Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B06540singletonON29129115530.0
TBLA0D02380singletonON4012401954e-16
NCAS0B01970singletonON2701981323e-08
NCAS0F02730singletonON326230730.91
TBLA0C04410singletonON44855731.0
NDAI0B010207.153ON97786702.5
ZYRO0G03938g7.153ON100679702.6
NCAS0A131907.153ON104686702.7
KNAG0M011406.17ON59455703.0
Smik_9.2017.153ON99183693.4
Kwal_47.179978.53ON22040674.6
KLTH0A03080g8.53ON22840674.7
NCAS0B067502.191ON167145685.4
TPHA0N002307.17ON1232117667.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06540
         (291 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06540 Chr2 complement(1358260..1359135) [876 bp, 291 aa] {...   602   0.0  
TBLA0D02380 Chr4 (598545..599750) [1206 bp, 401 aa] {ON}               80   4e-16
NCAS0B01970 Chr2 complement(319704..320516) [813 bp, 270 aa] {ON}      55   3e-08
NCAS0F02730 Chr6 (552428..553408) [981 bp, 326 aa] {ON}                33   0.91 
TBLA0C04410 Chr3 complement(1063709..1065055) [1347 bp, 448 aa] ...    33   1.0  
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    32   2.5  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    32   2.6  
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    32   2.7  
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...    32   3.0  
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    31   3.4  
Kwal_47.17997 s47 (638896..639558) [663 bp, 220 aa] {ON} YLR052W...    30   4.6  
KLTH0A03080g Chr1 (262571..263257) [687 bp, 228 aa] {ON} weakly ...    30   4.7  
NCAS0B06750 Chr2 complement(1285302..1290317) [5016 bp, 1671 aa]...    31   5.4  
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    30   7.9  

>KAFR0B06540 Chr2 complement(1358260..1359135) [876 bp, 291 aa] {ON}
           
          Length = 291

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/291 (100%), Positives = 291/291 (100%)

Query: 1   MIHSCCHHHLISLKSCPYSKKLSVPYDLATEKYVWTNIHSANYMKYNIDFNKLSLKEYMS 60
           MIHSCCHHHLISLKSCPYSKKLSVPYDLATEKYVWTNIHSANYMKYNIDFNKLSLKEYMS
Sbjct: 1   MIHSCCHHHLISLKSCPYSKKLSVPYDLATEKYVWTNIHSANYMKYNIDFNKLSLKEYMS 60

Query: 61  NRFTNKIRDEIKKHLTVRPSLSEGTVSCVLWVNQFQQILEAFNLYNFAIFPYPAYPNIIE 120
           NRFTNKIRDEIKKHLTVRPSLSEGTVSCVLWVNQFQQILEAFNLYNFAIFPYPAYPNIIE
Sbjct: 61  NRFTNKIRDEIKKHLTVRPSLSEGTVSCVLWVNQFQQILEAFNLYNFAIFPYPAYPNIIE 120

Query: 121 EGEAYFVSKVVFPLVFPEECARGPKDGPTVKYISKNFRLLIGSLLPRKPSHRVEEILRNL 180
           EGEAYFVSKVVFPLVFPEECARGPKDGPTVKYISKNFRLLIGSLLPRKPSHRVEEILRNL
Sbjct: 121 EGEAYFVSKVVFPLVFPEECARGPKDGPTVKYISKNFRLLIGSLLPRKPSHRVEEILRNL 180

Query: 181 DLSSIESISRQYECIDILQNICTTVKVSEEYKVIRLVTALSEKFKSSIKGLARKWEKQID 240
           DLSSIESISRQYECIDILQNICTTVKVSEEYKVIRLVTALSEKFKSSIKGLARKWEKQID
Sbjct: 181 DLSSIESISRQYECIDILQNICTTVKVSEEYKVIRLVTALSEKFKSSIKGLARKWEKQID 240

Query: 241 TLTIELILDDVKCLYQTNAIRRYHDCDHDSIDEQPRKRARSHIVRRSTEHA 291
           TLTIELILDDVKCLYQTNAIRRYHDCDHDSIDEQPRKRARSHIVRRSTEHA
Sbjct: 241 TLTIELILDDVKCLYQTNAIRRYHDCDHDSIDEQPRKRARSHIVRRSTEHA 291

