       +++ NLFSMA+  F
Sbjct: 170 YERYLEILKSKQKERNDLAIRKKE-------SGIKMEKSGLSNIVGTDSNNLFSMATDFF 222

Query: 211 NKGKEFIDQMTAYPEET-DRLSRY---RDISEISSMKPLRKSPGIV-------------- 252
           NKGK+ +DQ T++P E  DRL+ Y    D  E   +  +  SP  +              
Sbjct: 223 NKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPA 282

Query: 253 DGFDMDRISQHQ---DTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDNKEELSKESV 309
           D  D D ++  +   D  K  AP  +V   S P S  L++        +  + E   E  
Sbjct: 283 DNPDQDLLTDFETKIDITKRTAP--DVSHSSSPTSGILIEE-------NSRRNEPLIEDS 333

Query: 310 LLDIDNXXXXXXXXXXXXXXXXXFQDENVLEXXXXXXXXXXXXELSGYNEYNSRGSSFFK 369
           LLD                      +EN               ELSGYNE+ ++G+S FK
Sbjct: 334 LLDF----SEGNLTNSKSNEDSTLFNEN---SNTDSTIPISDIELSGYNEFKAKGTSLFK 386

Query: 370 NGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKEN 429
           NGDYI++L+EYEKSLNTLP +HPLRIIA SNI A++LKIGEYS  ++ +  AL+LFP   
Sbjct: 387 NGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSK 446

Query: 430 LKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMDG 489
            KW   I +S+P +S+ DIW K+++R+AE+ EHLE+F+ A + Y  LI+ N F DKIM G
Sbjct: 447 AKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQG 506

Query: 490 KRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQKY--------ESVXXXXXXXXXXXXX 541
           KRRCQ  +NP                +   P+T+K           +             
Sbjct: 507 KRRCQDFINPPPVKKSMPVKKKTTTTS---PATKKQNLTASSSNSPISVDSTSEIKKREL 563

Query: 542 XXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTY 601
               L LYD V  KI++WK  K +DIRHLLANL ++LTW  WK +S+ DLVMPK+VK+TY
Sbjct: 564 ENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITY 623

Query: 602 LKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           +KA+AKTHPDKI  SL+LE+KMIAEN FSTLS+AWDKFK +N++N
Sbjct: 624 MKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  379 bits (973), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 263/694 (37%), Positives = 362/694 (52%), Gaps = 100/694 (14%)

Query: 1   MSDPFANLLES---------FKENGKK------------PDIEKKNPVPVKSNDVSSISL 39
           MSDPFA+LL S         FKE   +            PD+ K +    +S  + S+S 
Sbjct: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYES--LHSVSA 58

Query: 40  NSTLQPKKLNGINTKVSTLSTNSVPTFANVSSLNSLQTTP------IHDDFEELFGSSTS 93
              + P       +KVS  +   VP+  + SS N+   TP      I DDF+E+FGS   
Sbjct: 59  WPLIPP-------SKVSFSAAPLVPS-NSTSSANTASNTPSPAPVNIDDDFDEIFGSD-- 108

Query: 94  NNFSVSPEPTNNFKTVTDVPNVTYEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKG 153
                +   T   + V    +   +   D++VDEVKDMEIA+LMSLGLS++KA  +Y+  
Sbjct: 109 -----AIAATGGLQQVDQD-SHDDDDGDDALVDEVKDMEIARLMSLGLSVQKATEFYNDD 162

Query: 154 ISYDTLL------KKLERRRYGSRKGRDT----PTFGGNTNKDDKAYAKLFDSSENTNLF 203
           I+Y+  L      +K  R R    K  D     P    NT+ D            N NL 
Sbjct: 163 ITYERYLEILKSKQKKHRDRIAREKSNDIKIKKPGLFNNTDSD------------NNNLL 210

Query: 204 SMASGLFNKGKEFIDQMTAYP-EETDRLSRYRDISEISSMKPLR------KSPGIVDGFD 256
           S+A+  FNKGKE +DQ T++P EE +RL  + ++ + S+   L        S G  D  D
Sbjct: 211 SIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDESNDYDLSLEENPCNSGG--DNLD 268

Query: 257 MDRISQHQ-DTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDNKEELSKESVLLDIDN 315
            D ++  +   D  K  ++ V   SP PS D+       +  D  K+E S +  LLD   
Sbjct: 269 EDLLTDFEAKIDITKRASKNVAS-SPSPSFDI------PIDEDSGKKESSMDDSLLDFSP 321

Query: 316 XXXXXXXXXXXXXXXXXFQDENVL---EXXXXXXXXXXXXELSGYNEYNSRGSSFFKNGD 372
                              + N L                ELSGY+E+ ++G++ FKNGD
Sbjct: 322 ENFTKSDST----------ENNTLFGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGD 371

Query: 373 YISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKW 432
           Y+++L+EYEK+LN+LP +HPLRII  SNI A++LK+GEYS  +  +D AL LFP     W
Sbjct: 372 YVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASW 431

Query: 433 NLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRR 492
           N  I +S+P +S+ DIW K+++R+AE+ EHLE+F+ A + Y  LI  N F DKIM GKRR
Sbjct: 432 NNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFFDDKIMQGKRR 491

Query: 493 CQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQKYESVXXXXXXXXXXXXXXXXXLKLYDIV 552
           CQ  ++P +                P P                         L LYD V
Sbjct: 492 CQNFISPPLVRKSTPVKKTTPTLKKPAPDPS---PAPIDIPSKVKEQELENAKLALYDKV 548

Query: 553 EAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDK 612
             KI  WK  K +DIRHLL+NL  +LTW  WK +S+ DLVMPKKVK+ Y+KA+AKTHPDK
Sbjct: 549 FGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDK 608

Query: 613 ISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           I  SL+LE+KMIAEN FSTLS+AWDKFK++N++N
Sbjct: 609 IPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  348 bits (894), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 210/302 (69%), Gaps = 10/302 (3%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSGY E+ +RG+ +FKNGDY+S+ +EYEKSLNTLP +HPLRIIAYSNI A+ELKIGEYS
Sbjct: 399 ELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYS 458

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             +K +  AL++FP +  +W  +IQDS+P ++YKDIW K+ LR+AEALEH+E+F+ A   
Sbjct: 459 KSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSS 518

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQK-------- 524
           Y  LIE    +DKIMDGKRRCQKVLNP                + P+P  +K        
Sbjct: 519 YQELIEKGFANDKIMDGKRRCQKVLNPTPPPVVKTPRISTPKQS-PSPVPRKATSNSKDA 577

Query: 525 -YESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEW 583
            YESV                 L LYD V AK+  WK+ K  DIRHLLANL  +LTW +W
Sbjct: 578 VYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLANLSIVLTWCDW 637

Query: 584 KPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEEN 643
           KP++ +DLVMPKKVK+TY+KA+AKTHPDK+  SL LE+KMIAEN FS LSVAWDKFK EN
Sbjct: 638 KPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLSVAWDKFKIEN 697

Query: 644 NM 645
           NM
Sbjct: 698 NM 699

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 144/271 (53%), Gaps = 59/271 (21%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLS- 59
           MSDPFA+LL SFK NGK    +     P KSN      +++T +P      +  +S LS 
Sbjct: 1   MSDPFADLLTSFK-NGK----DNAKSEPTKSN------ISATQKPA---SASPNISQLSI 46

Query: 60  TNSVPTFA-NVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTNNFKTVTD------- 111
           T  VP+ + NVS         IHDDF++LFG S   N + +  P    KT TD       
Sbjct: 47  TPLVPSPSPNVS---------IHDDFDDLFGVSLGQNGTNTIVPKQTVKTETDDIDAAFN 97

Query: 112 ---------------VPNVTYEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISY 156
                           PN     +++ VVDEVKDME+A+LMSLGLSI++AN +Y KGI Y
Sbjct: 98  VFQATPSQSIKPEASAPNDIDRDEEEYVVDEVKDMEVARLMSLGLSIDEANDHYDKGILY 157

