Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B065506.14ON45645623850.0
SAKL0E01012g6.14ON54442510561e-139
NCAS0D026306.14ON45146310261e-136
Kwal_56.223876.14ON54341910341e-136
KAFR0L003606.14ON50242110291e-135
NCAS0F002206.14ON69541410421e-135
YEL060C (PRB1)6.14ON63541810321e-134
Smik_5.276.14ON60841810281e-134
TBLA0A073006.14ON57341310211e-133
TDEL0G045506.14ON56440710191e-133
KLTH0C11396g6.14ON55042710161e-133
KNAG0E009206.14ON53139910141e-133
Skud_5.296.14ON60841810191e-132
Kpol_1032.56.14ON68041210201e-132
KLLA0D00979g6.14ON56142910061e-131
Kpol_1045.756.14ON4774239981e-131
Skud_15.1646.14ON4824819921e-130
Suva_5.76.14ON66441810081e-130
Ecym_30186.14ON5753519981e-130
Suva_15.1786.14ON4764089831e-129
ZYRO0C07942g6.14ON5484149831e-128
CAGL0B03619g6.14ON4683569751e-128
Smik_15.1726.14ON4783519731e-127
NDAI0K028806.14ON7044229911e-127
YOR003W (YSP3)6.14ON4784689711e-127
ACR012C6.14ON5413519601e-124
KNAG0F02970singletonON4203899431e-124
NDAI0I022806.14ON4824739351e-121
TPHA0M002306.14ON5854149351e-120
CAGL0E02651g6.14ON4854179111e-118
CAGL0L13266gsingletonON5794235983e-70
Kpol_1018.56.313ON4654184934e-56
NCAS0D043906.313ON4923844868e-55
Suva_3.846.313ON5274554826e-54
SAKL0A02002g6.313ON4793554734e-53
ZYRO0D08822g6.313ON4904264666e-52
KLTH0A06094g6.313ON4963124641e-51
TDEL0A072806.313ON4363604549e-51
KNAG0I024706.313ON4753634552e-50
Kpol_1028.616.313ON5183164537e-50
Kwal_23.61836.313ON4933984464e-49
Smik_3.1496.313ON4914354422e-48
CAGL0L10802g6.313ON5173474388e-48
YCR045C (RRT12)6.313ON4914304361e-47
Skud_3.1246.313ON5404514302e-46
TPHA0D037606.313ON6073114305e-46
TBLA0F039706.313ON7342314241e-44
AAR069W6.313ON7683184152e-43
NDAI0I005606.313ON4834374043e-43
KAFR0J024506.313ON4783494019e-43
Ecym_21056.313ON6102763911e-40
TBLA0A067006.313ON4973033684e-38
KLLA0F06028g6.313ON5083043502e-35
Kwal_33.133721.78ON3773313344e-34
KLTH0F02288g1.78ON3802563178e-32
Kpol_2000.691.78ON3863042826e-27
TDEL0C062301.78ON3642822808e-27
ZYRO0F16764g1.78ON3863362721e-25
TBLA0A054101.78ON3823372598e-24
TPHA0B045201.78ON3882662483e-22
KNAG0G027608.714ON10850682.4
NCAS0H031002.601ON101647705.8
TBLA0B075005.117ON78930697.0
TBLA0G032503.299ON858100688.7
SAKL0G06204g5.581ON21453669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06550
         (456 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   923   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   411   e-139
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     399   e-136
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   402   e-136
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   400   e-135
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   405   e-135
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   402   e-134
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   400   e-134
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   397   e-133
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   397   e-133
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   395   e-133
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   395   e-133
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   397   e-132
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   397   e-132
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   392   e-131
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   389   e-131
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   386   e-130
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   392   e-130
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   389   e-130
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   383   e-129
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   383   e-128
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   380   e-128
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   379   e-127
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   386   e-127
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   378   e-127
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   374   e-124
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              367   e-124
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   364   e-121
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   364   e-120
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   355   e-118
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   234   3e-70
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   194   4e-56
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   191   8e-55
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   190   6e-54
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   186   4e-53
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   184   6e-52
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   183   1e-51
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   179   9e-51
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   179   2e-50
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   179   7e-50
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   176   4e-49
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   174   2e-48
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   173   8e-48
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   172   1e-47
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   170   2e-46
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   170   5e-46
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   167   1e-44
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   164   2e-43
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    160   3e-43
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   159   9e-43
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   155   1e-40
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   146   4e-38
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   139   2e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   133   4e-34
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   126   8e-32
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   113   6e-27
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   112   8e-27
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   109   1e-25
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   104   8e-24
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   100   3e-22
KNAG0G02760 Chr7 (612984..613310) [327 bp, 108 aa] {ON} Anc_8.71...    31   2.4  
NCAS0H03100 Chr8 complement(596551..599601) [3051 bp, 1016 aa] {...    32   5.8  
TBLA0B07500 Chr2 (1784284..1786653) [2370 bp, 789 aa] {ON} Anc_5...    31   7.0  
TBLA0G03250 Chr7 complement(861791..864367) [2577 bp, 858 aa] {O...    31   8.7  
SAKL0G06204g Chr7 complement(517155..517541,517609..517866) [645...    30   9.1  

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/456 (97%), Positives = 444/456 (97%)

Query: 1   MNPLLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQKDRDSTFSRTEVLEHLSAKQNDII 60
           MNPLLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQKDRDSTFSRTEVLEHLSAKQNDII
Sbjct: 1   MNPLLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQKDRDSTFSRTEVLEHLSAKQNDII 60

Query: 61  KDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILR 120
           KDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILR
Sbjct: 61  KDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILR 120

Query: 121 GPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDD 180
           GPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDD
Sbjct: 121 GPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDD 180

Query: 181 ATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVA 240
           ATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVA
Sbjct: 181 ATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVA 240

Query: 241 KTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLA 300
           KTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLA
Sbjct: 241 KTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLA 300

Query: 301 IDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDVFAP 360
           IDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDVFAP
Sbjct: 301 IDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDVFAP 360

Query: 361 GMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKI 420
           GMNVMSTYIGSDN            PYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKI
Sbjct: 361 GMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKI 420

Query: 421 VAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKDY 456
           VAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKDY
Sbjct: 421 VAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKDY 456

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  411 bits (1056), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 269/425 (63%), Gaps = 24/425 (5%)

Query: 53  SAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDH----------- 101
           S +  +II  +YI++FK  A   E   H + +         + D KD             
Sbjct: 71  SPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEY 130

Query: 102 ----KSN----LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQE 153
               KS+       F I   L+GYI     E +  +R +  V+ IE DS V A +   Q 
Sbjct: 131 GIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQN 190

Query: 154 DTPWGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIV 213
             PWGLSRIS R R+ +G    Y YDD     VT+YV+DTGI ++H+ FNGRA WGKT+ 
Sbjct: 191 GAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVP 250

Query: 214 PNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH 273
            ND D D +GHGTH AG IAS+ +GVAK  EVVA+KVLRSNG G MSDV+KG+EF    H
Sbjct: 251 QNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSH 310

Query: 274 S----KNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPAD 329
                KNK   KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA 
Sbjct: 311 QEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAA 370

Query: 330 ARRAITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTA 389
           A  AITVGAS  SD+RA+FSNWG+CVD+FAPG+NV+STYIGS+             P+ A
Sbjct: 371 AENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVA 430

Query: 390 GLIAYYLSLQPDKDSGYFTGE-MTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRN 448
           GL+ Y+LSLQPD DS +F    +TP++LK+K++A+ +KDVLYELPE+TPN +IYNG G++
Sbjct: 431 GLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQD 490

Query: 449 LSHFW 453
           LS FW
Sbjct: 491 LSDFW 495

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  399 bits (1026), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 213/463 (46%), Positives = 295/463 (63%), Gaps = 25/463 (5%)

Query: 4   LLFWYTSFVLTGGCLSLLLPEIFQCRGIET-ISQKDRDSTFSRTEVLEHLSAKQNDIIKD 62
           LL   +  +LT    SL++P I+   G    +   D DS    + ++ H ++     I +
Sbjct: 3   LLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFNIDSDSP---SNIIHHAASP----IPN 55

Query: 63  QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILRGP 122
           QYIV+FK+     ++E H   L +++          D   + L+ F++   L GY  R P
Sbjct: 56  QYIVLFKSDTTDIQRETHLATLNSWLL-------NTDPQYTILHSFQLAHDLQGYTSRLP 108

Query: 123 IETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDDA- 181
            + ++ L  DPI+Q IE DS VHAL  + Q D+PWGL+RISQR R+++ QDQ Y+YDD+ 
Sbjct: 109 EQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSG 168

Query: 182 TSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVD-EDNSGHGTHVAGIIASDKFGVA 240
            S N   Y+LDTGI  +H +F GRA+WG    P + + ED +GHGTH AG+I S ++GVA
Sbjct: 169 ASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVA 228

Query: 241 KTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS-----KGSVVNLSLGASKSP 295
           K   ++AVKVL + G+G+MS V++GIE+V   H ++         KGSV+NLSLGA KSP
Sbjct: 229 KNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSP 288

Query: 296 ALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECV 355
           AL+  I+AA+   +HFAVAAGNE+ DAC TSPAD+  A+TVGAS FSD+R FFSNWG CV
Sbjct: 289 ALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCV 348

Query: 356 DVFAPGMNVMSTYIGS-DNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTG--EMT 412
           DVFAPG+N+MSTYIG  +N            P+  GLIAY+LSLQPD  S ++TG    T
Sbjct: 349 DVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPT 408

Query: 413 PSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455
           P +LK KI++F ++ VL+E+PE TPN ++YNG G +L  FW +
Sbjct: 409 PYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN 451

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  402 bits (1034), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/419 (48%), Positives = 265/419 (63%), Gaps = 23/419 (5%)

Query: 58  DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKD-------DHKSN------ 104
           D I  +YIV+FK+  +  E + H + +         + D  D       D +        
Sbjct: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137

Query: 105 ----LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLS 160
               L+ F +   L GYI     E +  +R +P+V  +E DS V+A +   Q   PWGLS
Sbjct: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197

Query: 161 RISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDED 220
           RIS R ++ +G    Y YDDA    VT+YV+DTGI I H+ F GRA WGKT+  ND+D+D
Sbjct: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257

Query: 221 NSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS----KN 276
            +GHGTH AG IAS  +GVAK   VVAVKVLRSNG G MSDV+KG+EF    H     KN
Sbjct: 258 GNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317

Query: 277 KNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITV 336
           K   KGS  N+SLG  KSPAL +A++AA+   IHFAVAAGNEN DAC +SPA A  AITV
Sbjct: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377

Query: 337 GASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYL 396
           GAS  +D+RA+FSNWG+CVD+FAPG+NV+STYIGS+             P+ AGL+ Y+L
Sbjct: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437

Query: 397 SLQPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           SLQPD DS YF   G +TPS+LK+K++A+ +K+ L +LPE+T N +IYNG G++L  FW
Sbjct: 438 SLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  400 bits (1029), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 276/421 (65%), Gaps = 20/421 (4%)

Query: 53  SAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLK--NFIKTYSYEWDEKDDHKSNLNI--- 107
           +A   +II  +YI++FK+     + + H + +   +  ++ ++  D  +  ++++N+   
Sbjct: 51  NADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPES 110

Query: 108 -----------FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTP 156
                      F I + LSGYI     E L  +R +P++  IE D+ VH      Q + P
Sbjct: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170

Query: 157 WGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPND 216
           WGL+RIS R  + +     Y YDD    NV AYV+DTG+ ++H +F+ RA WGKTI  ND
Sbjct: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230

Query: 217 VDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH--- 273
            D D +GHGTHVAG I S  +GVAK+  ++AVKVLRSNG G MSDV+KG+EF V  H   
Sbjct: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290

Query: 274 SKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA 333
            KN+   KGSV N+SLG  KSPAL LA++AA+   IHFAVAAGNEN +AC +SPA A +A
Sbjct: 291 MKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQA 350

Query: 334 ITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGS-DNXXXXXXXXXXXXPYTAGLI 392
           +TVGAS  SDERA+FSNWGECVD+FAPG+N++STYIG+ D+            P+ AGL+
Sbjct: 351 VTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLL 410

Query: 393 AYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHF 452
           AYYLSLQP+K S + T  ++ S+LK+K++ + +KDVL +LPE TPN++IYNG G++LS F
Sbjct: 411 AYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDF 470

Query: 453 W 453
           W
Sbjct: 471 W 471

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  405 bits (1042), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 212/414 (51%), Positives = 266/414 (64%), Gaps = 20/414 (4%)

