Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B06530singletonON53853825500.0
KNAG0G024108.318ON53045210491e-137
Suva_2.3058.318ON59752710091e-130
KAFR0H023008.318ON52151810021e-130
YLR120C (YPS1)8.318ON56952910011e-129
Smik_4.3888.318ON59750210011e-129
NCAS0C033008.318ON5594499861e-127
Skud_12.1928.318ON5695139811e-126
Smik_12.1868.318ON5725009661e-124
TPHA0A015808.318ON6004599661e-123
Suva_10.2118.318ON5664959621e-123
YDR144C (MKC7)8.318ON5964949641e-123
Kpol_543.618.318ON5884529611e-123
Kwal_26.7254singletonON5705279491e-121
Skud_4.4038.318ON5905239461e-120
TDEL0F044508.318ON5244809151e-117
Ecym_42518.318ON5024108691e-110
Smik_12.1878.319ON5074178691e-110
NDAI0G026208.318ON5904528751e-110
YLR121C (YPS3)8.319ON5084128661e-110
Skud_12.1938.319ON4974098471e-107
KLTH0G12386g8.318ON5805378531e-107
Suva_10.2128.319ON7454148641e-106
KLLA0E04049g8.318ON5895268331e-104
ZYRO0F10252gsingletonON5514888281e-103
CAGL0M04191g8.318ON6013678201e-101
NCAS0B035608.318ON5863428081e-100
KAFR0B057108.318ON5753127927e-98
ZYRO0F10318g8.319ON4864197821e-97
KNAG0E03220singletonON5404997844e-97
KNAG0I009108.318ON5695017849e-97
ZYRO0G02904gsingletonON5314437801e-96
NDAI0J010308.318ON6523567863e-96
KAFR0E03940singletonON6384477802e-95
KLTH0F06754gsingletonON7674617883e-95
AGL192W8.318ON4994617657e-95
TBLA0A039108.318ON5964857684e-94
TBLA0H012908.318ON6673707594e-92
ZYRO0F10274gsingletonON5723447501e-91
Kwal_33.14239singletonON6514777481e-90
SAKL0C02970gsingletonON5925057432e-90
TBLA0E02630singletonON6893417441e-89
SAKL0F07172g7.182ON5424087322e-89
KNAG0I01200singletonON6774287195e-86
SAKL0H15664g8.318ON5565117097e-86
Kwal_56.239028.318ON6293447024e-84
KAFR0I01700singletonON5524536965e-84
CAGL0E01771gsingletonON5194356893e-83
TBLA0D00140singletonON6075236857e-82
TPHA0C008408.318ON10004197023e-81
CAGL0E01749gsingletonON4824286645e-80
CAGL0E01793gsingletonON5164916641e-79
CAGL0E01815gsingletonON5194876613e-79
ZYRO0F10230g8.318ON5803396602e-78
KNAG0I009008.319ON5314966537e-78
CAGL0E01837gsingletonON5214326353e-75
Suva_9.13singletonON4643976242e-74
CAGL0E01859gsingletonON5054466245e-74
KAFR0B06700singletonON5314506153e-72
NCAS0A124607.182ON5404026144e-72
Suva_16.14singletonON5404036111e-71
ZYRO0E02266gsingletonON5063156038e-71
Smik_65.1singletonON3423105776e-69
YIR039C (YPS6)singletonON5374535865e-68
CAGL0E01419g8.318ON5914065826e-67
Suva_34.1singletonON3873145669e-67
CAGL0E01881gsingletonON5084295741e-66
ZYRO0F10296gsingletonON5283095577e-64
SAKL0E15356gsingletonON5574785464e-62
CAGL0E01727gsingletonON5394135421e-61
Skud_9.1547.182ON5164095392e-61
KLLA0D15917g7.182ON5114335382e-61
YIL015W (BAR1)7.182ON5873665353e-60
Smik_9.1757.182ON5934055171e-57
Smik_5.7singletonON3042414919e-57
Ecym_43947.182ON5184024884e-54
CAGL0J02288g7.182ON5414024808e-53
KNAG0H027607.182ON5634104792e-52
TDEL0H026507.182ON5523974773e-52
NDAI0B017207.182ON5473924712e-51
ZYRO0D15554g7.182ON5214114692e-51
Suva_79.1singletonON2272114098e-46
AGR240W7.182ON4523864204e-45
SAKL0H00330gsingletonON5783884116e-43
Kpol_1063.227.182ON3363033951e-42
TBLA0D045807.182ON3953703306e-33
TBLA0B038308.677ON4134322318e-20
SAKL0H06512g8.677ON4043762174e-18
Suva_9.186singletonOFF5431492179e-18
Kwal_26.88028.677ON4123512087e-17
Suva_9.1877.182ON3331442049e-17
KNAG0J017108.677ON4153912052e-16
KLTH0D11264g8.677ON4173512033e-16
ZYRO0F07392g8.677ON4183561981e-15
Smik_6.3518.677ON4053511935e-15
Skud_16.1288.677ON4053511926e-15
KAFR0H024208.677ON4163411882e-14
NCAS0C013608.677ON4063491846e-14
YPL154C (PEP4)8.677ON4053511847e-14
Ecym_23968.677ON4153711847e-14
ZYRO0A06578g5.401ON7202711832e-13
KLLA0D05929g8.677ON4093521802e-13
NDAI0E021058.677ON4083511774e-13
AGR407CsingletonON2681851734e-13
Suva_16.1568.677ON4063511741e-12
Kpol_1013.68.677ON4023531722e-12
Suva_2.5205.401ON5982351733e-12
TDEL0A062308.677ON4083521652e-11
YDR349C (YPS7)5.401ON5962481662e-11
Ecym_13245.401ON5762291652e-11
TPHA0D012608.677ON4193521633e-11
Skud_4.6185.401ON5862451643e-11
Smik_4.6135.401ON5962461634e-11
TDEL0E022305.401ON5732371625e-11
ACR144W8.677ON4083511615e-11
KLLA0F22088g5.401ON5582381616e-11
CAGL0A02431g5.401ON5873021511e-09
Kpol_1072.158.677ON3993551492e-09
ACR143WsingletonON3931781472e-09
KLTH0E02596g5.401ON5961951431e-08
Kwal_55.200345.401ON5932131421e-08
TBLA0H016805.401ON6092341403e-08
YGL258W-AsingletonON77721201e-07
TPHA0E019205.401ON6242051341e-07
KNAG0C051405.401ON5982731313e-07
SAKL0G07524g5.401ON6322151295e-07
CAGL0M02211g8.677ON4153551277e-07
KAFR0E040805.401ON5962281251e-06
NDAI0C046105.401ON6092461223e-06
NCAS0F031505.401ON6452351207e-06
ACR150W5.401ON5532531197e-06
Suva_62.1singletonON2521681114e-05
Smik_67.1singletonON110571035e-05
YGL259W (YPS5)singletonON165921022e-04
Ecym_4614na 1ON4812161045e-04
Kpol_1059.335.401ON6622441045e-04
ABL123Cna 1ON494220930.009
Smik_5.6singletonON12369820.043
SAKL0D01408gna 1ON506191810.29
KLLA0B00451gsingletonON38695760.88
KLLA0D19929gsingletonON38696732.6
Kwal_55.211873.483ON57385706.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06530
         (538 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            986   0.0  
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   408   e-137
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   393   e-130
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   390   e-130
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   390   e-129
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   390   e-129
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              384   e-127
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   382   e-126
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   376   e-124
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   376   e-123
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   375   e-123
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   375   e-123
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   374   e-123
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   370   e-121
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   369   e-120
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   357   e-117
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   339   e-110
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   339   e-110
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   341   e-110
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   338   e-110
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   330   e-107
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   333   e-107
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   337   e-106
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   325   e-104
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   323   e-103
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   320   e-101
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   315   e-100
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   309   7e-98
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   305   1e-97
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   306   4e-97
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              306   9e-97
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   305   1e-96
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             307   3e-96
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              305   2e-95