Query: 157 DTLLKKLER-RRYGSRKGRDTPTFGGNTN----------KDDKAYAKLFDS-SENTNLFS 204
           + LL K+++ +R   R+  +T     N+N          + D  YA + DS +   +LFS
Sbjct: 158 ENLLAKMKQNQRQKERRKVETQPTKRNSNPPSANNRLNDRFDNTYANIRDSRTRGGDLFS 217

Query: 205 MASGLFNKGKEFIDQMTAYPEETDRLSRYRD 235
           MA+    KGKEF+DQ+ AYPEE +RL  YRD
Sbjct: 218 MATDFLYKGKEFVDQLIAYPEENNRLLNYRD 248

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  342 bits (877), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/304 (57%), Positives = 210/304 (69%), Gaps = 17/304 (5%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSG+ E+ +RGS  FKNGDY+SAL+EYEKSLNTLPQ HPLRII+YSNI A +LKIGEYS
Sbjct: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469

Query: 413 NLVKKADKALKLFPKENL--KWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAY 470
             ++    AL LFPK  +   WN II DS P +S+KDIWSKL++R+AE+ EHLEN++LA 
Sbjct: 470 KSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529

Query: 471 KQYHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTP-STQKYE--- 526
             Y  LIEN   + KIMDGKRRCQK+LNP               +  PTP S  K++   
Sbjct: 530 DSYQKLIENGFTNSKIMDGKRRCQKILNPP-------PPPQTSKSPTPTPVSILKHKEKD 582

Query: 527 ----SVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTE 582
               SV                 + LYD VE+KINAWK +K  DIRHLL+NL T+LTW +
Sbjct: 583 TTTASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCD 642

Query: 583 WKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEE 642
           W  IS  DLVMPKKVK+TYLKAI KTHPDKI  SL+LE+KMIAEN FS LS+AWDKFK +
Sbjct: 643 WPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLD 702

Query: 643 NNMN 646
           NNMN
Sbjct: 703 NNMN 706

 Score =  130 bits (327), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 139/270 (51%), Gaps = 41/270 (15%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           MSDPFA+LL SFK NG+                 ++    S++Q   LN    K ST S 
Sbjct: 1   MSDPFASLLTSFK-NGQNTTNNNTTTDTDTKKLSATTPSQSSIQ-FNLN----KASTPSL 54

Query: 61  NS------VPTFANVSSLNSLQTTP--IHDDFEELFGSSTSNNFSVSPEPTNN-----FK 107
           ++      +P+  + S  NS  T+P  I DDF +LF S+   N +  P P  +     F 
Sbjct: 55  DTFALAPLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFD 114

Query: 108 TVTDVPNVTYEAKQDS-------------VVDEVKDMEIAQLMSLGLSIEKANSYYSKGI 154
             T  P +  + +Q               +VDEVKDME+A+LMSLGLSI++AN YY KGI
Sbjct: 115 IFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGI 174

Query: 155 SYDTLLKKLERRRYGSRKGRDTPTFGGNTNKD------DKAYA-KLFDSSENT--NLFSM 205
            Y+ +++K   ++   +  R+        N        D  YA K F+ S+N   NLFSM
Sbjct: 175 LYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSM 234

Query: 206 ASGLFNKGKEFIDQMTAYPEETDRLSRYRD 235
           A+ +  KGKE +DQ+TAYPEE +RL +YR+
Sbjct: 235 ATDILYKGKELVDQLTAYPEENNRLYKYRE 264

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  332 bits (852), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 206/298 (69%), Gaps = 4/298 (1%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSGY E+ + G+ FFK GDY SAL EY+KSLNTLPQ HPLR+I+YSNI AA+LK+GEYS
Sbjct: 542 ELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYS 601

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             VK  D AL+LFPK + +W   IQDS+P K+YK+IW K+VLRKAEA EH+E +++AY  
Sbjct: 602 QSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDS 661

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAA----VPTPSTQKYESV 528
           Y  L+  NVF+DKIM GKRRCQKVLNPE              +A      T S    ++V
Sbjct: 662 YQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQSTASTSSINVNKNV 721

Query: 529 XXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISV 588
                            L+L D V AKI  W +NK +DIR+LL+N+  +LTW+ WK I+ 
Sbjct: 722 ERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAINA 781

Query: 589 NDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           +DLVMPKKVKV Y+KA+AKTHPDKIS  L++E+KMIAE+ FS LSVAW+KFK  N MN
Sbjct: 782 SDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMN 839

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (60%), Gaps = 6/120 (5%)

Query: 121 QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFG 180
           Q SVVDEVKDMEIA+LMSLGLSI+KA+ YY+KG   D +L+K++ +++  +    T    
Sbjct: 213 QQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKY-- 270

Query: 181 GNTNKDDKAYAKLFDSSE---NTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRDIS 237
            +  K   +  KL +S+    N  LFS+AS   NKGK  +DQ + Y EE  R  R  + S
Sbjct: 271 -DDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEEDYRPFRSTNFS 329

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  323 bits (829), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/299 (52%), Positives = 200/299 (66%), Gaps = 10/299 (3%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSGYNE+ ++G+S FKNGDY+++L+EYEKSLN+LP  HPLRIIA SNI A++LKIGEYS
Sbjct: 366 ELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYS 425

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             ++ +D AL LFP     WN  I  S+P +SY DIW K+++R+AE+ EHLE+F+ A + 
Sbjct: 426 KSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALET 485

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQKYES----- 527
           Y  L+  N F DKIM GKRRCQ  +NP  A               PTP+  K  +     
Sbjct: 486 YQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKK-----TTPTPAPMKKPTSTPSP 540

Query: 528 VXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPIS 587
                             L LYD V  KI  WK  K +DIRHLLANL  +LTW  WK +S
Sbjct: 541 APVDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVS 600

Query: 588 VNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           V +LVMPKKVK+TY+KA+AKTHPDKI  SL+LE+KMIAEN F+TLS AWDKFK++N++N
Sbjct: 601 VQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 136/263 (51%), Gaps = 38/263 (14%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           MSDPFA+LL S K   K    E K   P   +  ++ +           G N  + + S 
Sbjct: 1   MSDPFAHLLTSLK--NKDSGTESKKTTPQTKDFTATSATVVASAATTTQGNNDGLHSFSA 58

Query: 61  NSVPTFANVS-SLNSL------------QTTP------IHDDFEELFGSSTSNNFSVSPE 101
           + +   +NVS S+  L              TP      I DDF ELFGS+T    +   +
Sbjct: 59  SPMIPASNVSFSVAPLVPSNSNSNANSASNTPTPSPANIEDDFNELFGSNTMATANELQQ 118

Query: 102 PTNNFKTVTDVPNVTYEAKQDSV-VDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLL 160
              N+   +D  +       D V VDEVKDMEIA+LMSLGLSIEKA  +Y+  ++Y+  L
Sbjct: 119 VDQNYYGNSDGSH-----DGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYL 173

Query: 161 K--KLERRRYGSRKGRDTPTFGGNTNKDDKAYAKLF--DSSENTNLFSMASGLFNKGKEF 216
           +  KL+++++  R     PT  G+++K+    A LF   S  N NLFSMA+  FNKGKE 
Sbjct: 174 EISKLKQKKHKDRIASHRPT--GSSSKN----ASLFNNASPNNNNLFSMATDFFNKGKEL 227

Query: 217 IDQMTAYPEET-DRLSRYRDISE 238
           +DQ T++P E  DRLS Y ++ +
Sbjct: 228 VDQWTSFPPEANDRLSNYVNVED 250

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  323 bits (827), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 157/297 (52%), Positives = 198/297 (66%), Gaps = 3/297 (1%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           EL GY E+  RG+  FK GDY++ALE Y+KSLNTLP  HPLRIIA SNI A+  K GEY 
Sbjct: 390 ELLGYKEFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYR 449