Query: 59  IIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDD--------------HKSN 104
           II ++YIV+FK S +  E + H K+L N I+  S     KDD                  
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFH-KELINQIQLESAAKLPKDDKFFSASAIEDESINQGGI 156

Query: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164
           L  F I   L+GY+     E L+L+R +P+V+ +E DS V A +   Q + PWGL+RIS 
Sbjct: 157 LTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH 216

Query: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224
           R R+ +G    Y YDD     VT YV+DTGI   H  FN RA WGKTI  ND D D +GH
Sbjct: 217 RERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGH 276

Query: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK----NKNYS 280
           GTH AG IAS  +GVAK  EVVAVKVLRSNG G MSDV+KG+EF  + H K     K   
Sbjct: 277 GTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGF 336

Query: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340
           KGS  N+SLG  KSP L LA++AA+   IHFAVAAGNEN DAC TSPA A RAITVGAS 
Sbjct: 337 KGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAST 396

Query: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
            SD+RA+FSNWG+CVD+FAPG+N++STYIG D+            P+ AGL+ Y+LSLQP
Sbjct: 397 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQP 456

Query: 401 DKDSGYF-TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
             DS +F   E+TP+++K+K++ + SKDVL++LPE TPN +I+NGAG NL   W
Sbjct: 457 GSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  402 bits (1032), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 267/418 (63%), Gaps = 21/418 (5%)

Query: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104
           II ++YI++FK  A   E + H         + ++N     ++    KD   S       
Sbjct: 178 IIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGI 237

Query: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164
            + F I    SGYI     E + L+RQ+P+V  +E DS V A +   Q   PWGL+RIS 
Sbjct: 238 QDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297

Query: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224
           R R+ +G    Y YDD     VT+YV+DTG+ I+H+ F  RA WGKTI  ND D D +GH
Sbjct: 298 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357

Query: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK----NKNYS 280
           GTH AG IAS  +GVAK   VVAVKVLRSNG G MSDV+KG+E+    H K     K   
Sbjct: 358 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGF 417

Query: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477

Query: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
            SD+RA+FSNWG+CVDVFAPG+N++STYIGSD+            P+ AGL+ Y+LSLQP
Sbjct: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 537

Query: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455
             DS +F      +TP +LK+K++ + +KD+L+++PE+TPN++IYNG G++LS FW D
Sbjct: 538 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWND 595

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  400 bits (1028), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 204/418 (48%), Positives = 264/418 (63%), Gaps = 21/418 (5%)

Query: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104
           II ++YIV+FK      E   H         + ++N     ++    +D + S       
Sbjct: 151 IIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGI 210

Query: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164
            + F I    SGYI     E + L+RQ+P+V  +E DS V A +   Q   PWGL+RIS 
Sbjct: 211 QDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270

Query: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224
           R R+ +G    Y YDD     VT+YV+DTG+ I+H+ F  RA WGKTI  ND D D +GH
Sbjct: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330

Query: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN----KNYS 280
           GTH AG IAS  +GVAK   VVAVKVLRSNG G MSDV+KG+E+    H K     K   
Sbjct: 331 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGF 390

Query: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450

Query: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
            SD+RA+FSNWG+CVDVFAPG+N++STYIGSD             P+ AGL+ Y+LSLQP
Sbjct: 451 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 510

Query: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455
             DS +F      +TP +LK+K++ + +KD+L+++PE+TPN +IYNG G++LS FW D
Sbjct: 511 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWND 568

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  397 bits (1021), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 269/413 (65%), Gaps = 17/413 (4%)

Query: 58  DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKT----------YSYEWDEKDDHKSNLNI 107
           +II  +YI+ FK      E + H + +    +           Y    +  D  +  ++ 
Sbjct: 123 NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPIIDS 182

Query: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPR 167
           F I + L GYI     + +  +R +P+VQ +E DS V+  +   Q   PWGL+RIS R R
Sbjct: 183 FNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRER 242

Query: 168 VRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTH 227
           + +G    Y +DD     VTAYV+DTG+ + H  F GRA WGKTI  ND D D +GHGTH
Sbjct: 243 LNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTH 302

Query: 228 VAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYS-KGS 283
            AG IAS  +GVAK   VVAVKVLRSNG G MSDVLKG+E+    H    KNK    KGS
Sbjct: 303 CAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGS 362

Query: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343
             N+SLG  KSP+L LA++AA+   IHFAVAAGNEN DAC TSPA A+ AITVGAS  SD
Sbjct: 363 TANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSD 422

Query: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKD 403
           +RA+FSNWG+CVDVFAPG+N++STYIGSD+            P+ AGL++Y+LSLQP++D
Sbjct: 423 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQD 482

Query: 404 SGYFT---GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           S + T   G +TP++LK++++++G+KD+L ++PE TPN++++NGAG++LS FW
Sbjct: 483 SEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  397 bits (1019), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 262/407 (64%), Gaps = 17/407 (4%)

Query: 63  QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNI---------FKIGTT 113
           +YIV+ K+S+   E  LH + +         E  + D   S   +         F +   
Sbjct: 114 RYIVVLKHSSP-EEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGL 172

Query: 114 LSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQD 173
           L+GY+       ++L+R+ P+V  +E DS VHA +   Q   PWGLSRIS R R+ +G  
Sbjct: 173 LNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSF 232

Query: 174 QLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIA 233
             Y +DD     VT+YV+DTGI + H+ F GRA WGKTI  ND D D +GHGTH AG IA
Sbjct: 233 NKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIA 292

Query: 234 SDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK----NKNYSKGSVVNLSL 289
           S  +GVAK  +VVAVKVLRSNG G MSDV+KG+EF    H K     K   KGS  N+SL
Sbjct: 293 SKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGSTANMSL 352

Query: 290 GASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFS 349
           G  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +A+TVGAS  SD+RA+FS
Sbjct: 353 GGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFS 412

Query: 350 NWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYF-- 407
           N+G+CVD+FAPG+N++STYIGSD+            P+ AGL+ Y+LSLQPD DS +F  
Sbjct: 413 NYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDA 472

Query: 408 -TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
            +  +TP +LK+K++A+ +KD+LY+LPE+TPN +IYNG G  L  FW
Sbjct: 473 GSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  395 bits (1016), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/427 (46%), Positives = 264/427 (61%), Gaps = 33/427 (7%)

Query: 60  IKDQYIVIFKNSAMMAEKELH---------------------FKQLKNFIKTYSYEWDEK 98
           I  +YIV+FK +    E + H                     F   +NF++   +E D +
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138

Query: 99  DDHKSNL------NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQ 152
               +        + F +   L+GYI     E +  +R +P+V  +E DS V A +   Q
Sbjct: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198

Query: 153 EDTPWGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTI 212
              PWGLSRIS R ++ +G    Y YDD     VT+YV+DTG+ + H+ F GRA WGKTI
Sbjct: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258

Query: 213 VPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDD 272
             ND+D+D +GHGTH AG IAS  +GVAK   VVAVKVLRSNG G MSDV+KG+EF    
Sbjct: 259 PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKS 318

Query: 273 HS----KNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPA 328
           H     +NK   KGS  N+SLG  KSPAL +A++AA+   IHFAVAAGNEN DAC +SPA
Sbjct: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378

Query: 329 DARRAITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYT 388
            A  A+TVGAS  +D+RA+FSNWG+CVD+FAPG+NV+STYIGSD             P+ 
Sbjct: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438

Query: 389 AGLIAYYLSLQPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAG 446
           AGL+ Y+LSLQPD DS YF   G +TPS+LK+K++A+ +K+VL ++P++T N +I+NG G
Sbjct: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498

Query: 447 RNLSHFW 453
             L  FW
Sbjct: 499 EGLDDFW 505

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  395 bits (1014), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 195/399 (48%), Positives = 263/399 (65%), Gaps = 6/399 (1%)

Query: 62  DQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILRG 121
           ++YI++FK   + AE+    KQL   +   + +   +      L+ F +   LSGY+   
Sbjct: 96  NKYIILFKE-GVTAEQISAHKQLLQQVLLETSDVSAQGIVADVLDSFDLEGVLSGYVAEL 154

Query: 122 PIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDDA 181
               L+L+R+ P VQL+E DS+VH  +   Q + PWGL+RIS R  + +G    Y YDDA
Sbjct: 155 SPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDA 214

Query: 182 TSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAK 241
               V +Y++DTGI + H++F GRA+WGKTI  ND DED +GHGTH AG IAS  +GVAK
Sbjct: 215 AGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAK 274

Query: 242 TCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS----KNKNYSKGSVVNLSLGASKSPAL 297
              V+AVKVLRSNG G MSDV+ G+EF    H+     N    KGS  N+SLG  KSP+L
Sbjct: 275 RANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSL 334

Query: 298 VLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDV 357
              +DAA+   +HF+VAAGNEN DAC TSPA + RAITVGAS  SD+RA+FSNWG CVD+
Sbjct: 335 DRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDI 394

Query: 358 FAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFT-GEMTPSKL 416
           FAPG+N++STY GSD+            P+ AGL+ Y+LSLQP+K S + T  ++TP +L
Sbjct: 395 FAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQL 454

Query: 417 KEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455
           K+K++ + +K VL++LPE+TPN +IYNG G +LS FW D
Sbjct: 455 KKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD 493

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  397 bits (1019), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/418 (47%), Positives = 262/418 (62%), Gaps = 21/418 (5%)

Query: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104
           II ++YI++FK        + H         + ++N     ++    +D   S       
Sbjct: 151 IIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGI 210

Query: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164
            + F I    SGYI     E + L+RQ+P+V  +E DS V A     Q   PWGL+RIS 
Sbjct: 211 QDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISH 270

Query: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224
           R R+ +G    Y YDD     VT+YV+DTG+ ++H+ F  RA WGKTI  ND D D +GH
Sbjct: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 330

Query: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN----KNYS 280
           GTH AG IAS  +GVAK   VVAVKVLRSNG G MSDV+KG+E+    H K     K   
Sbjct: 331 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGF 390

Query: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450

Query: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
            SD+RA+FSNWG+CVD+FAPG+N++STYIGSD+            P+ AGL+ Y+LSLQP
Sbjct: 451 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 510

Query: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455
             DS +F      +TP +LK K++ + +KD+L+++PE+TPN +IYNG G++LS FW D
Sbjct: 511 GSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWND 568

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  397 bits (1020), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 199/412 (48%), Positives = 268/412 (65%), Gaps = 18/412 (4%)

Query: 56  QNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNL------NIFK 109
           +N +I ++YI++FK    + + ++H    K+ I    +++    D  S+         F 
Sbjct: 228 ENLVIPNKYIIVFKKDVSVKDMQIH----KDLIARAQFQYASVSDETSSSILGGIEEAFN 283

Query: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVR 169
           +     GYI     + +Q +R  PIV  +E DS VHA ++  Q + PWGL+RIS R  + 
Sbjct: 284 VANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLN 343

Query: 170 IGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVA 229
           +G    Y YDD     VTAYV+DTGI I H++F GRA WGKTI  ND D D +GHGTH A
Sbjct: 344 LGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCA 403

Query: 230 GIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK----NKNYSKGSVV 285
           G IAS  +GVAK  EVVAVKVLRS+G G MSDVLKG+E+    H K     K   KGS  
Sbjct: 404 GTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTA 463

Query: 286 NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER 345
           N+SLG  KS +L LA+DAA+   IHFAVAAGNEN DAC +SPA +  AITVGAS  SD+R
Sbjct: 464 NMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDR 523

Query: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSG 405
           A+FSNWG+CVDVFAPG+N++STYIGSD             P+ AGL++Y+LS+QPD DS 
Sbjct: 524 AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADSE 583

Query: 406 YFTG---EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWK 454
           +F+     ++P++LK+K++A+ +K++  +LPE TPN+++YN AG N+S FWK
Sbjct: 584 FFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 209/429 (48%), Positives = 271/429 (63%), Gaps = 29/429 (6%)

Query: 57  NDI---IKDQYIVIFKNSAMMAE----KEL----HFKQLKN------FIKTYSYEWDEKD 99
           NDI   I ++YI++FK  A   E    +EL    H K L +      F    S E  E  
Sbjct: 91  NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFG 150

Query: 100 DHKSNL-----NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQED 154
               +L     + F I  +LSGY+     E +  +R+ P+V+ +E DS V +     Q  
Sbjct: 151 VKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNS 210

Query: 155 TPWGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVP 214
            PWGL+RIS R ++ +G    Y YDD     VTAYV+DTG+ ++H+ F+GRA WGKTI  
Sbjct: 211 APWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPK 270