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   308   3e-95
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   299   7e-95
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   300   4e-94
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   296   4e-92
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   293   1e-91
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   292   1e-90
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   290   2e-90
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   291   1e-89
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   286   2e-89
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              281   5e-86
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   277   7e-86
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   275   4e-84
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   272   5e-84
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   270   3e-83
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                268   7e-82
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   275   3e-81
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   260   5e-80
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   260   1e-79
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   259   3e-79
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   258   2e-78
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              256   7e-78
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   249   3e-75
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   244   2e-74
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   244   5e-74
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   241   3e-72
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   241   4e-72
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   239   1e-71
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   236   8e-71
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       226   6e-69
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   230   5e-68
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   228   6e-67
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   222   9e-67
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   225   1e-66
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   219   7e-64
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   214   4e-62
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   213   1e-61
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   212   2e-61
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   211   2e-61
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   210   3e-60
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   203   1e-57
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       193   9e-57
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   192   4e-54
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   189   8e-53
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   189   2e-52
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   188   3e-52
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   186   2e-51
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   185   2e-51
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   162   8e-46
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   166   4e-45
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   162   6e-43
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   156   1e-42
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   131   6e-33
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    94   8e-20
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    88   4e-18
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    88   9e-18
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    85   7e-17
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    83   9e-17
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    84   2e-16
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    83   3e-16
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    81   1e-15
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    79   5e-15
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    79   6e-15
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    77   2e-14
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    75   6e-14
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    75   7e-14
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    75   7e-14
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    75   2e-13
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    74   2e-13
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     73   4e-13
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    71   4e-13
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    72   1e-12
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    71   2e-12
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    71   3e-12
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    68   2e-11
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    69   2e-11
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    68   2e-11
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    67   3e-11
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    68   3e-11
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    67   4e-11
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    67   5e-11
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    67   5e-11
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    67   6e-11
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    63   1e-09
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    62   2e-09
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    61   2e-09
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    60   1e-08
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    59   1e-08
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    59   3e-08
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    51   1e-07
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    56   1e-07
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    55   3e-07
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    54   5e-07
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    54   7e-07
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    53   1e-06
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    52   3e-06
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    51   7e-06
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    50   7e-06
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    47   4e-05
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        44   5e-05
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    44   2e-04
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    45   5e-04
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    45   5e-04
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...    40   0.009
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        36   0.043
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    36   0.29 
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    34   0.88 
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    33   2.6  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...    32   6.8  