>TBLA0D02380 Chr4 (598545..599750) [1206 bp, 401 aa] {ON} 
          Length = 401

 Score = 79.7 bits (195), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 115/240 (47%), Gaps = 17/240 (7%)

Query: 20  KKLSVPY--DLATEKYVWTNIHSANYMKYNIDFNKLSLKEYMSNRFTNKIRDEIKKHLTV 77
           K+L VP     +T +  W+ I+S N   Y+ID+  L+ +EY+++RF +    ++K+ ++ 
Sbjct: 106 KRLPVPTIKTGSTIRKDWSGINSHNQFNYDIDYKTLTKEEYIASRFNDDTLSKMKQQISY 165

Query: 78  RPSLSEGTVSCVLWVNQFQQILEAFNLYNFAIFPYPAYPNIIEEGEAYFVSKVVFPLVFP 137
                   VS +LW   F  +L  + L        P +P II++ E   V +      + 
Sbjct: 166 AMLCKNDQVS-ILWKYVFSSLLLQYKLDQNVFNQIPLHPTIIDKCEELIVKRYFLQAAYT 224

Query: 138 EECARGPKDGPTVKYI-SKNFRLLIGSLL-PRKPSHRVEE---ILRNLDLSSIESISRQY 192
           +           +KYI S+N   +   LL P  P+H + E   + +NL+++++  I RQ 
Sbjct: 225 KR---------ELKYIYSRNIHEIFKKLLFPINPTHGLYEARTLYKNLEITTVPDIERQL 275

Query: 193 ECIDILQNICTTVKVSEEYKVIRLVTALSEKFKSSIKGLARKWEKQIDTLTIELILDDVK 252
             I++L       K S   + + +++   + F      L  KW++  + LT++L+L D++
Sbjct: 276 LIINMLNEFSNEPKFSSRQQAVTIISLFKDTFPGRFAYLFEKWDQAYEHLTLKLVLSDIE 335

>NCAS0B01970 Chr2 complement(319704..320516) [813 bp, 270 aa] {ON} 
          Length = 270

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 82/198 (41%), Gaps = 9/198 (4%)

Query: 34  VWTNIHSANYMKYNIDFNKLSLKEYMSNRFTNKIRDEIKKHLTVRPSLSEGTV-SCVLWV 92
           V   I++ NY   + D  K+SL  Y+  R T     ++   +   P+ SE ++     W 
Sbjct: 16  VLKGINAGNYQDCDFDITKISLSAYLETRVTPYFLQDVDT-IQAPPNSSECSLYEIARWY 74

Query: 93  NQFQQILEAFNLYNFAIFPYPAYPNIIEEGEAYFVSKVVFPLVFPEECAR--GPKDGPTV 150
             F+  LE  +L N   +P+P   N+I+  E   + K V P +FP E          PT+
Sbjct: 75  VTFRNFLERHDLDNCLKYPFPIEKNVIQRAEQIMIDKYVPPKMFPLEFKLYFPLSQSPTI 134

Query: 151 KYISKNFRLLIGSLLPRKPSHRVEEILRNLDLSSIESISRQYECIDILQNICTTVKVSEE 210
                   L    +LP         + R+L++     I  Q   ID+L        ++++
Sbjct: 135 -----TLELFTERVLPSTLFDMANTLFRDLNIDDPMFIRTQIRVIDLLVQYSKCRPLADD 189

Query: 211 YKVIRLVTALSEKFKSSI 228
            K   +   + +K++S I
Sbjct: 190 LKGSMIREKIIQKYQSQI 207

>NCAS0F02730 Chr6 (552428..553408) [981 bp, 326 aa] {ON} 
          Length = 326

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 44/230 (19%), Positives = 93/230 (40%), Gaps = 17/230 (7%)