Query: 215 NDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS 274
           +D D D +GHGTH AG I S  +GVAK  ++VAVKVLRSNG G MSDV+KG+E+V + H 
Sbjct: 271 DDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHK 330

Query: 275 K----NKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADA 330
           K     K   KGS  N+SLG  KSPAL LA++AA+   +HFAVAAGNEN DAC TSPA A
Sbjct: 331 KAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAA 390

Query: 331 RRAITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAG 390
             AITVGAS  SDERA+FSNWG+CVD+F PG+N++STYIGSD             P+  G
Sbjct: 391 ENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVG 450

Query: 391 LIAYYLSLQPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRN 448
           L+ Y+LSLQPD DS YF   G +TPS+LK+K++ F +K+VL +LPE+T N +IYNG G++
Sbjct: 451 LLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQD 510

Query: 449 LSHFW-KDY 456
           L   W KDY
Sbjct: 511 LDDLWGKDY 519

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  389 bits (998), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 267/423 (63%), Gaps = 21/423 (4%)

Query: 52  LSAKQNDIIKDQYIVIFKNSAMMAEKELHFK-----QLKNFIKT-YSYEW---DEKDDHK 102
           L    +++I   YIV+F       E  LH +     QL++     Y +E+       D  
Sbjct: 27  LITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVN 86

Query: 103 SN------LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTP 156
           SN       ++FKIG  L GY      E ++ LR  P+V+ IE DS VH  +   Q + P
Sbjct: 87  SNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAP 146

Query: 157 WGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPND 216
           WGL+RIS R R+ +     Y YDD     V AYV+DTGI I++  F GRA WGKTI   +
Sbjct: 147 WGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGE 206

Query: 217 VDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN 276
            + D +GHGTHVAG IAS  +GVAK  +V AVKVLRSNG G MSDVLKG+E+VV  H ++
Sbjct: 207 ANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRD 266

Query: 277 KNYS--KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAI 334
              +  KGSV N+SLG  KS +L LA++AA+   +HFAVAAGNEN DAC TSPA A RAI
Sbjct: 267 VGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAI 326

Query: 335 TVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAY 394
           TVGAS  SD RA+FSNWG+CV +FAPG+N++STYIGS +            P+ AGL+AY
Sbjct: 327 TVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAY 386

Query: 395 YLSLQPDKDSGYFT----GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLS 450
           +LSLQP   S +++      +TP +LK+KIVAFG+K+ L +LP NTPN++ YNGAG++L 
Sbjct: 387 FLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLE 446

Query: 451 HFW 453
            FW
Sbjct: 447 DFW 449

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  386 bits (992), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/481 (42%), Positives = 283/481 (58%), Gaps = 27/481 (5%)

Query: 1   MNPLLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQKDRDSTFSR---TEVLEHLSAKQN 57
           MN  LF     +  GG L +++PE+ +        +  R++        + +E+L   + 
Sbjct: 1   MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 60

Query: 58  DIIKD------QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNI---- 107
            +++       +YI++F         E H + ++   K    +  E D     ++     
Sbjct: 61  KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 120

Query: 108 ----------FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPW 157
                     F I     GY      E ++++ QDP+V+ IE +S V       QED PW
Sbjct: 121 NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 180

Query: 158 GLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDV 217
           GL RIS R R + GQD  Y Y+DA    VT+YVLDTGI   HE F GRA+WG  I  ND 
Sbjct: 181 GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 240

Query: 218 DEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---- 273
             D +GHGTH AGII S  FGVAK   ++AVKVLRSNGEG +SDV+KGIE+V  +H    
Sbjct: 241 ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASS 300

Query: 274 SKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA 333
            K  +  KGS  NLSLG+SKSPA+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++
Sbjct: 301 KKRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 360

Query: 334 ITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIA 393
           ITVGAS FSD+RAFFSNWG CVDVFAPG+N+MSTYIGS N            P+ AG+++
Sbjct: 361 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 420

Query: 394 YYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           Y LSLQP +DS +F   ++P +LKEKI+ F ++ VL ++ E TPN ++YNG G+ L  FW
Sbjct: 421 YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

Query: 454 K 454
           +
Sbjct: 481 R 481

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  392 bits (1008), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 200/418 (47%), Positives = 264/418 (63%), Gaps = 21/418 (5%)

Query: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104
           II ++YI++FK      E   H         + ++N     ++    +D   S+      
Sbjct: 206 IIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGI 265

Query: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164
            + F I +  SGYI     E + L+RQ+P+V  +E DS V A     Q   PWGL+R+S 
Sbjct: 266 QDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325

Query: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224
           R R+ +G    Y YDD     VT+YV+DTG+ ++H+ F  RA WGKTI  ND D D +GH
Sbjct: 326 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 385

Query: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN----KNYS 280
           GTH AG IAS  +GVAK   VVAVKVLRSNG G MSDVLKG+E+    H K     K   
Sbjct: 386 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGF 445

Query: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 446 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 505

Query: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
            SD+RA+FSN+G+CVDVFAPG+N++STYIGSD             P+ AGL+ Y+LSLQP
Sbjct: 506 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 565

Query: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455
             DS +F      +TP +LK+K++ + +KD+L+++P++TPN +IYNG G++LS FW D
Sbjct: 566 GSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWND 623

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  389 bits (998), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/351 (54%), Positives = 244/351 (69%), Gaps = 5/351 (1%)

Query: 107 IFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRP 166
           +F+I  +L GY        L L+R+  +V+LIE DS VHA   + Q   PWGL+R+S R 
Sbjct: 174 MFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRE 233

Query: 167 RVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGT 226
           R+ +G    Y YDD     VTAYV+DTGI I H +F GRA+WGKTI  ND D D +GHGT
Sbjct: 234 RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGT 293

Query: 227 HVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK---NKNYSKGS 283
           H AG IAS  +GVAK  +VVAVKVLR+NG G MSDVL+G+E+VV +H K   + N+ KGS
Sbjct: 294 HCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNF-KGS 352

Query: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343
             N+SLG  KS AL LA+DAA++  IHFAVAAGNEN DAC TSPA +++ ITV AS  SD
Sbjct: 353 TANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSD 412

Query: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKD 403
           +RA+FSNWG CVD+FAPG+N++STYIGSD             P+ AGL+AY+LSLQPD  
Sbjct: 413 DRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSG 472

Query: 404 SGYFTG-EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           S Y+TG  ++P  LK+KIVA+GSK++L  +P  T N +I+NG G +L  FW
Sbjct: 473 SEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  383 bits (983), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/408 (48%), Positives = 260/408 (63%), Gaps = 18/408 (4%)

Query: 63  QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDH-------KSNL------NIFK 109
           +YI+ F   + +   E H K++   ++  S     KDD         S+L      + F 
Sbjct: 70  RYIIAFHEDSSVRSIESH-KRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSFFD 128

Query: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVR 169
           I     GY      E ++ + QDPI++ IE +S V       QE+ PWGL RIS R + +
Sbjct: 129 INGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREKAK 188

Query: 170 IGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVA 229
            GQD  Y Y+DA    VT+YVLDTGI I+HE F GRA WG  I  ND   D +GHGTH A
Sbjct: 189 YGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTHCA 248

Query: 230 GIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH----SKNKNYSKGSVV 285
           GII S  FGV K   +VAVKVLRSNGEG +SDV+KGIE+VV DH     K     KGS  
Sbjct: 249 GIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFKGSTA 308

Query: 286 NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER 345
           NLSLG+SKSPA+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++ITVGAS FSD+R
Sbjct: 309 NLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR 368

Query: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSG 405
           AFFS+WG CVDVFAPG+N++STYIGS N            P+ AG+++Y+LSLQP  DS 
Sbjct: 369 AFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSE 428

Query: 406 YFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           +F   ++P +LKEKI+ F ++ VL ++ E+TPN +IYNG GR L +FW
Sbjct: 429 FFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  383 bits (983), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/414 (46%), Positives = 270/414 (65%), Gaps = 19/414 (4%)

Query: 59  IIKDQYIVIFKNSAMMAE--------KELHFKQLKNFIKTYSYEWDEKDD--HKSNL--- 105
           +++++YI++FK      E        +++H +++    + +S+    + D  + S L   
Sbjct: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGI 147

Query: 106 -NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164
            + F I   L GY    P + L ++R  P+++++E DS V+  K   +   PWGL+RIS 
Sbjct: 148 DHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISH 207

Query: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224
           R R+ +G    Y YD+     VT+YV+DTG+ + H QF GRA+WGKTI   D+DED +GH
Sbjct: 208 RERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGH 267

Query: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS----KNKNYS 280
           GTH AG I S  +GVAK  ++VAVKVLRSNG G MSDVLKG+E+   DH     + K   
Sbjct: 268 GTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGF 327

Query: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340
           KGS  N+SLG  KSP+L  A++AA++  ++FAVAAGNE+ DAC TSPA A   ITVGAS 
Sbjct: 328 KGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGAST 387

Query: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
            SD+RA+FSN+G+CVDVFAPG+N++STYIGSD+            P+ AGL+AY+LSLQP
Sbjct: 388 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQP 447

Query: 401 DKDSGYFTG-EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
             DS +  G  ++P +LK+K++AF +KDVL ++P  TPN++IYNG G +LS FW
Sbjct: 448 GSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFW 501

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  380 bits (975), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 187/356 (52%), Positives = 247/356 (69%), Gaps = 8/356 (2%)

Query: 106 NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQR 165
           ++F I     G I   P   ++LL +  IV+ +E DS VHA     Q + PWGL+RIS R
Sbjct: 59  DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118

Query: 166 PRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHG 225
            R+ +G    Y YD+A    VTAYV+DTGI + H +F+GRA+WGKTI  ND+D D +GHG
Sbjct: 119 DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHG 178

Query: 226 THVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYSKG 282
           TH AG IAS  +G+AK   VVAVKVL+S+G G MSDV+KG+E+    H   SKN    KG
Sbjct: 179 THCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKG 238

Query: 283 SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFS 342
           S  N+SLG  KSPAL +A++AA+S  IHFAVAAGNEN DAC TSPA A +AITVGAS  S
Sbjct: 239 STANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLS 298

Query: 343 DERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXX-XXXXXXXPYTAGLIAYYLSLQPD 401
           D+RA+FSNWG+CVD+FAPG+N++STYIG  N             P+ AGL+ Y+LSLQPD
Sbjct: 299 DDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPD 358

Query: 402 KDSGYFTGE---MTPSKLKEKIVAFGSKDVLYELPE-NTPNIVIYNGAGRNLSHFW 453
            DS ++      +TP++LK+K++A+ +K+VL +LP+ ++PN++IYNGAG +L  FW
Sbjct: 359 SDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  379 bits (973), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/351 (53%), Positives = 238/351 (67%), Gaps = 6/351 (1%)

Query: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPR 167
           F I     GY      E L L+ QDP+++ IE +S V      +Q+D PWGL RIS R +
Sbjct: 129 FDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREK 188

Query: 168 VRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTH 227
            + GQD  Y Y+DA    VT+YVLDTGI   HE F GRA WG  I  ND   D +GHGTH
Sbjct: 189 AKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTH 248

Query: 228 VAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH-----SKNKNYSKG 282
            AGII S  +GVAK  ++VAVKVLRSNGEG +SDV+KGIE+V  +H      K+K + KG
Sbjct: 249 CAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF-KG 307

Query: 283 SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFS 342
           S  NLSLG+SKS A+ +A+DAA+   +HFA+AAGNEN DAC +SPA A+++ITVGAS FS
Sbjct: 308 STANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFS 367

Query: 343 DERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDK 402
           D+RAFFSNWG CVDVFAPG+N+MSTYIGS N            P+ AG+++Y+LSLQP  
Sbjct: 368 DDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAP 427

Query: 403 DSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           DS YF   ++P +LKEK++ F +  VL ++ +NTPN +IYNG G+ L   W
Sbjct: 428 DSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  386 bits (991), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 203/422 (48%), Positives = 265/422 (62%), Gaps = 24/422 (5%)

Query: 55  KQNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSN---------- 104
           K   I+ ++YI++FK+S  + E   H K+L + I+  S        H  +          
Sbjct: 234 KHPRILPNKYIIVFKDSINIDEISYH-KELISEIQQQSASRLPPHHHFFHSTSEEEEESF 292

Query: 105 -----LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGL 159
                ++ F I   LSGY      E + L+R +P+V+ +E DS V   +   Q + PWGL
Sbjct: 293 RNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGL 352