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/538 (92%), Positives = 496/538 (92%)

Query: 1   MLIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINL 60
           MLIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINL
Sbjct: 1   MLIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINL 60

Query: 61  GQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTG 120
           GQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTG
Sbjct: 61  GQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTG 120

Query: 121 SNNPYCNGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGR 180
           SNNPYCNGSTFSDTVPSRELFNCSQYG                  IQYGDTTFASGTWGR
Sbjct: 121 SNNPYCNGSTFSDTVPSRELFNCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGR 180

Query: 181 DVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNA 240
           DVMSINGLNVTGLTF            LGIGLTQLETTYNGSNSSHSYTYANFPVVLKNA
Sbjct: 181 DVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNA 240

Query: 241 GLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTL 300
           GLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTL
Sbjct: 241 GLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTL 300

Query: 301 QGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCS 360
           QGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCS
Sbjct: 301 QGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCS 360

Query: 361 LRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVY 420
           LRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVY
Sbjct: 361 LRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVY 420

Query: 421 DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIFPXX 480
           DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIFP  
Sbjct: 421 DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIFPTV 480

Query: 481 XXXXXXXXXXHKGNSDASTTSSTQTKKNYGNRENPRILSSIYFLPIINLILDPLFDGL 538
                     HKGNSDASTTSSTQTKKNYGNRENPRILSSIYFLPIINLILDPLFDGL
Sbjct: 481 TSRSSTQTSTHKGNSDASTTSSTQTKKNYGNRENPRILSSIYFLPIINLILDPLFDGL 538

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  408 bits (1049), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 296/452 (65%), Gaps = 26/452 (5%)

Query: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95
           ++ ++F K +G ++  A KWQ            Q  L KR ++ Y+E+ + NQQSF+S++
Sbjct: 21  YVGMRFEKKFGDNYAGATKWQR----------PQMRLAKR-NTGYEEITLTNQQSFFSVE 69

Query: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC---NGSTFSDTVPSRELFNCSQYGXXXXX 152
           L +GTP QNVTV +DTGSSDLW+TG++NPYC   +GS  +D++P R+  +CS+YG     
Sbjct: 70  LDVGTPAQNVTVLVDTGSSDLWITGADNPYCLTYSGSG-ADSIPRRDRVDCSEYGTFSLE 128

Query: 153 XXXXXXXXXXXXX--IQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGI 210
                          I YGDTTFASG WG+D + +  +NVTG++F            +GI
Sbjct: 129 DSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVANRTNSTVGVMGI 188

Query: 211 GLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHS 270
           GL  LETT +GS     YTYANFP VLKN+G T+S  YSL+LN+L+ E GSILFGAVDHS
Sbjct: 189 GLPGLETTNSGS---RPYTYANFPQVLKNSGATQSALYSLYLNDLEEERGSILFGAVDHS 245

Query: 271 KYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK---KTTITQTKLAAILDSGT 327
           KY+G++YTLP++N  +  G+  PI+F +TLQGIG+ S      + TIT TK+ A+LDSGT
Sbjct: 246 KYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTITSTKMPALLDSGT 305

Query: 328 SLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL 387
           ++T LP  I+  IA  L    S     Y++ CS     N +LV+DFGGF I   L+N+I+
Sbjct: 306 TMTYLPSNIVSQIAQQLGASMSARFGQYVLPCS-NVPENMHLVYDFGGFHINSNLTNYIV 364

Query: 388 EIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSD--IDVIR 445
           +    +CILGL   D N+ ILGDTFL  AYVVYDLENLQI +AQAKF  S SD  ID++ 
Sbjct: 365 QASQTLCILGLFPRDSNTAILGDTFLTDAYVVYDLENLQIGLAQAKFGVSDSDAKIDIVT 424

Query: 446 GNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           G++G+PSA +AP YSSTW+ +  +++TGGNIF
Sbjct: 425 GSAGIPSAQRAPDYSSTWSTSVGTVTTGGNIF 456

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  393 bits (1009), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/527 (42%), Positives = 308/527 (58%), Gaps = 69/527 (13%)

Query: 2   LIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLG 61
           +   +  FL Y S A   ++  P ++      + ++ +QF K YG SF+ A   +     
Sbjct: 6   ITLATNAFLFYSSMANADSLASPSLAA----GDNYVRIQFQKKYGDSFENASSNKKT--- 58

Query: 62  QHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGS 121
                  ++ L KR   DY+ +++ NQ SFYS+DL IGTP Q VTV +DTGSSDLWVTGS
Sbjct: 59  -------EARLVKRGD-DYEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGS 110

Query: 122 NNPYCNGSTFSDTVPSRE------------------------------------------ 139
           NNPYC+  +   +  S+E                                          
Sbjct: 111 NNPYCSTKSGHTSSSSKERKDEDNILSLVQSVVQSVASEISYDTTITDTDATATQDSTSS 170

Query: 140 ---LFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFX 196
                +C+ YG                  I YGD TFASGTWG D +++N LNVTGL+F 
Sbjct: 171 ALQTIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFA 230

Query: 197 XXXXXXXXXXXLGIGLTQLETTYNG---SNSSHSYTYANFPVVLKNAGLTESISYSLFLN 253
                      LGIGL  LE+TY+G   S++  SYTY NFP+VLKN+G  +S +YSLFLN
Sbjct: 231 VANETNSTVGVLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLN 290

Query: 254 ELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSG-SKKT 312
           E +A+ GSILFGAVDH KYSG+LYT+P++NT +D G+ +PI+F VTLQG+G+  G S+ T
Sbjct: 291 ETNAKHGSILFGAVDHGKYSGDLYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSEST 350

Query: 313 TITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFD 372
           TIT TK+ A+LDSGT+++ +P  ++  +A  L   YS  +  YL+ C      + N+VFD
Sbjct: 351 TITTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFD 410

Query: 373 FGGFTIKGTLSNFILEIE--DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMA 430
           FGGF I G LS++ L  +   D+CILG +   +++VILGD FL++AYVVYDL+N++ISMA
Sbjct: 411 FGGFYISGNLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMA 470

Query: 431 QAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           Q      + DIDVI  +  VPSA+KAP YSSTW+ T  SI +GG+IF
Sbjct: 471 QVDLSGRSEDIDVIEDS--VPSAVKAPSYSSTWS-TDGSIVSGGDIF 514