Query: 34  VWTNIHSANYMKYNIDFNKLSLKEYMSNRFT----NKIRDEIK--KHLTVRPSLSEGTVS 87
           V+  I +AN+ +Y+ID+ K     Y++ R       K  D+I+  K    +   S   + 
Sbjct: 57  VFGYITAANFHQYDIDWTKFDTASYLNERLEEPRLEKFMDQIETFKFKEWQHYSSTCNID 116

Query: 88  CVLWVNQFQQILEAFNLYNFAIFPY--PAYPNIIEEGEAYFVSKVVFPLVFPEECARGPK 145
            + W   F+  +   N+  F           N +E  E+ F+   +   +FP+     P 
Sbjct: 117 FLKWYLSFESKMRLLNMATFLFDEKFDSKERNPLEVIESKFICYNILLSLFPKYYGEIPS 176

Query: 146 DGPTVKYISKNFRLLIGSLLPRKPSHRVEEILRNLDL---SSIESISRQYECIDILQNIC 202
           D       SK F  +I   LP +      +++  L +   S I+ I + Y+  + L+ + 
Sbjct: 177 D------CSKLFDKIIYRYLPGQKYELARDLVEELTISPTSDIDLIIQTYKMGNALRKLG 230

Query: 203 TTVKVSEEYKVIRLVTALSEKFKSSIKGLARKWEKQIDTLTIELILDDVK 252
               ++E+     ++         S     R+W++ +    +E +++ ++
Sbjct: 231 DLELINEQDFCHTVMIKALRSLDGSFSAAYREWKENMKEFNLEKVVELIR 280

>TBLA0C04410 Chr3 complement(1063709..1065055) [1347 bp, 448 aa]
           {ON} 
          Length = 448

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 86  VSCVLWVNQFQQILEAFNLYNFA-IFPYP-AYPNIIEEGEAYFVSKVVFPLVFPE 138
           V+ ++W N+F++ +++  LY F  + P+  A  N IE  E  F+   + P + P+
Sbjct: 191 VNLIIWYNRFKENMKSLGLYTFVYVKPFNYASANPIEINEHQFLMHFILPRILPK 245

>NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.153
           YIR002C
          Length = 977

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 12/86 (13%)

Query: 150 VKYISK---NFRLLIGSLLPRKPSHRVEEILRNLDLSSIESISRQYECIDILQNICTTVK 206
           VK+I +   ++R+L  +  P      V+E++ NLD+S IE   R  E IDI       VK
Sbjct: 224 VKFIDRFNSSYRILALTATPGSDLDSVQEVVNNLDISKIE--IRTEESIDI-------VK 274

Query: 207 VSEEYKVIRLVTALSEKFKSSIKGLA 232
             ++ + +++ T L+ + +  I+ L 
Sbjct: 275 YMKQREKVKIQTGLTTEIEDVIEQLG 300

>ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} similar
           to uniprot|P40562 YIR002C Saccharomyces cerevisiae MPH1
           Member of the DEAH family of helicases
          Length = 1006

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 150 VKYI---SKNFRLLIGSLLPRKPSHRVEEILRNLDLSSIESISRQYECIDILQ----NIC 202
           VK+I   S ++RLL  +  P      V+E+++NLD+S +E   R  E +DI++     I 
Sbjct: 224 VKFIDRFSTSYRLLALTATPGTDLESVQEVIKNLDISKVE--IRTEESMDIVKYMKRRIQ 281

Query: 203 TTVKVSEEYKVIRLVTALS 221
             ++V   ++++ +V  L 
Sbjct: 282 EKIQVEPLFEMLEIVEQLG 300

>NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]
           {ON} Anc_7.153 YIR002C
          Length = 1046

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 12/86 (13%)

Query: 150 VKYISK---NFRLLIGSLLPRKPSHRVEEILRNLDLSSIESISRQYECIDILQNICTTVK 206
           VK+I +   ++R+L  +  P      V+E++ NLD+SSIE   R  E +DI       +K
Sbjct: 225 VKFIDRFNSSYRILALTATPGSDLESVQEVVNNLDISSIE--IRTEESMDI-------IK 275