Query: 160 SRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDE 219
           SRIS R R+ +G    Y YDD     VT +V+DTGI ++H  F  RA WGKTI  ND D 
Sbjct: 353 SRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412

Query: 220 DNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKN 276
           D +GHGTH AG IAS  +GVAK  EVVAVKVLRSNG G MSDV+KG+EF  + H    KN
Sbjct: 413 DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472

Query: 277 KNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITV 336
           K   KGS  N+SLG  KSP L LA++AA+   IHF+VAAGNEN DAC +SPA A  AITV
Sbjct: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532

Query: 337 GASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXX-XXXXXXXPYTAGLIAYY 395
           GAS  SD+RA+FSNWG CVDVFAPG+N++STY+G  N             P+ AGL+ Y+
Sbjct: 533 GASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYF 592

Query: 396 LSLQPDKDSGYFT----GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSH 451
           LSLQPD  SG+F     G++TP +LK+K++A+ + D+LY+LP+ TPN +IYNGAG ++S 
Sbjct: 593 LSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISD 652

Query: 452 FW 453
            W
Sbjct: 653 LW 654

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  378 bits (971), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 278/468 (59%), Gaps = 35/468 (7%)

Query: 17  CLSLLLPEI-------------FQCRGIETISQKDRDSTFSRTEVLEHLSAKQNDIIKDQ 63
           CL +++P+                 R  E + Q D  +  +  + + H    + + +  +
Sbjct: 15  CLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHVAH----KTEFLPYR 70

Query: 64  YIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNL--------------NIFK 109
           Y+++F     + + + H + ++    T   +  E D     +              N F 
Sbjct: 71  YVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFGGIDNFFD 130

Query: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVR 169
           I     GY      E ++++ QDPI++ +E ++ V      +QE+ PWGL R+S R + +
Sbjct: 131 INGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRVSHREKPK 190

Query: 170 IGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVA 229
            GQD  Y Y+DA    VT+YVLDTGI   HE F GRA WG  I  ND   D +GHGTH A
Sbjct: 191 YGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGHGTHCA 250

Query: 230 GIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYS-KGSVV 285
           GII S  FGVAK  ++VAVKVLRSNGEG +SDV+KGIE+V  +H   SK KN   KGS  
Sbjct: 251 GIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTA 310

Query: 286 NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER 345
           NLSLG+SKS A+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++ITVGAS FSD+R
Sbjct: 311 NLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR 370

Query: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSG 405
           AFFSNWG CVDVFAPG+N+MSTYIGS N            P+ AG+++Y+LSLQP  DS 
Sbjct: 371 AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSE 430

Query: 406 YFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           +F    +P +LKEK++ F ++ VL ++ ++TPN +IYNG G+ L  FW
Sbjct: 431 FFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  374 bits (960), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 185/351 (52%), Positives = 231/351 (65%), Gaps = 5/351 (1%)

Query: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPR 167
           F +G  L GY+     + + LLR +P V  +E DS V A     Q   PWGL+R+S R +
Sbjct: 138 FALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREK 197

Query: 168 VRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTH 227
           +  G    Y YDD +   VT+YV+DTGI I H  F  RA WGKTI  ND D D +GHGTH
Sbjct: 198 LNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTH 257

Query: 228 VAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS----KGS 283
            AG IAS  +GVAK   VVAVKVLRSNG G MSDVL+G+E+ V  H K    +    KGS
Sbjct: 258 CAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGS 317

Query: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343
             N+SLG  +S AL LA+DAA+   IHFAVAAGNEN DAC TSPA +++AITVGAS  +D
Sbjct: 318 TANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLAD 377

Query: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKD 403
           +RA+FSNWG CVD+FAPGMN++STYIGSD             P+ AGL+ Y+LSLQPD D
Sbjct: 378 DRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGD 437

Query: 404 SGYFTGE-MTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           S +   + ++P  LK+K++ FG+KD L  LP  T N++IYNG G +LS FW
Sbjct: 438 SEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFW 488

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  367 bits (943), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 260/389 (66%), Gaps = 16/389 (4%)

Query: 60  IKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYIL 119
           I ++++V+FK      E E+    L        +E             F I   L G+ +
Sbjct: 41  ILNEFLVMFKPMVDREEVEVGLSVLAGRFPLAQFEQ------------FHIADELIGFTV 88

Query: 120 RG-PIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYY 178
           +  P   +  L Q P V+++E +SKV+AL + +QED PWGL R+SQR RVRIG +Q+Y Y
Sbjct: 89  KNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRY 148

Query: 179 DDATSG-NVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKF 237
           D   S  +V  Y+LDTGI + HE+F GRARWGKTI  ND D D++GHGTH AGI+    +
Sbjct: 149 DTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATY 208

Query: 238 GVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH-SKNKNYSKGSVVNLSLGASKSPA 296
           GVAK   ++AVKVL + G+G+MSDV++GIEF V++H ++N++  +GS++NLSLGA +SPA
Sbjct: 209 GVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDEVRGSIINLSLGAGESPA 268

Query: 297 LVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVD 356
           L   + AA+++ +HFAVAAGNE+ +ACY+SPA+    +TVG S FSD+RAFFSNWG C+D
Sbjct: 269 LQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCID 328

Query: 357 VFAPGMNVMSTYIG-SDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSK 415
           VFAPG+NV S+Y+G + N            P+ AGL+AY LSL+PD  S + T    P++
Sbjct: 329 VFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQ 388

Query: 416 LKEKIVAFGSKDVLYELPENTPNIVIYNG 444
           LK+K+V+  ++  L+E+P++T N++I+NG
Sbjct: 389 LKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/473 (43%), Positives = 283/473 (59%), Gaps = 29/473 (6%)

Query: 4   LLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQK--DRDSTFSRTEV--LEHLSAKQNDI 59
           +L W+   +      SL++PEI      +    K  +RD T  + ++  +      Q + 
Sbjct: 9   ILSWFARSIT-----SLIIPEIIHSGNNDASHAKLNERD-TLDKNQIPFIIPTHGPQKNF 62

Query: 60  IKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYIL 119
           I DQYIV+F+N     +     + L + I+  + +++  D++   L+ F+I     G I+
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMII 122

Query: 120 RGPIETL------QLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQD 173
           R PI+         +     I+++IE DS VH  K   Q D+ WGLSRISQR  +++ QD
Sbjct: 123 RAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQD 182

Query: 174 QLYYYDDATSGN-VTAYVLDTGIMISHEQFNGRARWGKTI-VPNDVDEDNSGHGTHVAGI 231
           Q Y+YDD  SG  V  Y+LDTGI  +H +F GRA WG ++ V     ED++GHGTH AGI
Sbjct: 183 QFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGI 242

Query: 232 IASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKN----------YSK 281
           I S  +GVAK   ++AVKVL   G+G MSDV+ G+EFV + H+   N            K
Sbjct: 243 IGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFK 302

Query: 282 GSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIF 341
           GSVVNLSLGA KSP+L +A+++A    IH  VAAGNE+ DAC TSPAD+   ITVGAS F
Sbjct: 303 GSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSF 362

Query: 342 SDERAFFSNWGECVDVFAPGMNVMSTYIG-SDNXXXXXXXXXXXXPYTAGLIAYYLSLQP 400
           SD+RAFFSNWG CVDVFAPG+N+ STYIG ++N            P+ +GL AYYLSLQP
Sbjct: 363 SDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQP 422

Query: 401 DKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           D  S +    MTP +LK KI+ F +  +L ELP +T N ++YNG G++LS FW
Sbjct: 423 DVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFW 475

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  364 bits (935), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 190/414 (45%), Positives = 263/414 (63%), Gaps = 25/414 (6%)

Query: 62  DQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDE---------KDDHKSNLNIFKIGT 112
           D+YI++FK      + + H K +    +  S E            +D     ++ F++  
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193

Query: 113 TLSGYILR-GPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIG 171
             SGYI      + +  +R +P+V  +E DS VH+L  + Q + PWGL+RIS R  + +G
Sbjct: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLG 252

Query: 172 QDQLYYYDDATSG-NVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAG 230
               Y Y   ++G  VTAYV+DTGI +SH +F  RA+WGKTI  ND D D +GHGTH AG
Sbjct: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAG 312

Query: 231 IIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK---------NKNYSK 281
            I S+ +GVAK   +VAVKVLRS+G G MSDVLKG+E+V  +H+K         N NY K
Sbjct: 313 TIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNY-K 371

Query: 282 GSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIF 341
           G+  N+SLG  KSPAL  A++AA+   +HFAVAAGNEN DAC +SPA A  AITVGAS  
Sbjct: 372 GATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTL 431

Query: 342 SDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPD 401
           SD+RA+FSN+G+CVD+FAPG+N++STYIG+++            P+ AGL+ Y LSLQPD
Sbjct: 432 SDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPD 491

Query: 402 KDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           K S ++    E+TP ++K+KI+ + +K+ L +LP +TPN +IYNG G N + FW
Sbjct: 492 KGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNSTDFW 544

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  355 bits (911), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 191/417 (45%), Positives = 257/417 (61%), Gaps = 16/417 (3%)

Query: 53  SAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLN------ 106
           SAK + II ++YIV+FK+     E + H   ++    +  +  D      +  N      
Sbjct: 67  SAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRG 126

Query: 107 -----IFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSR 161
                 F IG +++GYI      T + +   P+V+L+E DS V     K+QE  PWGL R
Sbjct: 127 IGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGR 186

Query: 162 ISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDN 221
           ISQR ++ I   + Y+YDD    +   +V+DTGI + HE F GRA WGKTIV ND D D 
Sbjct: 187 ISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDL 246

Query: 222 SGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVD---DHSKNKN 278
           +GHGTH AG IAS  +G+AK  EV+AVKVLRS+G G MSDV++G+E+ V+   D  K K+
Sbjct: 247 NGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKS 306

Query: 279 YSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGA 338
             KG+  N+SLGA KS AL  A+DAA +  I FAVAAGNE+ DAC +SPA A   ITVG 
Sbjct: 307 NLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGG 366

Query: 339 SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSL 398
           S  SD+ AFFSN+G CVD+FAPG+N+MSTYIGS N            P+ AG++AYYLSL
Sbjct: 367 STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSL 426

Query: 399 QPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453
           QPD  S ++     ++P  LK+K++ + +   L  LP  T N+++YNG G+NLS FW
Sbjct: 427 QPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  234 bits (598), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 144/423 (34%), Positives = 224/423 (52%), Gaps = 27/423 (6%)

Query: 56  QNDIIKDQYIVIFKNSAMMAEKELHFK-----QLKNFIKT------YSYEWDEK---DDH 101
           QN+I+  +YIV+FKN A   E +LH +     QL+  I        + +  D++   ++ 
Sbjct: 65  QNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFSTEEL 124

Query: 102 KSNLNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSR 161
              L  F IG+  +GY+     E ++ +R+  IV  +E DS +     +   ++ W L+R
Sbjct: 125 GGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLAR 184

Query: 162 ISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDN 221
           IS RP++ +     Y +D     N+ AY+LDTG+  +H  +  R   G  I PN+ + D 
Sbjct: 185 ISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDM 244

Query: 222 SGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN--KNY 279
           +GHGT +AG++   + GVA+   ++ VKVL   G G +S+++KG+ FV   H +   KN 
Sbjct: 245 NGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEKNG 304

Query: 280 SKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGAS 339
             G+VV  S+  +KS +L  A D  +S  IH  V AG + ++AC +SPA + + ITV   
Sbjct: 305 VLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVAGM 364

Query: 340 IFSDERAFFSNWGECVDVFAPGMNVMSTYIGSD----NXXXXXXXXXXXXPYTAGLIAYY 395
             +DE     NWG CVD++ PG  V +TY   +                    AGL+AY+
Sbjct: 365 SITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLAYF 424

Query: 396 LSLQPDKDSGYFTGE---MTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHF 452
            SLQP    G  T +   +TP +LKE+++ FG+K  L  L   +PNI+ +NGAG NL  F
Sbjct: 425 ASLQP----GLGTPDVIPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSF 480

Query: 453 WKD 455
           + D
Sbjct: 481 FND 483

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  194 bits (493), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 136/418 (32%), Positives = 215/418 (51%), Gaps = 59/418 (14%)

Query: 59  IIKDQYIVIFKNSAMMAEKELHFKQLKNFIK-TYSYEWDEKDDHKSNLN-IFKIGTTLSG 116
           I+ ++Y++  K S          + +++F+K T S     KDD K+++   F  G     
Sbjct: 17  IVGEEYLIKLKKS----------ESIQSFLKSTKSQSLQIKDDIKNHIRERFTFGA-FRA 65