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  390 bits (1002), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 226/518 (43%), Positives = 318/518 (61%), Gaps = 26/518 (5%)

Query: 21  MVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDY 80
           + LP+I         +++L+F K YG SF+ +  W              S L KR +  Y
Sbjct: 19  LSLPQIGGGDSKQPDYVNLKFKKTYGDSFEGSTTW--------------SALAKR-TRGY 63

Query: 81  QELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL 140
           + +++ N+Q+FYS+DL IGTP Q +TV +DTGSSDLWVTGS+NPYC  S  S+ V S   
Sbjct: 64  ELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSDNPYCV-SVKSNLVSSTNK 122

Query: 141 FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXX 200
           F+C+ YG                  I YGDT+FA GTWG+D + ++ L+V+GL+F     
Sbjct: 123 FDCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHLDDLDVSGLSFAVANV 182

Query: 201 XXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESG 260
                  LGIGL  LE TY  +   + Y Y NFP++LKN+G T S  YSL L+  +AE G
Sbjct: 183 TNSTVGVLGIGLPGLEVTYINA-PRNRYQYDNFPMILKNSGATHSNLYSLHLDHPEAEHG 241

Query: 261 SILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLA 320
           ++LFGAVDHSKY+G+LYT+PLVNT K  GF +P +F VTLQG+GIV+ + +TT+T TK+A
Sbjct: 242 TVLFGAVDHSKYTGSLYTIPLVNTLKTHGFSDPAKFEVTLQGVGIVANNTQTTLTNTKIA 301

Query: 321 AILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKG 380
           A+LDSGT+LT LP  ++  IA S+  R+S     Y+VSC    +++T LVFDFGGF I G
Sbjct: 302 ALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHING 361

Query: 381 TLSNFILEIEDDICILG-LSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFD-NST 438
            L++FI+E   ++C+L  +     NS ILGD FL +AYVV+DLEN +ISMAQA  + +  
Sbjct: 362 KLTDFIVETFGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMAQALHNVDDD 421

Query: 439 SDIDVIRGNSGVPSAIKAPGYSSTWTATPSSIST-GGNIFPXXXXXXXXXXXXH----KG 493
            DI+++  N+GV SA+ A GYSSTWTA PS+I T  G+IF                    
Sbjct: 422 QDIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAGDIFTVSAGATANYTTAKTRQSSS 481

Query: 494 NSDASTTSSTQTKKNYGNRENPRILSSIYFLPIINLIL 531
           +++++T S++  +KN  N   P   + +Y  P++  I+
Sbjct: 482 DTESNTASTSMNRKNLANMNVP--FTFLYSFPLLGSII 517

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  390 bits (1001), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/529 (44%), Positives = 313/529 (59%), Gaps = 78/529 (14%)

Query: 6   SQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNL 65
           S LF + V    LG ++     R    N+ F+ L F+KLYG S +        N+G    
Sbjct: 12  SSLFASQV----LGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLE--------NVGSDKK 59

Query: 66  NFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPY 125
              +  L KRA   Y+E+ I NQQSFYS+DL +GTP QNVTV +DTGSSDLW+ GS+NPY
Sbjct: 60  --PEVRLLKRADG-YEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPY 116

Query: 126 CN---------------------GSTFSD------------------------------T 134
           C+                     GS  +D                              +
Sbjct: 117 CSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQS 176

Query: 135 VPSREL-FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGL 193
           VP+ E   +C QYG                  I YGD TFASGT+G DV+ ++ LNVTGL
Sbjct: 177 VPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGL 236

Query: 194 TFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHS---YTYANFPVVLKNAGLTESISYSL 250
           +F            LGIGL +LE TY+GS +SHS   Y Y NFP+VLKN+G  +S +YSL
Sbjct: 237 SFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSL 296

Query: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV-SGS 309
           +LN+ DA  G+ILFGAVDHSKY+G LYT+P+VNT    GF +PI+F VT+ GIGI  SGS
Sbjct: 297 YLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGS 356

Query: 310 KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNL 369
              T+T TK+ A+LDSGT+LT LP T++  IA+ L  +YS  I  Y++ C   +S    +
Sbjct: 357 SNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDS--MEI 414

Query: 370 VFDFGGFTIKGTLSNFILEIEDDICILG-LSSVDENSVILGDTFLASAYVVYDLENLQIS 428
           VFDFGGF I   LS+FIL      C+LG + + D+   ILGD+FL +AYVVYDLENL+IS
Sbjct: 415 VFDFGGFHINAPLSSFILS-TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEIS 473

Query: 429 MAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           MAQA+++ ++ +I++I   S VPSA+KAPGY++TW +T +SI TGGNIF
Sbjct: 474 MAQARYNTTSENIEII--TSSVPSAVKAPGYTNTW-STSASIVTGGNIF 519

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  390 bits (1001), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/502 (43%), Positives = 301/502 (59%), Gaps = 63/502 (12%)

Query: 26  ISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEI 85
           IS+ S+ N+G++ + F + YG SF+ A           N    ++ L  R   DY+ +E+
Sbjct: 26  ISQSSEINDGYVKMNFQRKYGDSFESAT----------NDTKARARLVTRGD-DYELVEL 74

Query: 86  KNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC-------NGSTFS------ 132
            NQ SFYS++L IGTP Q VTV +DTGSSDLWVTGS+NPYC       +GS+F       
Sbjct: 75  TNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDN 134

Query: 133 ----------------------------DTVPSRELFNCSQYGXXXXXXXXXXXXXXXXX 164
                                       +T  + +  NC+ YG                 
Sbjct: 135 LVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEF 194