Query: 207 VSEEYKVIRLVTALSEKFKSSIKGLA 232
             ++ K  ++  AL+ + + +I+ L 
Sbjct: 276 YMKKRKQEKIQVALTTEIEDTIEQLG 301

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 106 NFAIFPYPAYPNIIEEGEAYFVSKVVFPLVFPEECARGPKDGPTVKYISKNFRLL 160
           N+ I  YP           YF    VF  VFP ECA  P + P +  + K FR+L
Sbjct: 67  NYRIVSYPVAVQSSSYARNYFRFNFVF--VFPYECATSPYE-PAITRLGKMFRVL 118

>Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON}
           YIR002C (REAL)
          Length = 991

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 150 VKYISK---NFRLLIGSLLPRKPSHRVEEILRNLDLSSIESISRQYECIDILQNICTTVK 206
           VK+I +   ++RLL  +  P      V+E++ NLD+S IE   R  E +DI++ +   +K
Sbjct: 224 VKFIDRFNSSYRLLALTATPASDLEGVQEVVNNLDISKIE--IRTEESMDIVKYMKKRIK 281

Query: 207 VSEEYKVIRLVTALSEKFKSSIK 229
              E  ++  +  + E+   +IK
Sbjct: 282 EKIEVPLLLEIEDIIEQLGIAIK 304

>Kwal_47.17997 s47 (638896..639558) [663 bp, 220 aa] {ON} YLR052W
           (IES3) - Hypothetical ORF [contig 202] FULL
          Length = 220

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 245 ELILDDVKCLYQTNAIRRYHDCDHDSIDEQPRKRARSHIV 284
           +L+  D +  Y  NAIRRY + D   +D+  + R + +I+
Sbjct: 19  KLLETDAQVKYALNAIRRYKNSDSIDVDDDRKSRHKRNII 58

>KLTH0A03080g Chr1 (262571..263257) [687 bp, 228 aa] {ON} weakly
           similar to uniprot|Q12345 Saccharomyces cerevisiae
           YLR052W IES3 Subunit of the INO80 chromatin remodeling
           complex
          Length = 228

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 245 ELILDDVKCLYQTNAIRRYHDCDHDSIDEQPRKRARSHIV 284
           EL+  D +  Y  NAIRRY   +   +D++ + R + +I+
Sbjct: 19  ELLAKDTQIRYAQNAIRRYKSSEAVDVDDERKSRHKRNII 58

>NCAS0B06750 Chr2 complement(1285302..1290317) [5016 bp, 1671 aa] {ON}
            Anc_2.191 YOR093C
          Length = 1671

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 50   FNKLSLKEYMSNRFTNKIRDEIKKHLTVRPSLSEGTVSCVLWVNQ 94
            F+K+ +K  ++ R     ++ + K  + RP +   T  CV+WVNQ
Sbjct: 1162 FSKIKIKSDLTIRI---FKNTLLKRFSYRPGVKSNTSPCVVWVNQ 1203

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 56/117 (47%), Gaps = 9/117 (7%)

Query: 53  LSLKEYMSNRFTNKIRDEIKKHLTVRPSLSEGTVSCVL--WVNQFQQILEAFN-LYNFAI 109
           L + +  ++ F N     ++ + T+     E   S ++  +++ F+Q+L  ++ + N+  
Sbjct: 340 LGVSQLSTSMFNNFEHQYLEDYCTINKDTGEVEYSQLMKCFISDFEQLLPPYDVIMNYKA 399

Query: 110 FPYPA-YPNIIEEGEAYF---VSKVVFPLVFPEECARGPKDGPTVKYISKNFRLLIG 162
           + Y + YPN+    +  F   +S ++FPL   EE   G  D        +N R+L+G
Sbjct: 400 YFYESIYPNLPFLDKELFEDTLSLILFPLDEDEEYKEGSTDSSETNV--RNVRILLG 454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,622,295
Number of extensions: 1356590
Number of successful extensions: 4307
Number of sequences better than 10.0: 28
Number of HSP's gapped: 4436
Number of HSP's successfully gapped: 28
Length of query: 291
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 182
Effective length of database: 40,982,805
Effective search space: 7458870510
Effective search space used: 7458870510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)