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             ++ +  AL+ FP +  +WN  IQDSEP ++YKDIW K+VL++AEA EH+E++E A + 
Sbjct: 450 KSIEISTSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALET 509

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQK---YESVX 529
           Y  +IE N F+DK+M GKRRCQ V+NP                  P   + +   YE+V 
Sbjct: 510 YQQMIEKNFFNDKVMSGKRRCQHVINPVKPTKSNSSALPRQTNTKPKKESNQNKAYENVE 569

Query: 530 XXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVN 589
                           L LYD VEA+IN WK+NK +DIRHLL+NL  ILTW  W P+  +
Sbjct: 570 KLKQKNKLEAEIESQRLALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPS 629

Query: 590 DLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           DLVMPKKVK+TY+KA+A+THPDKI S L LE KMIAEN FS LS AW+KFK++NNMN
Sbjct: 630 DLVMPKKVKITYMKAVARTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 122/265 (46%), Gaps = 65/265 (24%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKK-LNGINTKVSTLS 59
           M+DPFA+LL SFK          KN    K  ++++  +   L  +K +N +     TL 
Sbjct: 1   MADPFADLLSSFKSGSTT-----KNEQADKKVNIATKPMAELLTAQKPVNNV-----TLI 50

Query: 60  TNSVPTFANVSSLNSLQTTPIHDDFEELFGSSTS-------------------------- 93
            N V          S+ +  IHDD  +LFG S+                           
Sbjct: 51  ENEV----------SISSNGIHDDIADLFGLSSESKPINASKPINASKPINTSKPSEGID 100

Query: 94  ------NNFSVSPEPTNNFKTVTDVPNVTYEAKQDSVVDEVKDMEIAQLMSLGLSIEKAN 147
                 N F+ SP+ +    TVT  P V     QD VVDEVKDMEIA+LMSLGL I++A 
Sbjct: 101 DLDAAMNFFNDSPQESLRGSTVTTSPEV-----QDIVVDEVKDMEIAKLMSLGLDIDEAT 155

Query: 148 SYYSKGISYDTLLKKLERRRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMAS 207
           ++Y  GI Y+TL+ K+  R   SR      T   N +  +   A+       +N     +
Sbjct: 156 THYDNGILYETLVSKI--RTSNSRI-----TAQRNDSGRNDIRAEPMRKPRTSNGSFTFT 208

Query: 208 GLFNKGKEFIDQMTAYPEETDRLSR 232
           GLF+KGK+ +DQ T Y EE DRL R
Sbjct: 209 GLFDKGKQLVDQWTVYHEEDDRLFR 233

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  315 bits (807), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 206/301 (68%), Gaps = 9/301 (2%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSGYNE+  RG+ +FK GDY+SA E+YEKSLN+L + HPLRIIA SN+ A+ LK G+Y+
Sbjct: 393 ELSGYNEFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYT 452

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
           +++  +  AL LFPKE+  W+ +IQ+SEP K+YK+IWSKLV R+AEA E +EN++ AY  
Sbjct: 453 SMITISTSALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDS 512

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPE--------IAXXXXXXXXXXXXAAVPTPSTQK 524
           Y  LIENN+F++KIM GK RCQKVLNPE        +               V T ST  
Sbjct: 513 YQLLIENNIFNEKIMAGKLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTSS 572

Query: 525 YESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWK 584
             ++                   LYD+VE K+NAW + K +DIRHLL+ L  I+TWT+W 
Sbjct: 573 -GNLKKIQEQNKRTEKYEEEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWN 631

Query: 585 PISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENN 644
            ++ +DLVMPKKVK+TYLKA+AKTHPDK+ S+L+ ES+M+AEN FS LS  W+KFK +NN
Sbjct: 632 EVASSDLVMPKKVKITYLKAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNN 691

Query: 645 M 645
           +
Sbjct: 692 I 692

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 126/276 (45%), Gaps = 64/276 (23%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVS-SISLNSTLQPKKLNGINTKVSTLS 59
           M+DPFA+LL SFK     P+ E++N    +SN  S ++S+N  L        N+ +  L 
Sbjct: 1   MADPFADLLTSFKTG---PN-ERENSGTAQSNTTSRNLSMNELLNSSSNV-KNSNLDVLQ 55

Query: 60  TNSVPTFANVSSLNSLQTTP---------IHDDFEELFGSS----TSNNF---------- 96
               P   NV  LN   + P         + DDF++LFG S    T+N F          
Sbjct: 56  ----PKAKNVDMLNKSTSVPSNVINNNKNLLDDFDDLFGPSKPSVTTNTFKGTDQGERDD 111

Query: 97  --------SVSPEPTNNFKTVTDVPNVTYEAKQDS-----VVDEVKDMEIAQLMSLGLSI 143
                     +P P++  + V  +P+ T    Q S     +VDEVKDMEIA+LMSLGLSI
Sbjct: 112 LDDIMDMFDFTPSPSHCNQEV--MPSKTNAEAQSSSKNEVIVDEVKDMEIAKLMSLGLSI 169

Query: 144 EKANSYYSKGISYDTLLKKLE--RRRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTN 201
           ++A   +  GI YDT+  + +  +R   S   R TP     TN           +S    
Sbjct: 170 DEAIKSFEHGILYDTVASRQQAAQRFSSSSNRRGTPIANSGTN-----------NSSGGG 218

Query: 202 LFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRDIS 237
           LF   S +  K K+ ID  T   +E DRL R  D S
Sbjct: 219 LF---SSIIGKSKQLIDDWTVNHDEDDRLFRNTDFS 251

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  280 bits (715), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 193/588 (32%), Positives = 283/588 (48%), Gaps = 62/588 (10%)

Query: 83  DFEELFGSSTSNNFSVSPEPTNNFKTVTD-------VPNVTYEAKQDSVVDEVKDMEIAQ 135
           D +E+FG     N   +P   + F    D       +P    + +   +VDE+KDMEIA+
Sbjct: 48  DLDEIFGFEKQAN--SAPAVKDEFDLAFDAFDAPAKLPQNHMDPEPQPLVDEIKDMEIAR 105

Query: 136 LMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFGGNTNKDDKAYAKLFD 195
           LMSLGLS  KA SYY +G+ YD LL   ER+R   R   + P    +  +        F 
Sbjct: 106 LMSLGLSCTKATSYYERGLLYDDLL---ERKRQ-QRTREEAPQKTSDEGR--------FT 153

Query: 196 SSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRD-IS---EISSMKPLRKSPGI 251
                +L S+AS   N+G+ F+D      +  +    Y D IS   E S+    R  P  
Sbjct: 154 QGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSYSDYISSRMESSAHTGSRLRPTS 213

Query: 252 VDGFDMDRISQHQDTDKGKAPTREV--QQESPPPSHDL--LDNFQNNLKLDDNKEELSKE 307
               ++DR    QD      P       Q SP  S  L  L N  +++ +   +E  +  
Sbjct: 214 DIPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEE--ASA 271

Query: 308 SVLLDIDNXXXXXXXXXXXXXXXXXFQDENVLEXXXXXXXXXXXXELSGYNEYNSRGSSF 367
            +L+D D                      + +             E   Y E+  +G+  
Sbjct: 272 DLLVDFDAPSG-----------------HDAVSSPVAASIAMSALEFHSYQEFKEKGTLS 314

Query: 368 FKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPK 427
           F  GDY +A + +EKS+N+LP SHPLR I+ SN+    LK+GEY   ++ +  ALKL   
Sbjct: 315 FSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLI-- 372

Query: 428 ENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIM 487
              K + +I  S+P K++K+IW K+V  KAEA EH+E+++ A K+Y  LI+    S K+M
Sbjct: 373 SCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVM 432

Query: 488 DGKRRCQKVLNPE---------IAXXXXXXXXXXXXAAVPTPSTQKYESVXXXXXXXXXX 538
           +G+RRCQK++ PE         ++            AA     ++K E V          
Sbjct: 433 EGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLERVQNINKKEKEL 492