Query: 165 XIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNG--- 221
            I YGD+TFASGTWG D +S+N LNVTGL+F            LGIGL  LE+TY+G   
Sbjct: 195 SITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSL 254

Query: 222 SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPL 281
           S++  SYTY NFP++LKN+G  +S +YSLF N  D++ G+ILFGAVDH KY+G+LYT+P+
Sbjct: 255 SSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPI 314

Query: 282 VNTYKDRGFPNPIEFAVTLQGIGIVSGSKK---TTITQTKLAAILDSGTSLTVLPGTIIH 338
           +NT ++RG+ +PI+F VTLQGIG+  G +    TT+T TK+  +LDSGT+++ +P  ++ 
Sbjct: 315 INTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVE 374

Query: 339 SIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL--EIEDDICIL 396
            IAS +   YSP    Y++ C       ++L+FDFGGF I   LSNF L  +   ++CIL
Sbjct: 375 MIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCIL 434

Query: 397 GLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKA 456
           G++   + ++ILGD FL S YVVYDL+N++ISMA A F +    ID I+ +  VPSA+KA
Sbjct: 435 GIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDS--VPSALKA 492

Query: 457 PGYSSTWTATPSSISTGGNIFP 478
           PGYSSTW +T  SI  GGN+FP
Sbjct: 493 PGYSSTW-STYESIVPGGNMFP 513

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  384 bits (986), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 213/449 (47%), Positives = 284/449 (63%), Gaps = 23/449 (5%)

Query: 34  NGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYS 93
           N F++L+FNK YG  +D A           +    + EL KR  SDY+E+E+ NQQSFYS
Sbjct: 31  NKFVNLRFNKKYGDHYDTAST---------DSRKPKLELVKRDGSDYEEVELTNQQSFYS 81

Query: 94  LDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXXXX 153
           +++ +GTP Q VTV +DTGSSD WV GS+NPYC+  T      S    +CS++G      
Sbjct: 82  VEVDVGTPSQRVTVLLDTGSSDFWVMGSDNPYCSDDT------STTGIDCSEFGTFDSSS 135

Query: 154 XXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLT 213
                       I YGD +FA GTWG D +SI+ + +  L+             +G+GL 
Sbjct: 136 SSTFHNNGTAFNIHYGDGSFALGTWGTDTVSIDDITLDALSLAVANSSNSSMGVIGLGLA 195

Query: 214 QLETTYNGSN---SSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHS 270
            LETTY+ S+   S  +Y YANFP+ LKNAG+  + +YSL+LN+ +  +G+ILFGAVDHS
Sbjct: 196 GLETTYSSSHAVKSGQTYQYANFPLALKNAGIVAANAYSLYLNDPEETTGNILFGAVDHS 255

Query: 271 KYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGS-KKTTITQTKLAAILDSGTSL 329
            YSG LYT+PLVN Y   GF N +EF VTL GIGIV  S   TT++ T + A+LDSGT+L
Sbjct: 256 LYSGQLYTIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSSGSATTVSTTPIIALLDSGTTL 315

Query: 330 TVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEI 389
           T  P   +  +A+ L  +YS     Y +SC     T T LVFDFGGF I  TL++F+++ 
Sbjct: 316 TYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINATLADFVVQS 375

Query: 390 EDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNST-SDIDVIRGNS 448
               C L +   + +S ILGDTFL +AYVVYDL+NL+ISMAQAK+D S+  DI+VI  +S
Sbjct: 376 GTSTCFLSIIPQNSSSAILGDTFLNNAYVVYDLDNLEISMAQAKWDQSSDEDIEVI--SS 433

Query: 449 GVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            VPSA+KAPGYS+TW+ T  SI++GGNIF
Sbjct: 434 SVPSAVKAPGYSNTWSTT-MSITSGGNIF 461

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  382 bits (981), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/513 (44%), Positives = 312/513 (60%), Gaps = 74/513 (14%)

Query: 22  VLPEIS-RFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDY 80
           ++P  S R    N+ F+ L F+KLYG + D      D+   +      +  L KRA   Y
Sbjct: 23  IIPAASKRDDDSNSKFVKLPFHKLYGDTRD------DVGTDKK----PEVRLLKRADG-Y 71

Query: 81  QELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC-------------- 126
           +E+ I NQQSFYS+DL +GTP QNVTV +DTGSSDLW+ GSNNPYC              
Sbjct: 72  EEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYCSSGSMSSSRRRVIN 131

Query: 127 -------NGSTFSD------------------------------TVPSREL-FNCSQYGX 148
                  +G+  +D                              +VP+ E   NC ++G 
Sbjct: 132 KRDDSSSSGALVNDINPFGWLTGTGSAIGPTATGSGGGSGTATQSVPASEATMNCQEFGT 191

Query: 149 XXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXL 208
                            I YGD TFASGT+G D++ ++ LNVTGL+F            L
Sbjct: 192 FTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAVANETNSTMGVL 251

Query: 209 GIGLTQLETTYNGSNSSHS---YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFG 265
           GIGL +LE TY+GS +S S   YTY NFP+VLKN+G  ++ +YSL+LN+ DA+ G+ILFG
Sbjct: 252 GIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLNDSDAKHGTILFG 311

Query: 266 AVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGI-VSGSKKTTITQTKLAAILD 324
           AVDHSKY+G LYT+P+VNT    GF +PI+F VT+ GIGI    + + T+T T++ A+LD
Sbjct: 312 AVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKTLTTTQIPALLD 371

Query: 325 SGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSN 384
           SGT+LT LP  ++  IA  L+ +YS  +  Y++ C   NS +T +VFDFGGF I  +LS+
Sbjct: 372 SGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCP-SNSNSTQIVFDFGGFHINASLSS 430