Query: 117 YILRGPIETLQLLRQDPIVQLIEPDSKVHAL--------------KLKIQEDTPWGLSRI 162
            ++  P + ++ L+++P +  I P+ KV+A               K+ IQ + P  LSR+
Sbjct: 66  LVIDLPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPRHLSRL 125

Query: 163 SQRPRVRIGQDQL--------YYYDDATSGN-VTAYVLDTGIMISHEQFNGRARWGKTIV 213
           S+R ++    + +        YY+D    G+ V AY++DTGI   H +F GR ++   + 
Sbjct: 126 SRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKFAIDLT 185

Query: 214 PNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH 273
                ++N GHGTH+AGI+ S  FGVAK   ++ VK L   G+G +S +LK +EF +  H
Sbjct: 186 QEGPGDEN-GHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKALEFTI-RH 243

Query: 274 SKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA 333
            K ++  K  V NLS GA ++  +  AI  A +  I   VAAGN N+DAC+ SPA ++  
Sbjct: 244 CK-ESVDKKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNIDACWNSPASSKDV 302

Query: 334 ITVGASIFSDER---AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAG 390
           ITVGA  F D     A FSNWG CVDVFAPG+ V S    + +            P  +G
Sbjct: 303 ITVGA--FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSDVLLLSGTSMASPSVSG 360

Query: 391 LIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----LPENTPNIVIYNG 444
           + A  L      D G     + P  +K KI+   +K++ ++    +  NTPN++++NG
Sbjct: 361 IAAILL------DKG-----LNPKFVKSKIIESSTKNIFHQGTIMIKPNTPNLIVFNG 407

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  191 bits (486), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 133/384 (34%), Positives = 198/384 (51%), Gaps = 60/384 (15%)

Query: 109 KIGTTLS-----GYILRGPIETLQLLRQDPIVQLIEPDSKVHALK--------------- 148
           KIG T S     G+ +    + L+ ++++P+V  + P+ +VHA +               
Sbjct: 57  KIGKTFSIGSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFD 116

Query: 149 ---------LKIQEDTPWGLSRISQRPRV-------RIGQDQL-YYYDDATSG-NVTAYV 190
                    +K+Q   P  L+R+S+R ++           D L Y+YD  + G +V AY+
Sbjct: 117 NKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYI 176

Query: 191 LDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKV 250
           +D+GI + HE+FNGRA  G  +   +   D +GHGTHVAGI+ S  +GVAK  +++ +KV
Sbjct: 177 IDSGIYLEHEEFNGRAIPGIDLT-GEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKV 235

Query: 251 LRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIH 310
           L   G+G ++ VL GIEF V  H +  +     V NLSLG+ ++  L  AI AAI   + 
Sbjct: 236 LNRLGQGSLAMVLGGIEFAV-KHCQETSKKGRCVANLSLGSMRTAILNKAIKAAIDAGLV 294

Query: 311 FAVAAGNENMDACYTSPADARRAITVGASIFSDE---RAFFSNWGECVDVFAPGMNVMST 367
             VAAGN N++AC+ SPA A  AITVGA  F D     A FSNWG+C+D+FAPG+ + S 
Sbjct: 295 VVVAAGNNNLNACWYSPASAPEAITVGA--FDDRIDAIAKFSNWGQCLDIFAPGVVIKSL 352

Query: 368 YIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKD 427
            I  D             P  AGL A  L      D G     ++  ++K+ I+  G+ +
Sbjct: 353 SIFKDKEDVTYSGTSMASPTVAGLAALTL------DQG-----VSAEEVKDYILEMGTDN 401

Query: 428 VLYE----LPENTPNIVIYNGAGR 447
           V +         TPN + +NG  R
Sbjct: 402 VFHRRSLLFKPGTPNKICFNGVKR 425

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  190 bits (482), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 146/455 (32%), Positives = 213/455 (46%), Gaps = 66/455 (14%)

Query: 33  TISQKDRDSTFSRTEVLEHLSAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYS 92
           T+  K R  T     +L  L A  N  + ++Y+V FKN          F+Q   F  T +
Sbjct: 31  TLRPKARHRTMKAQCILISLLA--NLALAEEYLVRFKNPTA-------FQQ---FTSTSN 78

Query: 93  YEWDEKDDHKSNLNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHAL----- 147
             W +  DH+     F IG+   G  +      +  L++ P++  I P+ K  A      
Sbjct: 79  RSWRQFIDHRIEKK-FSIGS-FRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAE 136

Query: 148 --------------------KLKIQEDTPWGLSRIS---QRPRVRIGQDQL-----YYYD 179
                                +  Q D P  L+RIS   Q P     +D+      YYY+
Sbjct: 137 LSYMFNTTAKYAYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYE 196

Query: 180 DATSGN-VTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFG 238
           D   G  V AY++DTGI   H +F  R   G  +      ++N GHGTHVAG++ S  FG
Sbjct: 197 DEYQGQGVNAYIMDTGIHAEHPEFEDRVIQGVDLTKEGFGDEN-GHGTHVAGLVGSRTFG 255

Query: 239 VAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK-NKNYSKGSVVNLSLGASKSPAL 297
            AK   +V VKVL  +G G+ S+VL G+EF+V+  +K ++   K  V NLSLG+ +SP +
Sbjct: 256 AAKKVSLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKKCVANLSLGSFRSPII 315

Query: 298 VLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGA-SIFSDERAFFSNWGECVD 356
            +A++ AI E I F  AAGN N+DA + SPA A   ITVGA     D  A FSNWG CV+
Sbjct: 316 NMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVN 375

Query: 357 VFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKL 416
           +FAPG+ + S    +DN            P   G+ A  LS             + P  +
Sbjct: 376 IFAPGVEIESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPELI 424

Query: 417 KEKIVAFGSKDVLYE----LPENTPNIVIYNGAGR 447
            ++I    +++V +        +TPN ++YNG  +
Sbjct: 425 AQEIEYLSTRNVFHRRTLFFKPSTPNQILYNGVDK 459

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  186 bits (473), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 187/355 (52%), Gaps = 39/355 (10%)

Query: 114 LSGYILRGPIETLQLLRQDPIVQLIEPDS------------KVHALKLKIQEDTPWGLSR 161
             G+    P + ++ L+++P+V  + P+S            + ++ + K+QED P  L+R
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 162 ISQRPRVRIG------QDQLYYYDDATSGN-VTAYVLDTGIMISHEQFNGRARWGKTIVP 214
           +S+R  +         Q+  YYYD    G+ V AY++DTGI   H+   GRA +G  +V 
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMV- 179

Query: 215 NDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS 274
            +   D +GHGTHVAGI+ S  FGVAK   +V VK L + G+G+++ V+  IEF V +H 
Sbjct: 180 GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV-NHC 238

Query: 275 KNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAI 334
           K        V NLSLG+ ++  L  A++AA+   +   VAAGN N++AC+ SPA A  AI
Sbjct: 239 KKSGML--CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAI 296

Query: 335 TVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIA 393
           TVGA    +D  A FSNWG CVDVFA G+ VMS                   P  AGL A
Sbjct: 297 TVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVAGLAA 356

Query: 394 YYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----LPENTPNIVIYNG 444
             L      DSG     + P  +K+KI+   +++V  +        TPN + +NG
Sbjct: 357 VLL------DSG-----IDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFNG 400

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  184 bits (466), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 140/426 (32%), Positives = 198/426 (46%), Gaps = 67/426 (15%)

Query: 71  SAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIF---KIGTTLSGYILRGPI---- 123
           SA   E  + FK    F     +  +   DH  N   F   KI  T S    RG      
Sbjct: 14  SASAEEYLIRFKSPDGF----QFFMNSAKDHTKNFKEFFHNKISHTFSFGSFRGITVDIS 69

Query: 124 -ETLQLLRQDPIVQLIEPDSKVHAL---------------------------KLKIQEDT 155
            + ++ +R +P+V  + P+ +  A                            K+K+Q + 
Sbjct: 70  QDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGEA 129

Query: 156 PWGLSRISQR-PRVRIGQDQL--------YYYDDATSGNVTAYVLDTGIMISHEQFNGRA 206
           P  L+R+S+R P      D+L        YYY      N+ AY++DTGI   H+ F GRA
Sbjct: 130 PRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGRA 189

Query: 207 RWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGI 266
            +G+     +   D +GHGTHVAGI+ S  FGVAK   ++ VK L + G+G+++ V+  +
Sbjct: 190 IFGRDFT-GEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISAV 248

Query: 267 EFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTS 326
           EF V +H K+    KG V NLSLGA ++  +  AI AA    +   VAAGN N++AC+ S
Sbjct: 249 EFAV-NHCKSSG-KKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNINACWNS 306

Query: 327 PADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXX 385
           PA A  AITVGA    +D  A FSNWG CVD+FA G+ V S      +            
Sbjct: 307 PASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIAFSGTSMAS 366

Query: 386 PYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----LPENTPNIVI 441
           P   GL+A  L      D G     + P  +K K+V   + D+L          TPN + 
Sbjct: 367 PSVTGLVAILL------DKG-----VEPENIKAKLVELATHDLLQRRTLFFKPGTPNRIA 415

Query: 442 YNGAGR 447
           +NG  R
Sbjct: 416 FNGMER 421

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 169/312 (54%), Gaps = 29/312 (9%)

Query: 147 LKLKIQEDTPWGLSRISQRPRVRIGQDQL--------YYYDDATSGN-VTAYVLDTGIMI 197
           L +  Q+  P  L+RIS+R  +    + +        YYYDD  SG  V AYV+DTGI  
Sbjct: 130 LSIVAQKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYK 189

Query: 198 SHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEG 257
            H Q  GRA++G  +V  +   D +GHGTHVAG+I S KFGVAK   ++ VK L + G+G
Sbjct: 190 EHPQLEGRAKFGADLV-GEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQG 248

Query: 258 DMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGN 317
           +++ V+  IEF V+   K++   +G V NLSLG+ ++  L  A++AA+   +   VAAGN
Sbjct: 249 NLTSVISAIEFTVNHCRKSR---RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGN 305

Query: 318 ENMDACYTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXX 376
            N +AC++SPA +  AITVGA    +D  A FSNWG CVD+FAPG+ + S          
Sbjct: 306 SNANACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPV 365

Query: 377 XXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----L 432
                    P  +G++A  L      DSG     + P  +K +++   +  V ++     
Sbjct: 366 AFSGTSMASPIVSGMVANLL------DSG-----IHPFDIKTELIDLATDSVFHKRTLLF 414

Query: 433 PENTPNIVIYNG 444
              TPN V + G
Sbjct: 415 KPGTPNRVAFTG 426

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  179 bits (454), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 180/360 (50%), Gaps = 44/360 (12%)

Query: 122 PIETLQLLRQDPIVQLIEPDSKVHALK-------------LKIQEDTPWGLSRISQRPRV 168
           P + +  +R+ P+V  + P+ +  A               ++ Q   P  LSR+S+R ++
Sbjct: 71  PRDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQL 130

Query: 169 RIGQDQL---------YYYDDATSGN-VTAYVLDTGIMISHEQFNGRARWGKTIVPNDVD 218
               ++          YYYD+   G+ + AY++DTGI   H +F GRA +G+ +   +  
Sbjct: 131 PYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLT-GEGP 189

Query: 219 EDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKN 278
            D +GHGTHVAGI+ S K+GVAK   +V VK L + G+G+++ V+  +EF V +H ++  
Sbjct: 190 GDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHCRSSE 248

Query: 279 YSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGA 338
             KG V+NLSLGA ++  +  A+ AA    I   VAAGN N++AC  SPA A  AITVGA
Sbjct: 249 -GKGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGA 307

Query: 339 -SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLS 397
               +D  A FSNWG CVD+FAPG+ V S                   P   GL A  L 
Sbjct: 308 FDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILLD 367

Query: 398 LQPDKDSGYFTGEMTP-SKLKEKIVAFGSKDVLYE----LPENTPNIVIYNGAGRNLSHF 452
                       E  P  K+K+ I+   + DV           TPN V +NG  +N   F
Sbjct: 368 ------------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKNDDKF 415

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  179 bits (455), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/363 (35%), Positives = 180/363 (49%), Gaps = 41/363 (11%)

Query: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHAL------------KLKIQEDT 155
           F+IG  L G  +    + L  +++ P V+ + P+  V A             K+K Q   
Sbjct: 56  FQIGE-LKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGA 114