Query: 539 XXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVK 598
                    L+D V+ ++  W  N  +D+R LL+    I+ W +WK +S  DLVMPK+VK
Sbjct: 493 ERQK---FLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVK 549

Query: 599 VTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646
           + YLKA+ KTHPDKI  S  LE KM+AEN F  LS AW+ FKE+N ++
Sbjct: 550 IVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  271 bits (693), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 195/304 (64%), Gaps = 16/304 (5%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSG+ E+ S+G   F +G+Y SAL EYEKSLNTLP  HPLRII+ SNI   +LK+GE S
Sbjct: 285 ELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSNIITTQLKLGESS 344

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
           + ++  + AL+L  ++ L+  L I  S P KSY++ W K+ +RKAEALEH+EN+  A + 
Sbjct: 345 SALQNIETALRLIGEDELQ--LTIPASNPPKSYREFWGKITMRKAEALEHVENYVSALEC 402

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPST---------Q 523
           Y +LI+    + K+MDGKRRCQKVL+P                  P+P+          +
Sbjct: 403 YKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKK----PSPNVLDTSSSTLPK 458

Query: 524 KYESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWT-E 582
           + +++                   L D V+ +I +W   K  D+R LLA+LP +LTW+ +
Sbjct: 459 RSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQLLADLPKVLTWSND 518

Query: 583 WKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEE 642
           WKP++ +DLVMPKKVK+TYLKAIAKTHPDK++ SL++E KM+AE+ FS LS AW+ FKEE
Sbjct: 519 WKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIFSILSKAWEAFKEE 578

Query: 643 NNMN 646
           NN++
Sbjct: 579 NNIS 582

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 109/230 (47%), Gaps = 74/230 (32%)

Query: 3   DPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLSTNS 62
           DPFA+LL SFK  G+K                           +K +  +  VS    + 
Sbjct: 4   DPFADLLSSFK--GEK---------------------------QKSSTTSETVSLFDKHD 34

Query: 63  VPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTNNFKTVTDVPNVTYEAKQD 122
            P+ ++ +    LQT  I+DD +  F               + F + T+ P     AKQ 
Sbjct: 35  GPSISSPAPSKPLQT--INDDLDAAF---------------DVFNSATNTP-----AKQG 72

Query: 123 S-VVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLK----KLERRRYGSRKGRD-T 176
           S VVDEVKDMEIA+LMSLG+S+E+A  YY +GI YD +L+    K E +R  +   RD T
Sbjct: 73  SPVVDEVKDMEIARLMSLGVSLERALQYYERGILYDDVLRRRHEKHEAKRQAAAASRDFT 132

Query: 177 PTFG-------GNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQ 219
             F        G+   DDK            +LFSMA+GLFNKGK F+++
Sbjct: 133 KLFDNGSSNILGSDGSDDK----------QQDLFSMATGLFNKGKSFMEE 172

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  234 bits (597), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 185/305 (60%), Gaps = 16/305 (5%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           E+SGY E+N  G  +F+NGDY +A ++Y KSLNTLP  HPLRI+AYSNI   +LKIGE++
Sbjct: 362 EMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHT 421

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             +K  +KA  L    +L  + IIQ + P K+YK+ W+K++ +KAE LE+LE+++ A   
Sbjct: 422 ESLKNIEKACDLLDGSSL--DGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAV 479

Query: 473 YHSLIENNVFSDKIMDGKRRCQK---------VLNPEIAXXXXXXXXXXXXAAVPTP--S 521
           Y  LI   VF  KI++GK RCQK           +  +A            +++P     
Sbjct: 480 YRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIR 539

Query: 522 TQKYESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWT 581
           +QK E +                  +L+D V +KI +W   K  D+RHLL+ L  +LTWT
Sbjct: 540 SQKAEEL---IKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSRLSLVLTWT 596

Query: 582 EWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKE 641
            W  I  NDLV+PKKVK+ Y+KAI+K HPDK+ S+L+LESKM+AE+ FS L  AW+ FK 
Sbjct: 597 NWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKL 656

Query: 642 ENNMN 646
            N++N
Sbjct: 657 NNDIN 661

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 103/233 (44%), Gaps = 28/233 (12%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDV------SSISLNSTLQPKKLNGINTK 54
           M DPFA LL +FK  G+K ++ + +P     N +       S   +S L   ++   +  
Sbjct: 1   MGDPFATLLSNFK--GEKKELVQSSPRNASLNAILCESSSKSFESSSALDKLQVQDTSKN 58

Query: 55  VSTLSTNSVPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTN---NF-KTVT 110
             T+  +    F+  +S +        D   ELF    S +    PE  +   +F  TV 
Sbjct: 59  AKTVQYDPENAFSERNSAD--------DSLNELFCLRDSASPLPPPEKESIAFDFDTTVR 110

Query: 111 DV-PNVTYEAK---QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLER- 165
           D+ P    EA    +  +++ V  ME   + + G+S E ANS Y +G+ Y    + L+  
Sbjct: 111 DLNPANLNEAMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNG 170

Query: 166 RRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFID 218
           +++  R G    T G  ++ D+         +E  NL S AS LF KG++ ++
Sbjct: 171 KKFQQRNGF---TAGQRSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVE 220

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  232 bits (591), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 128/299 (42%), Positives = 177/299 (59%), Gaps = 12/299 (4%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           EL+ +NE+ + G  +F +GDY +AL E+EKS NTLP  HPLRII+ SNI + +LK+GE S
Sbjct: 329 ELTSFNEFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENS 388

Query: 413 NLVKKADKALKLFPKENLKWNL--IIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAY 470
             ++    AL L    +L  N   II+ S P +++K + +K+ L+ AE  EHLEN+E A 
Sbjct: 389 KALESVKLALDL---SDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKAL 445

Query: 471 KQYHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQKYE---- 526
             Y +LI N +   K+MDGKRRC+K++NPE                +P  S         
Sbjct: 446 SLYANLISNGITEQKVMDGKRRCEKIVNPE---KFKPAKEKISSPTIPVRSKTSISADTV 502

Query: 527 SVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPI 586
           +V                 L+L D V+ KI+ W  N   D+R+LLANL  +L W  WK +
Sbjct: 503 AVNRVKEENKKQEEEEEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKEV 562

Query: 587 SVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNM 645
           S  DLVM KKVK+ YLKAIAKTHPDKI +  +LE+ MIAEN ++ L+ AW+ FK +NN+
Sbjct: 563 SPQDLVMTKKVKICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 129/269 (47%), Gaps = 44/269 (16%)

Query: 1   MSDPFANLLESFK----ENGKKPDIEKKNPVPVKSNDV--SSISLNSTLQPKKLNGINTK 54
           MSDPFA+LL SFK      G      K   +    ND+  S  +L S L  K  + + +K
Sbjct: 1   MSDPFADLLSSFKGVNSSTGNNSSANKNASL----NDLLSSHSALTSPLSRKSPSNVPSK 56

Query: 55  ----VSTLSTNSVPTFANVSSLNSLQTTPIHDDFEELFGSSTS--NNFSVSPEPTNNFKT 108
               +S  S  +   F +       Q TP+ +   ++  S+ +  ++F ++      F++
Sbjct: 57  TPESISITSMTASQDFFDDLLAAPSQVTPLRESPSQVAPSTATEKDDFDLA------FES 110

Query: 109 VTDVPNVTYEAKQ-------DSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLK 161
               P+V     Q         +VDEVKDMEIA+LMSLGLS +KA  YY KGI Y+ L++
Sbjct: 111 FNSTPHVDLVQPQPDPIPEPQPLVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEELIE 170

Query: 162 KLERRRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFID--- 218
             +++R  SR   +   FG    +  ++     DSS      S+AS LFN GKEFI+   
Sbjct: 171 S-QKKRKQSRSNVNN-DFGQQQLRKQESR----DSS--PAFISVASNLFNMGKEFIEDKL 222