Query: 385 FILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVI 444
           FIL    +IC+LG+ + D+ + ILGD+FL +AYVVYDL+NL+ISMAQA+++ +  +I+VI
Sbjct: 431 FILN-AGNICLLGIIATDD-TTILGDSFLTNAYVVYDLDNLEISMAQAQYNITNENIEVI 488

Query: 445 RGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
              S +PSAIKAPGY+STW +T +SI TGGNIF
Sbjct: 489 --TSSIPSAIKAPGYTSTW-STSASIVTGGNIF 518

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  376 bits (966), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/500 (44%), Positives = 305/500 (61%), Gaps = 76/500 (15%)

Query: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95
           F+ L F+KLYG S D        N+G+      ++ L+KRA   Y+E+ I NQQSFYS++
Sbjct: 41  FVKLPFHKLYGDSLD--------NVGRDKK--PEAHLFKRADG-YEEIIITNQQSFYSVE 89

Query: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDT--------------------- 134
           L +G+P QNVTV +DTGSSDLW+ GSNNPYC+  T S++                     
Sbjct: 90  LDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDI 149

Query: 135 ------------------------------VPSREL-FNCSQYGXXXXXXXXXXXXXXXX 163
                                         VP+ E   +C +YG                
Sbjct: 150 NPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNNTY 209

Query: 164 XXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSN 223
             I YGD TFASGT+G DV+ ++ LNVTGL+F            LGIGL +LE TY+GS 
Sbjct: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269

Query: 224 SSHS---YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLP 280
           +S     + Y NFP+VLKN+G  ++ +YSL+LN+ DAE G+ILFGAVDHSKY+G LYT+P
Sbjct: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIP 329

Query: 281 LVNTYKDRGFPNPIEFAVTLQGIGIVSGSK--KTTITQTKLAAILDSGTSLTVLPGTIIH 338
           +VNT    GF +PI+F VT+ GIG VS SK  + T+T TK+ A+LDSGT+LT LP T++ 
Sbjct: 330 IVNTLSASGFSSPIQFDVTINGIG-VSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVA 388

Query: 339 SIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGL 398
            IA  +  +YS  +  Y++ C   +S  T +VFDFGGF I  +LS+FIL      C+LG+
Sbjct: 389 LIADEIGAQYSYRLGYYVLDCPSDDS--TQIVFDFGGFHINASLSSFILS-TGSTCLLGI 445

Query: 399 SSVDENS-VILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAP 457
               +N+  ILGD+FL +AYVVYDL+NL+ISMAQA+++ +T +I+VI  +S +PSA+KAP
Sbjct: 446 IPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVI--SSSIPSAVKAP 503

Query: 458 GYSSTWTATPSSISTGGNIF 477
           GY++TW +T ++I TGGNIF
Sbjct: 504 GYTNTW-STSATIVTGGNIF 522

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  376 bits (966), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/459 (46%), Positives = 295/459 (64%), Gaps = 21/459 (4%)

Query: 24  PEIS-RFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQE 82
           P+++ R     + F+  +F+K YG S+  + K           N  + ++ KR    Y+E
Sbjct: 31  PQLTKRDGSEIDNFIKFKFDKSYGDSYKNSSKR----------NKPKLDIVKR--DGYEE 78

Query: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC--NGSTFSDTV-PSRE 139
           +E+KN+ SFYS+ L IGTP QNVTV IDTGSSDLWVTGS+NP C  + +TF+ +   S+ 
Sbjct: 79  IELKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSSDDATFTGSDGSSQS 138

Query: 140 LFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXX 199
             +CS YG                  I YGD ++A G WG+DV+S+  ++VTGL+F    
Sbjct: 139 SIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQDIDVTGLSFAVAN 198

Query: 200 XXXXXXXXLGIGLTQLETTYNGS-NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAE 258
                   LGIGL  LE TY+GS   S+ Y Y N P+VL+N+G  +S +YSLFLN+ D+ 
Sbjct: 199 YTNSTVGVLGIGLPSLEATYSGSLAGSNPYQYDNLPLVLRNSGAVKSYAYSLFLNDEDSS 258

Query: 259 SGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTK 318
            GSILFG VDHSKY G L TLPLVN  K  GF +P EF +TLQG+GI + SK TT++ T+
Sbjct: 259 EGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTSSKNTTVSDTQ 318

Query: 319 LAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTI 378
           + A+LDSGT+LT LP T+   +A+ LN  YS  +  Y +SC   +S +T +VFDFGGF I
Sbjct: 319 IVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCP-SSSDSTEIVFDFGGFHI 377

Query: 379 KGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNST 438
              L++FI+    ++CILG+     +  ILGD+FL  AYVVYDLENL+IS+AQAK+ +S+
Sbjct: 378 NVPLTSFIVTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDLENLEISLAQAKYGSSS 437

Query: 439 SDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            DI+ I   S VPSA++A  YS+TW +T ++I++GG+IF
Sbjct: 438 EDIEAIV--SSVPSAVRAASYSNTW-STAATINSGGDIF 473

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  375 bits (962), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/495 (44%), Positives = 304/495 (61%), Gaps = 71/495 (14%)

Query: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95
           F+ L F+KLYG S D A + +            +  L KRA   Y+E+ I NQQSFYS+D
Sbjct: 39  FVKLSFDKLYGDSLDTAGRDKK----------PEVRLSKRADG-YEEIIITNQQSFYSVD 87

