Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0C018405.353ON58583001e-37
NCAS0H016305.353ON58582783e-34
YHR072W-A (NOP10)5.353ON58582766e-34
TBLA0H019605.353ON58582767e-34
Smik_8.1495.353ON58582759e-34
CAGL0J10802g5.353ON57562741e-33
ZYRO0D10208g5.353ON64572732e-33
Skud_8.1325.353ON58582697e-33
Kpol_1051.65.353ON58582698e-33
Kwal_34.159765.353ON59582698e-33
Suva_15.2635.353ON58582698e-33
KLTH0H14894g5.353ON59582699e-33
TDEL0E027405.353ON58582671e-32
SAKL0G08800g5.353ON59582662e-32
KLLA0C16753g5.353ON57572635e-32
KNAG0C054905.353ON56562637e-32
TPHA0D020805.353ON59582621e-31
Ecym_81795.353ON58582541e-30
AGR354W5.353ON69562472e-29
Suva_16.4453.443ON249629630.49
Smik_16.3603.443ON249029630.53
YPR117W3.443ON248929611.0
Kpol_1010.71singletonON41128582.2
KLLA0E13135g5.691ON62560582.6
SAKL0E04972g2.390ON61134564.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0C01840
         (58 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   120   1e-37
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   111   3e-34
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   110   6e-34
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   110   7e-34
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   110   9e-34
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   110   1e-33
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   109   2e-33
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   108   7e-33
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   108   8e-33
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   108   8e-33
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   108   8e-33
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   108   9e-33
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   107   1e-32
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   107   2e-32
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   105   5e-32
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   105   7e-32
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   105   1e-31
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   102   1e-30
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...   100   2e-29
Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR11...    29   0.49 
Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR11...    29   0.53 
YPR117W Chr16 (760025..767494) [7470 bp, 2489 aa] {ON} Putative ...    28   1.0  
Kpol_1010.71 s1010 complement(176578..177813) [1236 bp, 411 aa] ...    27   2.2  
KLLA0E13135g Chr5 complement(1162722..1164599) [1878 bp, 625 aa]...    27   2.6  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...    26   4.7  

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  120 bits (300), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  111 bits (278), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (96%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL +DGKR+YTLKKVTE+GEITKSAHPARFSPDDKYSRQRVTLKKRYGLLP Q
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPTQ 58

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  110 bits (276), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTLKKVTE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 54/58 (93%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL +DGKRVYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRY LLPGQ
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPGQ 58

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  110 bits (275), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTLKKVTE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  110 bits (274), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 54/56 (96%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLP 56
          MHLMYTLD +GKRVYTLKK+TEEGEITKSAHPARFSPDDKYSRQRVTLKKRY LLP
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  109 bits (273), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (94%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPG 57
          MHLMYTL  DGKR YTL+KVTEEGEITKSAHPARFSPDDKYSRQRVTLK+RYGLLPG
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLPG 57

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  108 bits (269), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTL KVTE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKRVYTLKK TEEGEITKSAHPARFSPDDK+SRQRVTLKKR+GLLP Q
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPTQ 58

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRY ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  108 bits (269), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKRY ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  107 bits (267), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 53/58 (91%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKRVYTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKRY LLP +
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  107 bits (266), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLMYTL  DGKR+YTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKR+ +LPG+
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLPGK 58

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  105 bits (263), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 52/57 (91%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPG 57
          MHLMYTLD  GKR+YTLKK+TE+ EITKSAHPARFSPDDKYSRQRVTLKKRY LLP 
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  105 bits (263), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLP 56
          MHLMYTLD +GKR+YTLKK T +GEITKSAHPARFSPDDKYSRQRVTLKKR+G+LP
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  105 bits (262), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLM+TL  DGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR+ LLP Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPNQ 58

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  102 bits (254), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (89%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58
          MHLM+TL  DGKR+YTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKR+ +LP Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score = 99.8 bits (247), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 51/56 (91%)

Query: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLP 56
          MHLMYTL  DGKRVYTL+KVT  GEITKSAHPARFSPDDKYSRQRVTLK+R+ +LP
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR117W
            (REAL)
          Length = 2496

 Score = 28.9 bits (63), Expect = 0.49,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 10   DGKRVYTLKKVTEEGEITKSAHPARFSPD 38
            DG  ++TL  + E+G+I+K+    RF PD
Sbjct: 1291 DGNVIWTLGLLFEQGDISKAGDEERFLPD 1319

>Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR117W
            (REAL)
          Length = 2490

 Score = 28.9 bits (63), Expect = 0.53,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 10   DGKRVYTLKKVTEEGEITKSAHPARFSPD 38
            DGK ++TL  + E+G+I K+    RF P+
Sbjct: 1291 DGKVIWTLGLIFEQGDICKAGDEERFLPN 1319

>YPR117W Chr16 (760025..767494) [7470 bp, 2489 aa] {ON} Putative
            protein of unknown function
          Length = 2489

 Score = 28.1 bits (61), Expect = 1.0,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 10   DGKRVYTLKKVTEEGEITKSAHPARFSPD 38
            DG+ ++TL  + E+G+I+K+    RF P+
Sbjct: 1291 DGRVIWTLGLLFEQGDISKAGDEERFLPN 1319

>Kpol_1010.71 s1010 complement(176578..177813) [1236 bp, 411 aa]
           {ON} complement(176578..177813) [1236 nt, 412 aa]
          Length = 411

 Score = 26.9 bits (58), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 2   HLMYTLDKDGKRVYTLKKVTEEGEITKS 29
            ++ T DKDG+   T+KK+TEE  + +S
Sbjct: 285 QMIATYDKDGRMSITMKKLTEEELMDRS 312

>KLLA0E13135g Chr5 complement(1162722..1164599) [1878 bp, 625 aa]
           {ON} weakly similar to uniprot|P36166 Saccharomyces
           cerevisiae YKR090W PXL1 LIM domain-containing protein
           that localizes to sites of polarized growth
          Length = 625

 Score = 26.9 bits (58), Expect = 2.6,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 8   DKDGKRVYTLKKVTEEGEI-TKSAHPARFSPDDKYSRQR--------VTLKKRYGLLPGQ 58
           + D K++  +  V  E EI +KSA P   SPD K +           VTL +  GL P Q
Sbjct: 319 NNDLKQIEQIPSVVVEPEIVSKSAEPELNSPDGKLTAMEKLIAELDTVTLTRNKGLTPDQ 378

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score = 26.2 bits (56), Expect = 4.7,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 15  YTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTL 48
           Y  +KVT  G+  K  H  +F+ DDK     V L
Sbjct: 518 YDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVL 551

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,281,948
Number of extensions: 188389
Number of successful extensions: 533
Number of sequences better than 10.0: 27
Number of HSP's gapped: 533
Number of HSP's successfully gapped: 27
Length of query: 58
Length of database: 53,481,399
Length adjustment: 31
Effective length of query: 27
Effective length of database: 49,926,753
Effective search space: 1348022331
Effective search space used: 1348022331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)