Query: 219 QMTAYPEETDRLSRYRDISEISSMKPLRK 247
           + T  P+  +   R    S+ S   PLR+
Sbjct: 223 KPTLQPQYANSSQR----SQFSDDIPLRR 247

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  222 bits (566), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 170/305 (55%), Gaps = 13/305 (4%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           E   + E+  +G++ F+ GDY +A + YEKSLN+LP +HPLR++++SNI    LK+GEY 
Sbjct: 321 ERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYR 380

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             +  A  ALKL P+ ++  N  I +  P K+YK+ WSK++  KA A E +EN+E A + 
Sbjct: 381 EALSDASSALKLIPQGSMNSN--IPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALET 438

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPE---IAXXXXXXXXXXXXAAVPTPSTQKY---- 525
           Y  LIE  V S K+++ +R+CQK +  E   ++            A    PS +      
Sbjct: 439 YQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPAKVTL 498

Query: 526 ----ESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWT 581
               E +                   L+D V + I  W     +++R LLA   TI+ W 
Sbjct: 499 ENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWV 558

Query: 582 EWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKE 641
            WK +S  DLV+PKK KV YLKA+AKTHPDKI  S  L+ KMIAEN F  LS AW+ FKE
Sbjct: 559 NWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKE 618

Query: 642 ENNMN 646
           +N ++
Sbjct: 619 KNQLS 623

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 78/149 (52%), Gaps = 28/149 (18%)

Query: 83  DFEELFGSSTSNNFSVSPEPTNNFKTVTDV-----------PNV-TYEAKQDSVVDEVKD 130
           D +  FGS TSN  + S    + F    D+           P+V   E K   VVDEVKD
Sbjct: 48  DLDAFFGSKTSN--ATSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKD 105

Query: 131 MEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGS-RKGRDTPTFGGNTNKDDKA 189
           MEIA+LMSLGL  +KA  YY +GI Y+ ++ + +RR   + R  R +P            
Sbjct: 106 MEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPLRTSPQ----------- 154

Query: 190 YAKLFDSSENTNLFSMASGLFNKGKEFID 218
            ++L +  E ++LFS+AS   NKG+ F+D
Sbjct: 155 SSQLRE--EESDLFSVASNWLNKGRTFLD 181

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  214 bits (546), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 178/309 (57%), Gaps = 27/309 (8%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           ELSGY ++N   +  +K GDY +A ++Y KSLNTLP +HPLRIIA SNI   +LKIGE++
Sbjct: 352 ELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHT 411

Query: 413 NLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQ 472
             +K  + A++L   +++ ++  IQD+ P ++YK+ W K++ +KAE LE  +N+E A   
Sbjct: 412 ESMKNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSV 469

Query: 473 YHSLIENNVFSDKIMDGKRRCQKVLNPEIAXXXXXXXXXXXXAAVPTPSTQ--------- 523
           Y  LI        I++GK RCQK  N +              ++ PT +TQ         
Sbjct: 470 YQQLISRGYTPKLILNGKARCQKACNSQKGNV----------SSNPTATTQGDRKNPRKQ 519

Query: 524 ------KYESVXXXXXXXXXXXXXXXXXLKLYDIVEAKINAWKSNKPEDIRHLLANLPTI 577
                 K E V                   L+D VE++I  W + K  D+RHLL  LP +
Sbjct: 520 TATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDLRHLLLGLPAL 579

Query: 578 LTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWD 637
           L W     +  +DLVMPK+VK++YLKA++KTHPDK+  +L LE KM+AE+ F TL+ AW 
Sbjct: 580 LPWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWG 639

Query: 638 KFKEENNMN 646
            FKEEN+++
Sbjct: 640 VFKEENSLS 648

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 124/329 (37%), Gaps = 81/329 (24%)

Query: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60
           MSDPFANLL  FK  GK+         P  +    + SLN  L    ++ ++   +TL T
Sbjct: 1   MSDPFANLLTKFK--GKEK--------PADAQTSKNRSLNDLLAQHSVSSLSEPPATLYT 50

Query: 61  --NSVPTFANVSSLNSLQTTPIHDD--FEELFGSSTSNNFS---------VSPEPTNNFK 107
             ++ P    V         P      ++   G+ ++  +            P P  +  
Sbjct: 51  PRDTRPAAGLVDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVS 110

Query: 108 TVTDVPNVTYEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTL-LKKLE-- 164
                   ++E K  ++ DE +D E+A+LMSLGL I  AN YY +G  Y+ L +++ E  
Sbjct: 111 --------SFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESD 162

Query: 165 --RRRYGSRKGRD-----TPTFG-----------------GNTNKDDKAYAKLFDSSENT 200
             R   GS  GR+     +  FG                 G     +        S  + 
Sbjct: 163 GTRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSN 222

Query: 201 NLFSMASGLFNKGKEFIDQMTAYPEETDRLSR-----------------------YRDIS 237
            L S AS LFN+G++FI+   A    T   SR                         D +
Sbjct: 223 RLVSAASNLFNRGRDFIEDQLATHARTSASSRSTLSDSNERFSNHTQESDYSVNQTNDQA 282

Query: 238 EISSMKPLRKSPGIVDGFDMDRISQHQDT 266
            +   +P      +++GF    + QHQ T
Sbjct: 283 HLIHTQPTAAEVDLLEGFADTEVVQHQST 311

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 354 LSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSN 413
           +  ++   ++G+ FFK  DY +A+  Y+K++   P S+P   I YSN     +K+ ++S 
Sbjct: 1   MEDFDTLKAKGNVFFKKCDYETAVLYYQKAITADP-SNP---IGYSNNAMGLIKLEKWSE 56

Query: 414 LVKKADKALKLFPKENLKWNLIIQDSEPHK 443
            V   +K LK+   EN K   I+Q  E  K
Sbjct: 57  AVDACNKGLKMICPENDKDGKIVQKLEWRK 86

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 17/101 (16%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G++FFKNGDY +A+  YEK+   L  S+P   I +SN+  A +K+  +   V   DK L
Sbjct: 47  KGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNACDKGL 102

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHL 463
               K + K  +   DS+  +       KL  R+  AL+HL
Sbjct: 103 N---KVSFKTGM---DSKTKQ-------KLEWRRITALKHL 130

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 53/104 (50%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           RG+ FFK  DY +AL+ Y  +L  + +  P   + YSNI+A  + +G+   +V+ + KAL
Sbjct: 107 RGNEFFKKKDYDNALKYYNYAL--VVKKDP---VFYSNISACYVSLGQLDKVVENSTKAL 161

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           +L P                      +SK +LR+A A E LEN+
Sbjct: 162 ELKPD---------------------YSKALLRRASANESLENY 184

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 14/95 (14%)

Query: 357 YNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVK 416
           + EY + G+++FK+G+Y+ A+E Y+K +   P+ +P   I YSN   + +K+ +Y+  ++
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPE-NP---IGYSNSAMSLIKLTKYTEALE 58

Query: 417 KADKALK--------LFPKENLKWNLIIQDSEPHK 443
                LK        ++ K   ++NL   D+E  K
Sbjct: 59  SCGTGLKYVNDADSQVYKKLQYRYNL--ADTELRK 91

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 357 YNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVK 416
           + +Y   G+  FK G Y  A E Y+K ++  P++ P   I YSN   A +K+G Y+ +V+
Sbjct: 3   FEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPEN-P---IGYSNKAMALIKLGRYTEVVE 58

Query: 417 KADKALKLFP 426
              K L   P
Sbjct: 59  LCRKGLTFTP 68

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 40.4 bits (93), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 354 LSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSN 413
           +S + +   +G+S FK G Y  A+  Y++ +   PQ+     + YSN   A +K+GEY+ 
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNP----VGYSNKAMALIKLGEYTQ 56

Query: 414 LVKKADKALK 423
            ++   + L+
Sbjct: 57  AIQMCQQGLR 66

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 51/104 (49%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FFK   Y  AL+ Y  +L+   +  P   + YSNI+A  + +G    +V+ + KAL
Sbjct: 105 KGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESSTKAL 159