Query: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGS-------------------------- 129
           L +GTP QN+TV +DTGSSDLW+ GS+NPYC+                            
Sbjct: 88  LEVGTPAQNITVLVDTGSSDLWIMGSSNPYCSSDDSSKYVLRKRDTSSSSGDLVNDINPF 147

Query: 130 --------------------TFSDTVPSREL-FNCSQYGXXXXXXXXXXXXXXXXXXIQY 168
                               T + +VP+ E   +C +YG                  I Y
Sbjct: 148 GWLTETGSVTGATATATGSGTATQSVPASEATMDCEEYGTFTSSDSSTFKSNNTAFEISY 207

Query: 169 GDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSH-- 226
           GD TFA+GT+G DV++++ LNVTGL+F            LGIGL  LE TY+GS++S+  
Sbjct: 208 GDGTFAAGTFGTDVLNLSDLNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSASNGG 267

Query: 227 -SYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTY 285
            SY Y NFP+VLKN+G  +S +YSL+LN+ DA+ G+ILFG VDH+KYSG LYT+ LVNT 
Sbjct: 268 KSYKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGGVDHNKYSGTLYTVALVNTL 327

Query: 286 KDRGFPNPIEFAVTLQGIGIV--SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASS 343
              GF +PI+F +TL G+GI+  +G +K T+T TK+  +LDSGT+LT LP  ++  IA +
Sbjct: 328 S--GFTSPIQFDITLNGLGIIDDNGDEK-TLTTTKIPVLLDSGTTLTYLPVEMVELIAEN 384

Query: 344 LNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILG-LSSVD 402
           +  +YS  I  Y++ C   +++ T +VFDFGGF I  +LS+FIL    + C+LG + + D
Sbjct: 385 VGAQYSSRIGYYVMECPSSDNS-TEIVFDFGGFHINASLSSFILSTSGNTCLLGIIPTSD 443

Query: 403 ENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSST 462
               ILGD+FL +AYVVYDLENL+ISMAQAK++ ++ DI+VI  ++ VP+A+KAPGY++T
Sbjct: 444 STGSILGDSFLTNAYVVYDLENLEISMAQAKYNVTSEDIEVI--STSVPNAVKAPGYTNT 501

Query: 463 WTATPSSISTGGNIF 477
           W+ T +SI+TGGNIF
Sbjct: 502 WSTT-ASIATGGNIF 515

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  375 bits (964), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/494 (42%), Positives = 294/494 (59%), Gaps = 63/494 (12%)

Query: 33  NNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFY 92
           N  ++ + F K YG+SF+ A    D   G+  L  +          DY+ +E+ NQ SFY
Sbjct: 33  NEVYVKMNFQKKYGSSFENA---LDDTKGRTRLMTRDD--------DYELVELTNQNSFY 81

Query: 93  SLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG------------------------ 128
           S++L IGTP Q VTV +DTGSSDLWVTGS+NPYC+                         
Sbjct: 82  SVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTKKKDTTGSSFKQVNKDALASVVES 141

Query: 129 -----------------STFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDT 171
                            +TF  T  + +L +C+ YG                  I YGDT
Sbjct: 142 VFTEISYDTTIVTSEATATFDSTASTSQLIDCATYGTFNTSKSSTFNSNNTEFSIAYGDT 201

Query: 172 TFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNG---SNSSHSY 228
           TFASGTWG D +S+N LN+TGL+F            LGIGL  LE+TY+G   S+   SY
Sbjct: 202 TFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSY 261

Query: 229 TYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDR 288
           TY NFP+VLKN+G+ +S +YSLF N+ D++ G+ILFGAVDH KY+G+LYT+P++NT + R
Sbjct: 262 TYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQHR 321

Query: 289 GFPNPIEFAVTLQGIGIVSGSKK---TTITQTKLAAILDSGTSLTVLPGTIIHSIASSLN 345
           G+ +PI+F VTLQG+G   G K+   TT+T TK+  +LDSGT+++ +P  ++  +A  + 
Sbjct: 322 GYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGTTISYMPTELVKMLADQVG 381

Query: 346 GRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF--ILEIEDDICILGLSSVDE 403
             YS     Y++ C       ++++FDFGGF +   LS+F  + +   +ICILG++   +
Sbjct: 382 ATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQLVTDSRSNICILGIAPQSD 441

Query: 404 NSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTW 463
            ++ILGD FLA+ YVVYDL+N++ISMAQA F +    I++I   S VPSA+KAPGYSSTW
Sbjct: 442 PTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEIIE--SAVPSALKAPGYSSTW 499

Query: 464 TATPSSISTGGNIF 477
            +T  SI +GGN+F
Sbjct: 500 -STYESIVSGGNMF 512

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  374 bits (961), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 288/452 (63%), Gaps = 25/452 (5%)

Query: 30  SQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQ 89
           S  + GF+   F+KL G SF+ A           N N + + + KR  +  +E+EI NQ 
Sbjct: 58  SNESQGFVRYHFDKLVGDSFENAS----------NKNKRYANIVKR-DNGVEEVEIMNQS 106

Query: 90  SFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCN-GSTFSDTVPSRELFNCSQYGX 148
           +FYS+ L IG+  QNVTV +DTGSSDLWVTGSNNP C+ G + SD V      +C+++G 
Sbjct: 107 NFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLCSRGDSNSDAV------DCAKFGT 160

Query: 149 XXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXL 208
                            I Y D+++ASGTWG+D + +  L+VTGL+F            L
Sbjct: 161 FNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGLSFAVANYTNSTVGVL 220

Query: 209 GIGLTQLETTYNGSN--SSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGA 266
           GIGL  LE TY+GSN  +   Y Y NFP++LKN+G T++ +YSL+LN+LD+ +GS+LFG 
Sbjct: 221 GIGLPSLEVTYSGSNNVAGTRYQYENFPLLLKNSGATKANAYSLYLNDLDSRTGSVLFGG 280