Query: 156 PWGLSRISQR--------PRVRIGQDQLYYYDDATSGNVT-AYVLDTGIMISHEQFNGRA 206
           P  L+RIS+R         + R      YYYD    G  T AY+LDTG+M  H++F  R 
Sbjct: 115 PRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRV 174

Query: 207 RWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGI 266
            +G T    + + D +GHGTHVAG++ S  FGVAK  ++V VK L + G G +  +L  +
Sbjct: 175 EFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSAL 233

Query: 267 EFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTS 326
           EF V D  ++++     V+N+SLG+ KS  L  AI+    + I   VAAGN NM+AC+TS
Sbjct: 234 EFAVQDCQEHEDSQ--CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTS 291

Query: 327 PADARRAITVGASIFSDER---AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXX 383
           P+ A  AITVGA  F D     A FSNWG CVD+FAPG+NV S                 
Sbjct: 292 PSSATGAITVGA--FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSM 349

Query: 384 XXPYTAGLIAYYL--SLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVI 441
             P   G++A  L   + P+    Y     T    K++ + F            TPN V+
Sbjct: 350 ASPIVCGMVALLLDDGVPPEDIRDYLQELATDGVFKKRTLVF---------KPGTPNSVL 400

Query: 442 YNG 444
           YNG
Sbjct: 401 YNG 403

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  179 bits (453), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 166/316 (52%), Gaps = 35/316 (11%)

Query: 149 LKIQEDTPWGLSRISQRPRVRI---GQDQL-----YYYDDATSG-NVTAYVLDTGIMISH 199
           + +Q   P  L RIS R ++      +++      YYY+D   G N+ AY+LDTGI   H
Sbjct: 151 INVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEH 210

Query: 200 EQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDM 259
             F  R   G  +   +   D++GHGTHVAGI+ S  FGVAK   +V VKVL   G G++
Sbjct: 211 PDFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNL 269

Query: 260 SDVLKGIEFVVDDHSKNKNYSKG--SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGN 317
           + VL GI+F V DH +    ++G   V N+SLG  ++  +  AI  A    +   VAAGN
Sbjct: 270 TTVLSGIQFAV-DHCRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGN 328

Query: 318 ENMDACYTSPADARRAITVGASIFSDER---AFFSNWGECVDVFAPGMNV--MSTYIGSD 372
            N+ AC+TSPA A+ AITVGA  F D     A+FSNWG CVD+FAPG+ +  +S    S 
Sbjct: 329 SNVSACWTSPASAKNAITVGA--FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESH 386

Query: 373 NXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYEL 432
           +            P  AGL A  L      D G     + P  +K+K++   +KDV  +L
Sbjct: 387 HKHVTHSGTSMASPVVAGLAAILL------DKG-----VEPFDVKDKLLHLSTKDVFNKL 435

Query: 433 ----PENTPNIVIYNG 444
                  TPN + YNG
Sbjct: 436 TLFFKYGTPNKIAYNG 451

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  176 bits (446), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 130/398 (32%), Positives = 193/398 (48%), Gaps = 76/398 (19%)

Query: 105 LNIFKIGTTL--------SGYILRGPIETLQLLRQDPIVQLIEPDSKVHALK-------- 148
           LNIF  G  L         G+ +  P+  +  LR +P+V  I P+ + +           
Sbjct: 45  LNIFSQGKILKTFSFGKFEGFTVDFPLSLISKLRNNPLVAEIVPNVEFNVFDGEEDPSYW 104

Query: 149 -------------------------LKIQEDTPWGLSRISQRPRVRIGQDQL-------- 175
                                       Q++ P  L+RIS+R  +    + +        
Sbjct: 105 DDDNGDDEYDEDEDEDDEDNSEFPDFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFS 164

Query: 176 YYYDDATSGN-VTAYVLDTGIMISHEQFNGRARWGKTIV---PNDVDEDNSGHGTHVAGI 231
           YYYDD+  G  V AYV+DTGI   H QF GRA++G  +V   P D++    GHGTHVAG+
Sbjct: 165 YYYDDSFPGTCVNAYVIDTGIFKEHRQFQGRAKFGADLVGEGPGDLN----GHGTHVAGL 220

Query: 232 IASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGA 291
           I S K+GVAK   ++ VK L + G+G+++ V+  IEF V+   K+K   +G V NLSLG+
Sbjct: 221 IGSQKYGVAKDVSLIEVKALNAKGQGNLTSVISAIEFTVNHCRKSK---RGCVANLSLGS 277

Query: 292 SKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGA-SIFSDERAFFSN 350
            ++  L  A++AA+   +   VAAGN N +AC++SPA +  AI+VGA    +D  A FSN
Sbjct: 278 FRNSVLNQAVEAALEAGVVVVVAAGNSNANACWSSPASSLSAISVGAFDDRTDTIARFSN 337

Query: 351 WGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGE 410
           WG CVD+FAPG+ + S                   P   G++A  L      DSG     
Sbjct: 338 WGNCVDLFAPGVKIASLSNIPPFKSVAYSGTSMASPLVTGMVAVLL------DSG----- 386

Query: 411 MTPSKLKEKIVAFGSKDVLYE----LPENTPNIVIYNG 444
           + P  +KE+++   +  V ++        TPN V + G
Sbjct: 387 IHPFDIKEELINTATDSVFHKRALLFKPGTPNRVAFTG 424

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  174 bits (442), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/435 (29%), Positives = 200/435 (45%), Gaps = 68/435 (15%)

Query: 57  NDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSG 116
           N +  ++Y+V FKN          F+Q   F    +  W +  D+K     F IG+   G
Sbjct: 13  NLVYAEEYLVRFKNPTA-------FQQ---FTSNSNRSWRQFIDNKIEKK-FSIGS-FRG 60

Query: 117 YILRGPIETLQLLRQDPIVQLIEPDSKVHALK---------------------------- 148
             +      +  L++ P+V  I P+ +  A +                            
Sbjct: 61  VTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDSARDVEYNYTFNATAKYSYENLDEEQ 120

Query: 149 -LKIQEDTPWGLSRISQRPRVRIGQD---------QLYYYDDATSGNVTAYVLDTGIMIS 198
            +  Q D P  L+RIS+  ++    +           YY DD    +V AY++DTGI   
Sbjct: 121 NITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFAD 180

Query: 199 HEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGD 258
           H +F  R   G  +      + N GHGTHVAG++ S  +G AK   +V VKVL  +G G+
Sbjct: 181 HPEFEDRVIQGIDLTKEGFGDQN-GHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 239

Query: 259 MSDVLKGIEFVVDDHSK-NKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGN 317
            S+VL G+EF+V+  ++ ++   K  V NLSLG+ +SP + +A++ AI E I F  AAGN
Sbjct: 240 ASNVLSGLEFIVEHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 318 ENMDACYTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXX 376
            N+DA + SPA A   ITVGA     D  A FSNWG CV++FAPG+ + S    + N   
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTL 359

Query: 377 XXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----L 432
                    P   G+ A  LS             + P  + +++    +++V +      
Sbjct: 360 VLSGTSMSTPIVTGVAAVLLS-----------KGIEPEMIAQELEYLSTRNVFHRRTLFF 408

Query: 433 PENTPNIVIYNGAGR 447
             +TPN ++YNG  +
Sbjct: 409 KPSTPNQILYNGVDK 423

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  173 bits (438), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 171/347 (49%), Gaps = 53/347 (15%)

Query: 141 DSKVHALKLKIQEDTPWGLSRISQRPRV--------RIGQDQLYYYDDATSG-NVTAYVL 191
           + K+ +  +K Q + P  L+R+S+R ++        R   D  YYY     G +V AYVL
Sbjct: 149 NGKLLSRYIKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVL 208

Query: 192 DTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVL 251
           D+G+MI H  F GRA +G   + +    D +GHGTHVAG+I S  +GV+K   ++ VKVL
Sbjct: 209 DSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVL 268

Query: 252 RSNGEGDMSDVLKGIEFV----------------------VDDHSKNKNYSKGSVVNLSL 289
            S G G +  V+ G+EFV                       +D   +   SK  V+NLSL
Sbjct: 269 DSVGSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSL 328

Query: 290 GASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER---- 345
           G  +S  +  AI+  I + I   VAAGN NM+AC+TSPA     ITVGA    D+R    
Sbjct: 329 GTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSI 385

Query: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSG 405
           A FSNWG CVD+FAPG+ V S                   P   GL+A  L      DSG
Sbjct: 386 AKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL------DSG 439

Query: 406 YFTGEMTPSKLKEKIVAFGSKDVLYE----LPENTPNIVIYNGAGRN 448
                + P+++K+++    + ++           TPN + +NG  R+
Sbjct: 440 -----IKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  172 bits (436), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 200/430 (46%), Gaps = 68/430 (15%)

Query: 62  DQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILRG 121
           ++Y+V FKN          F+Q   F    +  W +  D+K     F IG+   G  +  
Sbjct: 18  EEYLVRFKNPTA-------FQQ---FTSNSNRSWRQFIDNKIEKK-FSIGS-FRGVTMNL 65

Query: 122 PIETLQLLRQDPIVQLIEPDSKVHALK-----------------------------LKIQ 152
               +  L++ P+V  I P+ +  A +                             +  Q
Sbjct: 66  SKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSYTFNATAKYSYEDVEEEQNITYQ 125

Query: 153 EDTPWGLSRIS---QRPRVRIGQDQL-----YYYD-DATSGNVTAYVLDTGIMISHEQFN 203
            D P  L+RIS   Q P     +D+      YYY+ D    +V AY++DTGI   H +F 
Sbjct: 126 PDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEFE 185

Query: 204 GRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVL 263
            R   G  +      + N GHGTHVAG++ S  +G AK   +V VKVL  +G G+ S+VL
Sbjct: 186 DRVIQGIDLTKEGFGDQN-GHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNVL 244

Query: 264 KGIEFVVDDHSK-NKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDA 322
            G+EF+V+  +K ++   K  V NLSLG+ +SP + +A++ AI E I F  AAGN N+DA
Sbjct: 245 SGLEFIVEHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDA 304

Query: 323 CYTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXX 381
            + SPA A   ITVGA     D  A FSNWG CV++FAPG+ + S    + N        
Sbjct: 305 YWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLILSGT 364

Query: 382 XXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----LPENTP 437
               P   G+ A  LS             + P  + ++I    +++V +        +TP
Sbjct: 365 SMSTPIVTGVAAILLS-----------KGIEPEMIAQEIEYLSTRNVFHRRTLFFKPSTP 413

Query: 438 NIVIYNGAGR 447
           N ++YNG  +
Sbjct: 414 NQILYNGVDK 423

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  170 bits (430), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 132/451 (29%), Positives = 203/451 (45%), Gaps = 65/451 (14%)

Query: 44  SRTEVLEHLSAKQNDIIKDQYIVIFKNSAMMAEKELHFKQ---LKNFIKTYSYEWDEKDD 100
           S  E+  H + K   I+    I +  N A   E  + FK     + F    +  W +  D
Sbjct: 40  STPEIARHPTMKPQCIL----ISLLVNLAYAEEYLVRFKNPTAFQQFTSNSNRSWRQFID 95

Query: 101 HKSNLNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALK------------ 148
           +K     F IG+   G  +      +  L++ P+V  I P+ +  A +            
Sbjct: 96  NKIEKK-FSIGS-FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNYT 153

Query: 149 -----------------LKIQEDTPWGLSRISQRPRVRIGQD---------QLYYYDDAT 182
                            +  Q D P  L+RIS+  ++    +           YY DD  
Sbjct: 154 FNATAKYLYEDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYL 213

Query: 183 SGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKT 242
             +V AY++DTGI   H +F  R   G  +      + N GHGTHVAG++ S  +G AK 
Sbjct: 214 GQDVNAYIMDTGIFSDHPEFEDRVIQGIDLTKEGFGDQN-GHGTHVAGLVGSKTYGAAKK 272

Query: 243 CEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK-NKNYSKGSVVNLSLGASKSPALVLAI 301
             +V VKVL  +G G+ S+VL G+EF+V+  ++ ++   K  V NLSLG+ +SP + +A+
Sbjct: 273 VNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTRVSRPQGKKCVANLSLGSFRSPIINMAV 332

Query: 302 DAAISENIHFAVAAGNENMDACYTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAP 360
           + AI E I F  AAGN N+DA + SPA A   ITVGA     D  A FSNWG CV++FAP
Sbjct: 333 EGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAP 392

Query: 361 GMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKI 420
           G+ + S    +              P   G+ A  LS             + P+ + ++I
Sbjct: 393 GVEIESLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS-----------KGIEPALIAQEI 441