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           +L P                      +SK +LR+A A E+LENF
Sbjct: 160 ELKPD---------------------YSKALLRRASANENLENF 182

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ +FK  DY +A++ Y  +L+      P   I YSNI+A  + +G+   +++ + KAL
Sbjct: 128 KGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESSTKAL 182

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           +L P                      +SK +LR+A A E LEN+
Sbjct: 183 ELNPN---------------------YSKALLRRASANESLENY 205

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 357 YNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVK 416
           + E  ++G+  FKNG Y  A+  Y + ++  P S+P   I YSN   A LK   +   + 
Sbjct: 3   FEELKAKGNISFKNGSYSEAISWYNRCISIDP-SNP---IGYSNKAMALLKADRFDEAIT 58

Query: 417 KADKALKLFPKENLKWNLIIQDSE 440
             +K L+L  KE+ + NLI Q  E
Sbjct: 59  TCEKGLQLISKEDPE-NLIKQKLE 81

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 38.9 bits (89), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 354 LSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSN 413
           ++ + +   +G++ FK G Y+ A++ Y++ +   PQ+     + YSN   A +K+GE++ 
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQNP----VGYSNKAMALIKLGEHAQ 60

Query: 414 LVKKADKALK 423
            ++   + L+
Sbjct: 61  AIQACQQGLQ 70

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FFK  DY +AL+ Y+ +L TL +      + YSNI+A  + + +   +V+ + KAL
Sbjct: 112 KGNEFFKQKDYDNALKYYDYAL-TLKKDP----VFYSNISACYVSMNQLDKVVENSTKAL 166

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           +L P                      +SK +LR+A A E LEN+
Sbjct: 167 ELKPD---------------------YSKALLRRASANESLENY 189

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 26/124 (20%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           E   +G+ +FK  DY +AL+ Y+ +L  + +  P   + YSN++A  + + E   +++ +
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 419 DKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIE 478
            KAL+L P                      +SK +LR+A A E LEN+  A      L  
Sbjct: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203

Query: 479 NNVF 482
           NN F
Sbjct: 204 NNDF 207

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 26/122 (21%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FF+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482
           +L P                      +SK++LR+A A E L NF  A      L  N  F
Sbjct: 160 ELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198

Query: 483 SD 484
           +D
Sbjct: 199 ND 200

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ +FK  D+ +AL+ Y  +L TL Q      + YSNI+A  + +G+   +V+ + +AL
Sbjct: 111 KGNDYFKKQDFENALKYYNYAL-TLKQDP----VFYSNISACYVSLGQLEKVVESSTEAL 165

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           KL                     K  +SK +LR+A A E L N+
Sbjct: 166 KL---------------------KHDYSKALLRRASAYESLANY 188

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423
           G+      DY  A+E+Y +++ TLP +    +I Y+N  AA   + EY N +K A+KA++
Sbjct: 106 GNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAYSSVKEYDNAIKDAEKAIE 161

Query: 424 LFP 426
           + P
Sbjct: 162 IDP 164

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 357 YNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVK 416
           ++ + + G+ +FK G+Y SA++ YEK +   P++ P   I YSN   A +K  +    V+
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEINPEN-P---IGYSNKAMALIKANKNQEAVR 58

Query: 417 KADKALKLFPK 427
                LK   K
Sbjct: 59  TCQDGLKRVSK 69

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 26/122 (21%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ +F+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482
           +L P                      +SK++LR+A A E L NF  A      L  N  F
Sbjct: 160 ELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198

Query: 483 SD 484
           +D
Sbjct: 199 ND 200

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 26/122 (21%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FF+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 105 KGNQFFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482
           +L P                      +SK++LR+A A E L  F  A      L  N  F
Sbjct: 160 ELKPD---------------------YSKVLLRRASANEGLGKFADAMFDLSVLSLNGDF 198

Query: 483 SD 484
           +D
Sbjct: 199 ND 200

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 26/122 (21%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ +F+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482
           ++ P                      +SK++LR+A A E L NF  A      L  N  F
Sbjct: 160 EIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198

Query: 483 SD 484
           +D
Sbjct: 199 ND 200

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 35.4 bits (80), Expect = 0.078,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423
           G++ FK G Y  A++ Y++ +   PQ+     + YSN   A +K+ EY++ ++   + L+
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNP----VGYSNKAMALIKLAEYTHAIQTCQEGLR 70

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 24/120 (20%)

Query: 358 NEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKK 417
           +EY   G++ F   DY  A++ + K++     S     + YSN +AA     +Y   +  
Sbjct: 6   DEYKQEGNTAFVAKDYQKAIDAFTKAIEV---SETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 418 ADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLI 477
           AD+ +K+ P                      W+K   RK  AL+ L  +E A + Y+  +
Sbjct: 63  ADECIKINPS---------------------WAKGYTRKGAALQGLHKYEEAEQCYNETL 101

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FFKN  Y  A++ Y  ++    +  P   + YSN +A  + +G+   +V+    AL
Sbjct: 101 KGNEFFKNKKYDEAIQYYSWAIEV--KEDP---VFYSNRSACYVSLGQQEKVVEDTTAAL 155

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           KL P                      +SK +LR+A A E L NF
Sbjct: 156 KLKPD---------------------YSKCLLRRASANESLGNF 178

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+  FK   +  A++ Y  +L    +  P   I YSNI+A    + +Y  +++ A KAL
Sbjct: 116 KGNELFKTSKFEDAIKYYHYALKL--KDDP---IYYSNISACYASLLQYEKVIEYATKAL 170

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           KL P                      +SK+++R+A A E + NF
Sbjct: 171 KLRP---------------------TFSKVLMRRALAYEAMGNF 193

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 360 YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKAD 419
           + + G+++ K  +Y+ A+E Y +++    +  P + I +SN   A+LK+  + + +   D
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAI----ELDPTQSIFFSNRALAQLKLDNFQSCMNDCD 70

Query: 420 KALKLFPK 427
            AL+L PK
Sbjct: 71  VALRLDPK 78

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G++ FK  D+ +A++ Y  +L+   +  P   + YSNI+A    +  Y  +++ A KAL
Sbjct: 101 KGNALFKKKDFENAIKYYTFALSL--KEDP---VYYSNISACYSSLLNYEKVIEMATKAL 155

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
            L P                      +SK+++R+A A E L NF
Sbjct: 156 ALRPD---------------------YSKVLVRRANAYEKLGNF 178

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FFK  D+  A+E Y     TL  S     + YSN +AA + I  +  +V+    AL
Sbjct: 110 KGNEFFKAKDFEKAIEYY-----TLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           KL P                      +SK  LR+A A E+L  F
Sbjct: 165 KLKPD---------------------YSKCWLRRASAYENLGQF 187

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423
           G  +F  GD+ SA++ Y + +   P  H  R   YSN  AA  K+  + + +K  DKA++
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAP--HDAR--GYSNRAAALSKLMSFPDAIKDCDKAIE 454

Query: 424 LFP 426
           + P
Sbjct: 455 IDP 457

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+S FK   +  A++ Y  ++    + +P   I YSN++A  + + +   ++K  +KAL
Sbjct: 117 KGNSLFKADKFEEAIKYYNWAIEL--KENP---IFYSNLSACYVSLNKLEEIIKYCNKAL 171

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           +L P                      +SK++LR+A A E LEN+
Sbjct: 172 ELKPD---------------------YSKVLLRRANANEKLENY 194

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 26/107 (24%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           E  ++G+ +FK+ D  +A++ YE +L  L Q      + YSNI+A    + +   +++ +
Sbjct: 160 ELKNKGNQYFKSKDNENAIKYYEYALR-LDQDP----VFYSNISACYFAMNQLDKVIESS 214