Query: 421 VAFGSKDVLYE----LPENTPNIVIYNGAGR 447
               +++V +        +T N ++YNG  +
Sbjct: 442 EYLSTRNVFHRRTLFFKPSTANQILYNGVDK 472

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  170 bits (430), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 116/311 (37%), Positives = 162/311 (52%), Gaps = 27/311 (8%)

Query: 149 LKIQEDTPWGLSRISQRPRVRIG-QDQL-------YYYDDATSG-NVTAYVLDTGIMISH 199
           + IQ   P  L ++S R ++    +D+        YYYD    G N   Y++DTG+   H
Sbjct: 147 VDIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEH 206

Query: 200 EQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDM 259
           ++F  R  +G   +  +   D +GHGTHVAG+I S  FGVAK   +  VKVL   G G++
Sbjct: 207 KEFGNRVHFGGDFI-GEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNL 265

Query: 260 SDVLKGIEFVVDDHS-KNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNE 318
           + VL+GIEF V++   K +   K  V+N+SLG  ++P +  AI  A    I   VAAGN 
Sbjct: 266 TSVLEGIEFAVNNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNN 325

Query: 319 NMDACYTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXX 377
           N  AC+TSPA +  AITVGA    +D  A FSNWG+CVD+FAPG+ + S           
Sbjct: 326 NFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGVI 385

Query: 378 XXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYEL----P 433
                   P  AGL+A  +      + GY   E     +K+K++   SK +  +L     
Sbjct: 386 HSGTSMASPIVAGLVAILM------EKGYKCDE-----IKQKLIDDSSKSIFSKLTLFFK 434

Query: 434 ENTPNIVIYNG 444
             TPN VIYNG
Sbjct: 435 YGTPNRVIYNG 445

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 140/231 (60%), Gaps = 16/231 (6%)

Query: 148 KLKIQEDTPWGLSRISQRPRVRIG-------QDQL-YYYDDATSGN-VTAYVLDTGIMIS 198
           K K+Q   P  L+RIS R ++          ++QL YYYDD   G  V AYV+DTGI+  
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 199 HEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGD 258
           H+ F  R  +G T +  +   D +GHGTHVAG+I S  +GV K  +++ VK +   G   
Sbjct: 343 HKDFEDRVEFG-TDLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQ 401

Query: 259 MSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNE 318
           +S +++ IE+ V+D +   +  K  VVN+SLG+     +  A+++AI+E + F VAAGN 
Sbjct: 402 LSHIIEAIEYTVNDCNSRVD-KKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAGNN 460

Query: 319 NMDACYTSPADARRAITVGASIFSDER---AFFSNWGECVDVFAPGMNVMS 366
           N+DAC++SP  ++ AITVGA  F D     A FSNWGECVD+FA G+ V S
Sbjct: 461 NIDACWSSPGSSKNAITVGA--FDDRLDVIAKFSNWGECVDIFASGVEVKS 509

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  164 bits (415), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 165/318 (51%), Gaps = 34/318 (10%)

Query: 151 IQEDTPWGLSRISQR---PRVRIGQDQL---YYYDDATSGN-VTAYVLDTGIMISHEQFN 203
           IQ D P  L+R  +R   P    G  +    YYYD+   G  V  YVLD+GI  SH +F+
Sbjct: 427 IQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFD 486

Query: 204 GRARWGKTIV---PNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMS 260
           GRA +G       P D++    GHGTHVAG++ S  FG+AK   +  +KV+  +G G  S
Sbjct: 487 GRAHFGIDTTKEGPGDLN----GHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 261 DVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASK--SPALVLAIDAAISENIHFAVAAGNE 318
           +++ G+EF V  H +     K  V N+SLG       AL  A++AAI E + F VAAGN 
Sbjct: 543 NIIAGVEFAV-KHCQQSG--KRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNS 599

Query: 319 NMDACYTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXX 377
              AC+ SPA  + AITVGA    SD  A FSN+G+CVD+FAPG+ V S      N    
Sbjct: 600 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTMRV 659

Query: 378 XXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE---LPE 434
                   P TAG++A  L      D G     + P ++K+ +++  +K + ++   +  
Sbjct: 660 LNGTSMSAPITAGVVAVLL------DQG-----IEPHEVKDHLLSISTKGLFHKRRLVSS 708

Query: 435 NTPNIVIYNGAGRNLSHF 452
            TP+  ++ G  R    F
Sbjct: 709 RTPDRALFTGVKREDDSF 726

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  160 bits (404), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 201/437 (45%), Gaps = 77/437 (17%)

Query: 63  QYIVIFKNS----AMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYI 118
           +Y+V  KNS    + M     H + +K+++            H      F  G+   G  
Sbjct: 23  EYLVSLKNSDSIQSFMDSTYAHGQLMKDYL------------HGKISKTFSFGS-FRGLT 69

Query: 119 LRGPIETLQLLRQDPIVQLIEPDSKVHALK--------------------------LKIQ 152
           +    + +  ++++P+V  + P+ K+HA                            +K+Q
Sbjct: 70  VNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKNSYLVKVQ 129

Query: 153 EDTPWGLSRISQRPRVRIGQDQLYYYDDATS---------GNVTAYVLDTGIMISHEQFN 203
              P  L+R+S+R  +    D    Y+D+ S          +V AY++D+GI I+ E+F 
Sbjct: 130 NGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEEFE 189

Query: 204 GRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVL 263
           GRA  G  +   +   D +GHGTHVAG++ S  +GVAK   +V VK L   G G +  V+
Sbjct: 190 GRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLITVI 248

Query: 264 KGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDAC 323
             +EFVV+   K+K  SK  V NLSLGA   P L  AI A +   +   VAAGN N+DAC
Sbjct: 249 SALEFVVNHCGKSK--SKKCVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGNGNIDAC 306

Query: 324 YTSPADARRAITVGASIFSDER----AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXX 379
           + SPA  + AITVGA    D+R    A FSNWG CVD+FAPG+ + S  I  +       
Sbjct: 307 WCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKDNQKSVEFS 363

Query: 380 XXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----LPEN 435
                 P  AG+++  L      D G     +    +++ +    + DV  +        
Sbjct: 364 GTSMASPQVAGIVSILL------DQG-----VENEDIRDYLFELATDDVFQKRTLLFKPR 412

Query: 436 TPNIVIYNGAGRNLSHF 452
           TPN + +NG  +    F
Sbjct: 413 TPNRITFNGISKKDEDF 429

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  159 bits (401), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 170/349 (48%), Gaps = 46/349 (13%)

Query: 126 LQLLRQDPIVQLIEPDSKVHALKLK--------------IQEDTPWGLSRISQRPRVRIG 171
           ++ L+Q+P+V  I P+    A +                +Q + P  L+RIS+R ++   
Sbjct: 79  MEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKLPYD 138

Query: 172 QDQL--------YYYDDATSG-NVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNS 222
              +        YYY     G +V AY+LD+G+  +   F GR  +G      D + D++
Sbjct: 139 FTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEGDSN 197

Query: 223 GHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKG 282
           GHGTHVAG++ S  +GVAK   +V VK L   G G +  VL  IEF V+D  ++    K 
Sbjct: 198 GHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHP--EKR 255

Query: 283 SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFS 342
            V NLSLG+ K+  +  AI AA  + +   VAAGN N++AC+TSPA A  AITVGA  F 
Sbjct: 256 CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVGA--FD 313

Query: 343 DE---RAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQ 399
           D     A FSNWG CVD++APG+ V S                   P   G +A  L   
Sbjct: 314 DRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQVAILL--- 370

Query: 400 PDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYE----LPENTPNIVIYNG 444
              D G     +    +K  ++   + DV  +       NTPN V++NG
Sbjct: 371 ---DKG-----IPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  155 bits (391), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/276 (38%), Positives = 146/276 (52%), Gaps = 22/276 (7%)

Query: 176 YYYDDATSG-NVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIAS 234
           YYYD    G  V  Y+LD+GI  SH +F GRA +G     N+   D +GHGTHVAG++ S
Sbjct: 300 YYYDAEHLGETVNVYILDSGIHKSHPEFEGRAVFGIDTT-NEGPGDLNGHGTHVAGLVGS 358

Query: 235 DKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASK- 293
             +G AK   +  VKV+  +G G  S+++ G+EF V  H +     K  V N+SLG    
Sbjct: 359 KTYGAAKKATIYEVKVMTVDGRGSTSNIIAGVEFAV-KHCQQS--GKKCVANMSLGGLSF 415

Query: 294 -SPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGA-SIFSDERAFFSNW 351
              AL  A++AAI E + F VAAGN    AC+ SPA  + AITVGA    SD  A FSN+
Sbjct: 416 GHSALDSAVEAAIEEGLVFVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNY 475

Query: 352 GECVDVFAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEM 411
           G+CVD+FAPG+ V S      N            P TAG++A  L      D G     +
Sbjct: 476 GKCVDIFAPGVAVSSLSNSPYNTVRVLNGTSMSAPITAGVVAVLL------DQG-----V 524

Query: 412 TPSKLKEKIVAFGSKDVLYE---LPENTPNIVIYNG 444
               +KE+++   +K V +    +   TP+  ++NG
Sbjct: 525 KHEDVKERLIDLSTKGVFHRRRLVSSRTPDRTLFNG 560

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  146 bits (368), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 149/303 (49%), Gaps = 24/303 (7%)

Query: 148 KLKIQEDTPWGLSRISQRPRVRIGQD---QLYYYDDATSGNVTAYVLDTGIMISHEQFNG 204
           K   Q + P  LSR S+  ++    +     YY  D    NVT YVLD+GI + H +F G
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 205 RARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLK 264
           R         + V  DN GHGT VAGII S  +GVAK   ++ +KVL + G+G++  +L+
Sbjct: 201 RILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 265 GIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACY 324
           G++F+     +N N     ++N SLGA     L  A +   +  I    AAGN  ++AC+
Sbjct: 260 GLQFITKHCEENTN--GNCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNACW 317

Query: 325 TSPADARRAITVGASIFSDER-AFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXX 383
            +PA ++   TVG+    D+  A FSNWG CVD+ APG+ V +    +            
Sbjct: 318 ITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGTSV 377

Query: 384 XXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLY-----ELPENTPN 438
             P   GL A  LS    K++ Y           ++I   GS+D+L       LP  TPN
Sbjct: 378 STPIVTGLAAILLSKGVPKENLY-----------DEIRKMGSRDLLRNKEFSRLP-GTPN 425

Query: 439 IVI 441
           +++
Sbjct: 426 LIV 428

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  139 bits (350), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 156/304 (51%), Gaps = 25/304 (8%)

Query: 152 QEDTPWGLSRISQRPRVRIGQD-------QLYYYDDATSGNVTAYVLDTGIMISHEQFNG 204
           Q   P  L+RIS+R ++ + +        + +Y+++     V  YVLD+G+   H  F G
Sbjct: 154 QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 205 RARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLK 264
           RA  G      +   D  GHGTHVAG+I S  +GVAK   +V VKVL S G+G ++++++
Sbjct: 214 RAMKGIDTT-GEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNIIE 272

Query: 265 GIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALV-LAIDAAISENIHFAVAAGNENMDAC 323
           G+E+VV+     K   +  V+N+SLGA  + +++  A+ A I E +   VA GN  ++AC
Sbjct: 273 GLEYVVNQCIGKK---RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNSGLNAC 329

Query: 324 YTSPADARRAITVGA-SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXX 382
           + SPA  R+AITV A    +D  A FSNWG C+D++APG+NV S                
Sbjct: 330 WYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NKGRGTFVLSGTS 388

Query: 383 XXXPYTAGLIAYYL--SLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIV 440
              P  AG  A YL     P +     +   T    K++ +A   +         TPN V
Sbjct: 389 MASPIVAGAAAIYLDQGADPAEVRKILSKTATRGVFKKRAIAVRPR---------TPNKV 439

Query: 441 IYNG 444
           +Y G
Sbjct: 440 LYTG 443

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  133 bits (334), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 105/331 (31%), Positives = 153/331 (46%), Gaps = 26/331 (7%)

Query: 122 PIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDDA 181
           P   L+ L  D  +  +  D  +   +  +QE  P  L+R+SQ+  +R G D  Y Y   
Sbjct: 63  PQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSDGTYIYHSN 121

Query: 182 TSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDE-DNSGHGTHVAGIIASDKFGVA 240
               V  Y+LDTGI   H +  GR +    +  N V   D  GHGT VAG+I S  FG A
Sbjct: 122 GGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATFGSA 181

Query: 241 KTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLA 300
           K C +  V+V  S G   +  V++ +E      S  +   + SVV +     K+  L  A
Sbjct: 182 KKCNLFDVRVADSTGNATLIGVIRALEHASKLASVTQ---RPSVVVIPFTMRKNVILNSA 238

Query: 301 IDAAI-SENIHFAVAAGNENMDACYTSPADARRAITVGASIFS--DERAFFSNWGECVDV 357
           I+A I  +++   VA GN N +AC +SPA A  A+T+G+   +  D  A F+N+G+C+D 
Sbjct: 239 IEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDT 298

Query: 358 FAPGMNVMSTYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSLQPDKDSGYFTGEMTPSKLK 417
           FA G+N+ S   G                  +G++AYY+SL        + G    +K+K
Sbjct: 299 FAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSLG-------YRGMDAVNKVK 351

Query: 418 EKIVAFGSKDVLYELPENTPNIVIYNGAGRN 448
                      L  LP   PNI     A RN
Sbjct: 352 -----------LLSLPNVIPNIKQEYSATRN 371

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  126 bits (317), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 132/256 (51%), Gaps = 13/256 (5%)

Query: 151 IQEDTPWGLSRISQRPRVRIGQ---DQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRAR 207
           +Q+  P  L+R+SQ+  +R G    +  Y Y       V  Y+LDTGI  +H  F GR +
Sbjct: 92  VQQHAPNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQ 151

Query: 208 WGKTIVPNDVDE-DNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGI 266
                  + V   D  GHGT VAG+I S  FGVAK C +  V+V  S G   +  VL+ +
Sbjct: 152 KAADFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRAL 211

Query: 267 EFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISE-NIHFAVAAGNENMDACYT 325
           E      +  K   + S++ + L   ++  L  A++A + + +I   VAAGNEN  AC  
Sbjct: 212 EHASKLAAVTK---RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSV 268

Query: 326 SPADARRAITVGA--SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNXXXXXXXXXX 383
           SPA A  A+T+G+     +D  A F+N+ ECVD+F  G++V +  +G D+          
Sbjct: 269 SPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTS 326

Query: 384 XXPYTA-GLIAYYLSL 398
                A GL+AYY+S+
Sbjct: 327 ISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  113 bits (282), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 144/304 (47%), Gaps = 20/304 (6%)

Query: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ---RP 166
           IG+   G+      E +  L  DP V  I  D  ++  +   Q D P  L+R+S      
Sbjct: 57  IGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNS 116

Query: 167 RVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVD---EDNSG 223
           RV    +  + +       V  Y++D+GI   H  F  R    K I   D      D  G
Sbjct: 117 RVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHG 175

Query: 224 HGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEG-DMSDVLKGIEFVVDDHSKNKNYSKG 282
           HGT +AG++ SD FGV K   +  V+V+ +   G  +S +LK +EF +++HS+     + 
Sbjct: 176 HGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRAT--MRP 232

Query: 283 SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA---ITVGAS 339
           SV  L    SK+  L  AI+ ++  +I   V AGN++  AC  SPA AR +   ++VG+ 
Sbjct: 233 SVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 340 IF--SDERAFFSNWGECVDVFAPG--MNVMSTYIGSD-NXXXXXXXXXXXXPYTAGLIAY 394
            +  S E A FSN+GECVDVF  G  M+ +     SD N               AG + Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 395 YLSL 398
           Y+SL
Sbjct: 352 YMSL 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  112 bits (280), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 132/282 (46%), Gaps = 17/282 (6%)

Query: 123 IETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDDAT 182
           +E L+ L  D  V  I  D  +   + K+Q  +P  LS++S            + +D  +
Sbjct: 62  VEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGGS--------FTFDPVS 113

Query: 183 SGNVTAYVLDTGIMISH---EQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGV 239
              V  YV DTGI   H   +  N       T  P     D  GHGT +AG+IAS+ FGV
Sbjct: 114 GNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPHGHGTMMAGLIASETFGV 173

Query: 240 AKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVL 299
            K+C +V V+V   +GE  +S ++KGI   V   +  +   + SV  L +   K   ++ 
Sbjct: 174 LKSCSLVDVRVADKDGEVKLSTLMKGISASV---AHARFTKRPSVFVLPMTIGKKNHILD 230

Query: 300 AIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDVFA 359
               AI ++I   + AGN+  DAC  SP +    + +G+    +  A FSN+G CVDV+ 
Sbjct: 231 NFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGNCVDVYT 290

Query: 360 PGMNVM---STYIGSDNXXXXXXXXXXXXPYTAGLIAYYLSL 398
            G +++   ST  G++                AG++ Y++S+
Sbjct: 291 SGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  109 bits (272), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 101/336 (30%), Positives = 153/336 (45%), Gaps = 36/336 (10%)

Query: 84  LKNFIKTYSYEWDEKDDHKSNLNIFKIGT--TLSGYILRGPIETLQLLRQDPIVQLIEPD 141
           L   + +Y+   D++    ++  IF++G+    +G    GPI  LQ L  DP V  I  D
Sbjct: 27  LNAVLNSYALSSDQQGPEITD--IFELGSFRAFTGD-FSGPI--LQKLYNDPNVLAISRD 81

Query: 142 SKVHALKLKIQEDTP---WGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMIS 198
             +   ++ +Q + P    GLS IS          Q + Y       V  Y+LDTGI I 
Sbjct: 82  GSLKLQEIVLQNNAPSHLVGLSSISPLSH------QPFIYRSNGGNGVDVYLLDTGIDIK 135

Query: 199 HEQFNG-----RARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRS 253
           H   +       A   ++ VP   D    GHGT +AGIIAS+ FGV K C +V V+V  S
Sbjct: 136 HPNLSKLNILRMADLTQSPVPQGTDPQ--GHGTAMAGIIASETFGVLKKCNLVDVRVADS 193

Query: 254 NGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAV 313
           NG+  +S +L+ +      H +        V+ L +    +P L  AI A+  +++   +
Sbjct: 194 NGDVKLSTILQALTL-TQRHIEGTKRPSVVVIPLEVEDGNNPILTEAI-ASFDQSVPIII 251

Query: 314 AAGNENMDACYTSPADA----RRAITVGASIFSDERAFFSNWGECVDVFAPGMNV---MS 366
            AGN   DA   SPA+     +  I VG+   ++    F+N+G  VDVF  G  +    S
Sbjct: 252 PAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQS 311

Query: 367 TYIG----SDNXXXXXXXXXXXXPYTAGLIAYYLSL 398
           T +     S++              TAG+I YY+SL
Sbjct: 312 TDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  104 bits (259), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 155/337 (45%), Gaps = 30/337 (8%)

Query: 76  EKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILRGPIETLQLLRQDPIV 135
           E ELH K    F++ +    DE     + + ++ +G     +      + L+ L  D  +
Sbjct: 27  EVELH-KYTNKFLREFGINSDE-----AQVELYSVGKNFQAFSAILEQDHLRSLYNDLNI 80

Query: 136 QLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDDATSGN-VTAYVLDTG 194
             I  D ++   ++ +Q+D P  L+++ +      G ++  Y  D+T+GN V  Y+ DTG
Sbjct: 81  AAISIDRQLEPQEMIVQKDAPRHLTKLLE---TEAGDNEFVY--DSTAGNGVDIYIFDTG 135

Query: 195 IMISHEQFNGRARWGKTIVPNDV--DEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLR 252
           I  +    +         +P     D++   HGT ++G+I S  FGV K C ++ V V  
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGD 195

Query: 253 SNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFA 312
            NG+  MS VLKG+  +V  H K+ N  + SV+N S    K+  L  A D     ++  A
Sbjct: 196 ENGKVFMSKVLKGLN-LVQQHVKHTN--RPSVINFSYCTLKNAILNSAFD-NFPRDVPIA 251

Query: 313 VAAGNENMDACYTSPADARR---AITVGASIFSDE---RAFFSNWGECVDVFAPGMNVMS 366
           VAAGN     C  SP   +R    +  G+ + +D+    + FSN+G CV  +APG  +++
Sbjct: 252 VAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLT 311

Query: 367 TYI------GSDNXXXXXXXXXXXXPYTAGLIAYYLS 397
             I       S +               AG+I YY++
Sbjct: 312 FGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  100 bits (248), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 130/266 (48%), Gaps = 27/266 (10%)

Query: 152 QEDTPWGLSRISQRPRVRIGQ----DQLYYYDDATSGNVTAYVLDTGIMISHE---QFNG 204
           Q D P  L R++ +  ++  Q    +  Y + D +   V  Y++DTGI I H    Q N 
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 205 RARWGKTIVPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGE-GDMSDVL 263
                 T  P     D +GHGT +AGII SD FGV K+  +V V+V+ +N +   MS VL
Sbjct: 156 HKLIDLTTSPIP-SGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVL 214

Query: 264 KGIEFVVDDHSKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDAC 323
             +  +     K     + S++ L     K+  L  AI+  IS+ I   + AGN++ +AC
Sbjct: 215 SALSLIEKHEQKTM---RPSIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNAC 270

Query: 324 YTSPADARR---AITVGASIFSDERAF-----FSNWGECVDVFAPGMNVMSTYIGSDNXX 375
             SP   ++    + VG+  +S+E+ +     FSN+G CVD++  G+++ ST   S N  
Sbjct: 271 KLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDI-STLKTSSNGG 329

Query: 376 XXXXXXXXXXPYTAGLIA----YYLS 397
                      Y+ G++A    YY+S
Sbjct: 330 KELIHNVTGTSYSCGIVAGVVGYYMS 355

>KNAG0G02760 Chr7 (612984..613310) [327 bp, 108 aa] {ON} Anc_8.714
           YOR265W
          Length = 108

 Score = 30.8 bits (68), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 78  ELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILRGPIETLQ 127
           E+  K L+  +K +SY   E  D KS+++  +    +  Y L+  +E LQ
Sbjct: 7   EIKVKALQRLVKEHSYYQQELKDQKSHVDAMQKDPQVDSYDLKKQVEVLQ 56

>NCAS0H03100 Chr8 complement(596551..599601) [3051 bp, 1016 aa] {ON}
           Anc_2.601 YKL064W
          Length = 1016

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 58  DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSN 104
           +I KD Y + F++  ++AEK    K+ K+ + +     +E+DDH SN
Sbjct: 597 EIFKDYYFICFRSFDIVAEKHTRRKKEKDTLTSI----NERDDHSSN 639

>TBLA0B07500 Chr2 (1784284..1786653) [2370 bp, 789 aa] {ON}
           Anc_5.117 YLR047C
          Length = 789

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 392 IAYYLSLQPDKDSGYFTGEMTPSKLKEKIV 421
           IA YL +  DKDS YF+    PS+ K+KI+
Sbjct: 19  IAEYLDVSTDKDSSYFSVTKMPSEKKKKIL 48

>TBLA0G03250 Chr7 complement(861791..864367) [2577 bp, 858 aa] {ON}
           Anc_3.299 YDR052C
          Length = 858

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 38/100 (38%), Gaps = 5/100 (5%)

Query: 245 VVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKN-----YSKGSVVNLSLGASKSPALVL 299
            V+V    SN  G  +    G   V++D S NK       +  S  N ++ A  + A  L
Sbjct: 688 TVSVATTVSNAPGINTTNTNGELIVIEDRSSNKEDENEESNNTSASNKNVAAGTTTANAL 747

Query: 300 AIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGAS 339
            ID   + N+H      N N       PA A R   V  S
Sbjct: 748 PIDNNATTNLHNDTKIANNNTITEKRLPARANREPIVKNS 787

>SAKL0G06204g Chr7 complement(517155..517541,517609..517866) [645
           bp, 214 aa] {ON} similar to uniprot|Q03705 Saccharomyces
           cerevisiae YML036W Hypothetical ORFF
          Length = 214

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 233 ASDKFGVAKTCE-VVAVKVLRSNGE---GDMSDVLKGIEFVVDDHSKNKNYSK 281
           A  +FG+ +    ++ VK+L SN +   GDM DV+KG E   +D++ +  Y K
Sbjct: 90  ALKRFGIKEDSRNLICVKILESNEQFNHGDMIDVIKGDEIDFNDNNLSDLYDK 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,140,929
Number of extensions: 2159206
Number of successful extensions: 6040
Number of sequences better than 10.0: 68
Number of HSP's gapped: 6010
Number of HSP's successfully gapped: 68
Length of query: 456
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 343
Effective length of database: 40,524,141
Effective search space: 13899780363
Effective search space used: 13899780363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)