Query: 419 DKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLEN 465
           +KAL+L P                      +SK +LR+A A E L N
Sbjct: 215 NKALELKPD---------------------YSKALLRRANAYEALGN 240

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 357 YNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVK 416
           +N+    G++FF+ GDY  A   Y++ +   P ++P   I YSN   + +K G +   V+
Sbjct: 3   FNDLKQEGNTFFQKGDYAQANGYYDQCIKLEP-TNP---IGYSNKAMSLIKQGNHGLAVE 58

Query: 417 KADKALK 423
              + LK
Sbjct: 59  TCQEGLK 65

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           ++ ++G+ + K  DY SA+E Y K++  L  +     I +SN   A LK   + + V   
Sbjct: 14  DFKNKGNEYIKKSDYDSAIEFYSKAI-ALDSTQS---IYFSNRALAHLKQDNFYSAVVDC 69

Query: 419 DKALKLFPK 427
           D ALKL PK
Sbjct: 70  DNALKLDPK 78

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%)

Query: 360 YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKAD 419
           +  +G+  +K   +  A E Y K ++   Q + +    Y+N  A EL+I  Y   +    
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 420 KALKLFPK 427
           +AL+L PK
Sbjct: 144 QALQLNPK 151

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           EY + G++  K  DY  A+E+Y+K++    +    + + +SN     LK+  +    +  
Sbjct: 11  EYKNEGNACVKVQDYAKAIEKYDKAI----ELDDTQSVYFSNRALCHLKLDNFQCASQDC 66

Query: 419 DKALKLFPK 427
           DKAL L PK
Sbjct: 67  DKALALDPK 75

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 46/104 (44%), Gaps = 26/104 (25%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FFKN  +  AL+ Y  SL    +  P   + YSN +A  + +G+   +V+    AL
Sbjct: 102 KGNEFFKNKQFEDALKYY--SLAIEVKEDP---VFYSNRSACYVSLGQQEKVVEDTTAAL 156

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           KL P                      +SK +LR+A A E L  F
Sbjct: 157 KLKPD---------------------YSKCLLRRASANESLGKF 179

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 25/132 (18%)

Query: 372 DYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLK 431
           D+  A+E+Y +++  LP +     I Y+N  AA   + E+   +K A+ A+K+ P     
Sbjct: 116 DFHLAVEKYTEAIKILPTN----AIYYANRAAAHSSLKEFEEAIKDAESAIKIDP----- 166

Query: 432 WNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMD--- 488
                       SY   +S+L   K    +H E  E +YK+   +  +N  +    D   
Sbjct: 167 ------------SYSKGYSRLAFAKYGLGKHEEALE-SYKKVLDIEGDNATAGMKRDYET 213

Query: 489 GKRRCQKVLNPE 500
            K+R ++ +N E
Sbjct: 214 AKKRVEESMNVE 225

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 357 YNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELK 407
           +  +   G+  FK G+Y  A+E+Y K ++      P   + YSN+  A LK
Sbjct: 35  FQHFKDIGNEHFKKGEYDLAIEQYRKCISL----EPTNAVGYSNLAMAYLK 81

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 355 SGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEY 411
           + +N YN+R  ++ K  ++  A+ +  KS+    + HP    AY  +  A+ +IG+Y
Sbjct: 166 TNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 26/121 (21%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+  FK      A++ Y+ +L    +  P   + Y+NI+A  + + ++  +++  +KAL
Sbjct: 112 KGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCNKAL 166

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482
           +L P                      +SK++LR+A   E++ENF  A      L  NN F
Sbjct: 167 ELKPD---------------------YSKVLLRRANTYENMENFADAMFDLSVLSLNNDF 205

Query: 483 S 483
           S
Sbjct: 206 S 206

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
           Anc_2.350 YMR161W
          Length = 175

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 581 TEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLS-----VA 635
           T +  I V+  V  +++K++Y + I K HPDK SS    E+  +   A+ TLS       
Sbjct: 23  TYYDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEAFALVHKAYKTLSNKQKRAM 82

Query: 636 WDKF 639
           +DK+
Sbjct: 83  YDKY 86

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 49/119 (41%), Gaps = 30/119 (25%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHP-------------LRIIAYSNITAAELKIGE 410
           G+S FK   +  AL +YEKS + L Q  P             LRI  + NI    +K G+
Sbjct: 225 GTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIKTGD 284

Query: 411 YSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELA 469
           Y        KAL            ++ D+      K   +K + R+  A  HL++ E+A
Sbjct: 285 YQ-------KALT-------STTEVVHDAAADDKSK---AKALYRRGLAYYHLKDPEMA 326

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 32.0 bits (71), Expect = 1.5,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423
           G+  +K G Y  A+  Y++ +   PQ+     + +SN   A +K+GE++  ++   + L+
Sbjct: 11  GNELYKQGLYRDAIGCYDRLIAAQPQNP----VGHSNKAMALIKLGEHAQAIEACQQGLQ 66

Query: 424 L 424
           L
Sbjct: 67  L 67

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 25/104 (24%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           RG+ FF   ++  A++ Y+ ++   P + P   + YSNI+A  +  G+   +++   KAL
Sbjct: 133 RGNHFFTAKNFNEAIKYYQYAIELDP-NEP---VFYSNISACYISTGDLEKVIEFTTKAL 188

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           ++ P                       SK +LR+A A E L NF
Sbjct: 189 EIKPDH---------------------SKALLRRASANESLGNF 211

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+    N DY  A+ +Y +++  LP +     I Y+N  AA   + EY   VK A+ A+
Sbjct: 108 QGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAHSSLKEYDQAVKDAESAI 163

Query: 423 KLFP 426
            + P
Sbjct: 164 SIDP 167

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 24/125 (19%)

Query: 354 LSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSN 413
           ++  +EY  +G++ F   DY  A E + K+++   Q  P  ++ YSN +A    + +++ 
Sbjct: 1   MTSADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQ--PNHVL-YSNRSACYTSLKKFAE 57

Query: 414 LVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQY 473
            +K A++ +K+ P                      WSK   R   A   L N E A K Y
Sbjct: 58  GLKDAEECVKINPG---------------------WSKGYNRVGAAQFGLNNLEDAEKSY 96

Query: 474 HSLIE 478
              +E
Sbjct: 97  QKALE 101

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 358 NEYNSRGSSFFKNGDYISALEEYEKSLNTLPQ-SHPLRIIAYSNITAAELKIGEYSNLVK 416
           +EY  +G++ F   DY  A++ + K+++   Q +H L    YSN +A    + ++ N +K
Sbjct: 6   DEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVL----YSNRSACYTSLKKFVNALK 61

Query: 417 KADKALKLFPKENLKWNLI 435
            A++ +K+ P  +  +N +
Sbjct: 62  DAEECVKINPSWSKGYNRV 80

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 25/104 (24%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FF   ++  A++ Y+ ++   P       + YSNI+A  +  G+ + +++   KAL
Sbjct: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDP----VFYSNISACYISTGDLNKVLEYTTKAL 185

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           ++ P                       SK +LR+A A E L NF
Sbjct: 186 EIKPDH---------------------SKALLRRASANESLGNF 208

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 353 ELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYS 412
           E++G   + +RG+ F+K   Y  A E Y K ++       +    Y+N  A EL++  + 
Sbjct: 72  EIAG--NFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFR 129

Query: 413 NLVKKADKAL 422
             ++   KAL
Sbjct: 130 KCIEDCKKAL 139

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 25/104 (24%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FF + ++  A++ Y+ ++   P       + YSN++A  +  G+ + +V+   KAL
Sbjct: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDP----VFYSNMSACYISTGDLNKVVEYTTKAL 186

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           ++ P                       SK +LR+A A E L NF
Sbjct: 187 EIKPDH---------------------SKALLRRASANESLGNF 209

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%)

Query: 360 YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKAD 419
           +  +G+  +K   +  A E Y K L    +   +    Y+N  A EL++  Y   ++   
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 420 KALKLFPK 427
           KAL + PK
Sbjct: 146 KALTINPK 153

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 25/104 (24%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+ FF    +  A++ Y+ ++   P       + YSNI+A  +  G+   +V+   KAL
Sbjct: 137 KGNHFFTAKSFGDAIKYYQYAIELDPNDP----VFYSNISACYISTGDLDKVVEYTTKAL 192

Query: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
           ++ P                       SK +LR+A A E L NF
Sbjct: 193 EIKPDH---------------------SKALLRRASANESLGNF 215

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 360 YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKAD 419
           Y   G+ F K  D+  A E Y K++ T     P + I YSN   A LK+  + N +    
Sbjct: 12  YKDEGNKFLKQQDFQRANELYTKAIET----DPTQSIFYSNRALANLKLDNFMNALNDCT 67

Query: 420 KALKL 424
            A++L
Sbjct: 68  NAIEL 72

>Smik_2.359 Chr2 complement(641781..643805) [2025 bp, 674 aa] {ON}
           YBR216C (REAL)
          Length = 674

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 49/112 (43%), Gaps = 3/112 (2%)

Query: 50  GINTKVSTLSTNSVPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTNNFKTV 109
           GI+T + T++TN+   +    +    Q +  H +F ELF       FS+  +    F+ V
Sbjct: 282 GISTPIKTINTNTDVKYYCALNHQKFQLSVYHTEFLELFCRYYQMAFSLDVDVEKEFQKV 341

Query: 110 TDVPNVTYEA---KQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDT 158
            +   + Y +   +  +V DE K +  + +  L  + E   +   K +  D+
Sbjct: 342 IEECKIIYRSVPPEISAVNDEAKLVLESMVYKLAYTFEVQKAANEKNVGLDS 393

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 372 DYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFP 426
           +Y SA+++Y K++   P S+P     YSN  AA   I +++N V  A+ A+KL P
Sbjct: 113 NYKSAIDKYSKAIEIYP-SNPFY---YSNRAAAYQMIEDFTNAVLDANTAIKLDP 163

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 17/106 (16%)

Query: 362 SRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKA 421
           S+G+  +  G+Y +A+  Y+ +    P S+P+ +   +N++ A LK+  + + +   D+A
Sbjct: 13  SKGNDLYSKGEYETAVLYYKNASLAEP-SNPVHL---ANMSMALLKLERWEDALSACDRA 68

Query: 422 LKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFE 467
           L++  K  +  + I+Q             K+  RK  A EHL   E
Sbjct: 69  LEIMKKGPVTDDKILQ-------------KVQWRKKLAHEHLAGTE 101

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+    N +Y  A+++Y ++++ LP +     I Y+N  AA   + EY   +K A+ A+
Sbjct: 108 QGNKAMANKEYELAIKKYTEAIDVLPTN----AIYYANRAAAHSSLKEYDEAIKDAESAI 163

Query: 423 KLFP 426
            + P
Sbjct: 164 SVDP 167

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 30/113 (26%)

Query: 358 NEYNS----RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSN 413
           NEY S    RG+++FK  DY +A+  Y+ +L    ++ P   + YSN+ A  + +     
Sbjct: 83  NEYASELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKE 137

Query: 414 LVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466
            ++   KAL+L P                      +SK++L++A   E++  F
Sbjct: 138 AIEACSKALELNPD---------------------YSKVLLKRAAVYENIGKF 169

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           EY  +G+ F K  D+I A E Y K++    +    + I +SN   A LK   +   +   
Sbjct: 14  EYKDQGNDFVKKQDFIKAAELYTKAI----ELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 419 DKALKL 424
           DKAL+L
Sbjct: 70  DKALEL 75

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           E  + G+ F K   ++ A+E+Y ++++        + I +SN   A  K+  + + +   
Sbjct: 14  ERKNEGNVFIKEKHFLKAIEKYTQAIDL----DSTQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 419 DKALKLFPK 427
           D+ALKL PK
Sbjct: 70  DEALKLDPK 78

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%)

Query: 360 YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKAD 419
           +  +G+  +K   +  A E Y K LN   +   +    ++N  A EL++  Y   ++   
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 420 KALKLFPK 427
           KAL + PK
Sbjct: 146 KALSINPK 153

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 595 KKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEE 642
           + +K  Y K   K HPDK++  L  + K + E A+  ++ A++   +E
Sbjct: 139 RDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           E+ + G+ F K  +Y  A+E Y K++   P       I YSN   A+LK+  + +     
Sbjct: 14  EFKNEGNVFIKEQNYSKAIELYTKAIELDPNQS----IFYSNRALAQLKLDNFQSAYNDC 69

Query: 419 DKALKL 424
           ++AL L
Sbjct: 70  NEALTL 75

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422
           +G+    N DY  A+ +Y +++  LP       I Y+N  AA   + EY   VK A+ ++
Sbjct: 108 QGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKDAESSI 163

Query: 423 KLFP 426
            + P
Sbjct: 164 SIDP 167

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKA 418
           EY  +G+ F  + DY  A+E Y K++    +    + I +SN   A LK+  + + ++ +
Sbjct: 11  EYKDQGNKFVASKDYGQAIEAYTKAI----ELDGCQSIFFSNRALANLKLDRFQSALEDS 66

Query: 419 DKALKL 424
            KA++L
Sbjct: 67  SKAIEL 72

>Skud_5.219 Chr5 (345754..347331) [1578 bp, 525 aa] {ON} YER096W
           (REAL)
          Length = 525

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 176 TPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRD 235
            P  GG+T   D + + +    E  N F   S + ++G+EF D + + PE   R+S   D
Sbjct: 91  APAVGGDTMASDPSPSLV----EKYNTFPTKS-ILSEGREFADDIPSSPEGKSRVSFETD 145

Query: 236 I-SEIS-SMKPLRKSPGIVDGF 255
           I SEIS S  P R S  + D F
Sbjct: 146 ISSEISDSTAPQRNS--VFDDF 165

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 359 EYNSRGSSFFKNGDYISALEEYEKSL---NTLPQSHPLRIIAYSNITAAELKIGEYSNLV 415
           E+ +RG+   K  DY  A+E Y +++   +T+        I +SN     LK+  + + +
Sbjct: 14  EFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVS-------IYFSNRAMGHLKMDNFQSGI 66

Query: 416 KKADKALKLFPK 427
              DKAL++ PK
Sbjct: 67  NDCDKALEIDPK 78

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 595 KKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEE 642
           ++V+ +Y K   K HPDK+S  L+ E ++  E  +  ++ A+    EE
Sbjct: 129 REVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423
           G+ F K  D+  A++ Y K++         + I +SN   A LK+  + + +   D+ALK
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGL----DSTQSIYFSNRALAHLKLDNFQSSLNDCDEALK 74

Query: 424 LFPK 427
           L PK
Sbjct: 75  LDPK 78

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 51/109 (46%), Gaps = 34/109 (31%)

Query: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRI----IAYSNITAAELKIGEYSNLVKKA 418
           +G++ FK   +  A+E Y         +H +++    + +SNI+A  + +G+   +V+ +
Sbjct: 99  KGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVVESS 149

Query: 419 DKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFE 467
            +AL+L P                      +SK +LR+A A E++  ++
Sbjct: 150 TRALELKPD---------------------YSKALLRRASAYENMGRYQ 177

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423
           G+      DY SA+++Y +++  LP +     + Y+N  AA   + +Y + V  A+ A+K
Sbjct: 100 GNKAMATKDYESAIKKYSEAIEVLPTNA----VYYANRAAAYSSLKKYDDAVNDAESAIK 155

Query: 424 LFP 426
           + P
Sbjct: 156 VNP 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,297,281
Number of extensions: 3236405
Number of successful extensions: 12489
Number of sequences better than 10.0: 292
Number of HSP's gapped: 13040
Number of HSP's successfully gapped: 328
Length of query: 646
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 530
Effective length of database: 40,180,143
Effective search space: 21295475790
Effective search space used: 21295475790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)