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK-KTTITQTKLAAILDS 325
           VDH+KYSG LYT+PLVNT +  GF  P+EF VTLQG+GI        T+T TK+ A+LDS
Sbjct: 281 VDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQGMGISDDEHGNVTLTTTKIPALLDS 340

Query: 326 GTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF 385
           GT+L  LP  ++  IA   +  Y+     Y+++C   +  ++ +VFDFGGF I   L+ +
Sbjct: 341 GTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCP-DSDEDSQIVFDFGGFHISTNLTTY 399

Query: 386 ILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIR 445
           I++    IC+LG+      + ILGD+FL  AYVVYDL+NL+ISMAQA F+    +++VI 
Sbjct: 400 IIQAVGGICVLGILPQSSGTAILGDSFLQHAYVVYDLDNLEISMAQASFETDDENVEVI- 458

Query: 446 GNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            +S +PSA+KAPGYSSTW+ T SSIS+GGNIF
Sbjct: 459 -SSSIPSAVKAPGYSSTWS-TFSSISSGGNIF 488

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  370 bits (949), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/527 (42%), Positives = 300/527 (56%), Gaps = 67/527 (12%)

Query: 1   MLIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINL 60
           M    S  FLA     +   + L EI    Q  + ++ + F+KL G   D A   +D  +
Sbjct: 1   MKFSASAAFLAISGLVSSTAVSLQEIE--PQDVSKYVRISFDKLRG---DTA---EDARV 52

Query: 61  GQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTG 120
           G       ++EL KRA    + ++IKNQ +FYS+++ +G+P QNVT+ IDTGSSD+WV G
Sbjct: 53  GL----MPRAELVKRADGS-ETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMG 107

Query: 121 SNNPYCNGSTFS--------------DTV--------------------------PSR-- 138
           SNNP+C GS+ S              +TV                          PSR  
Sbjct: 108 SNNPFCEGSSRSSKHVLLGENIGLEDETVKKDFFSSFRSLLTATATSTVSASAVAPSRTS 167

Query: 139 -----ELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGL 193
                   +CS YG                  IQYGD T+A GTWG D +++  + V+ L
Sbjct: 168 VAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTYALGTWGHDDVTLQDITVSDL 227

Query: 194 TFXXXXXXXXXXXXLGIGLTQLETTYNGS---NSSHSYTYANFPVVLKNAGLTESISYSL 250
           +             LGIGLT LE T  GS   +S  +YTY N P +L + G     +YSL
Sbjct: 228 SMAVANESNSTFGVLGIGLTGLEVTNVGSLVSSSRSAYTYQNLPALLVDQGKIHQNAYSL 287

Query: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK 310
           FL++LDAE GS+LFGAVDHSKY+GNLYT+PLVN YK  GFP+PI+  VTLQG+G+ +   
Sbjct: 288 FLDDLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSANKT 347

Query: 311 KTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLV 370
             T T T + A+LDSGT+LT LP +++ SIA  L+ +YS  +  Y++ CS   S +  LV
Sbjct: 348 NITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQYSYDVGYYVLECS-EVSDSDELV 406

Query: 371 FDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMA 430
           FDFGGF IK  L NF+++   + C LGL     +  ILGD FL +AYVVYDLENL++SMA
Sbjct: 407 FDFGGFHIKSKLQNFLIKASSNFCALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVSMA 466

Query: 431 QAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           QA +D  + DI+VI  +S +P A+KAPGYSSTW++    ISTGGNIF
Sbjct: 467 QANYDGGSEDIEVI--SSTIPGAVKAPGYSSTWSSRI-PISTGGNIF 510

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  369 bits (946), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/523 (41%), Positives = 298/523 (56%), Gaps = 67/523 (12%)

Query: 4   FTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQH 63
           F +  FL Y ST +  ++    I+     +  ++ + F K YG SF+ A    D N G H
Sbjct: 8   FVANAFLLYSSTVSADSIASASIAT----SESYVIMNFEKKYGDSFENAS--NDRNAGAH 61

Query: 64  NLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNN 123
            +         R   DY+ +++ N+ SFYS++L IGTP Q +TV +DTGSSDLWVTGSNN
Sbjct: 62  LV---------RREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNN 112

Query: 124 PYCNG-----------------------------------------STFSDTVPSRELFN 142
           PYC+                                          +T  +T  + +  N
Sbjct: 113 PYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKIN 172

Query: 143 CSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXX 202
           C  YG                  I YGD+TFASGTWG D +++N LNVTGL+F       
Sbjct: 173 CGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETN 232

Query: 203 XXXXXLGIGLTQLETTYNG---SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES 259
                LGIGL  LE+TY+G   S+   SYTY NFP+VLKN+G  +S +YSLF N+ ++E 
Sbjct: 233 STVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEH 292

Query: 260 GSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSG---SKKTTITQ 316
           G+ILFGAVDH KY+G+LYT+P++N  ++ G+ +PI+F VTLQGI + +G      TT+T 
Sbjct: 293 GTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTT 352

Query: 317 TKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGF 376
           TK+ A+LDSGT+++ LP  ++  +A  +   YS     Y+++C      +  +VFDFGGF
Sbjct: 353 TKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGF 412

Query: 377 TIKGTLSNFIL--EIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKF 434
            I   LSNF L  +   D+CILG +   + +VILGD FL S Y+VYDL+N++ISMA A F
Sbjct: 413 HISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADF 472

Query: 435 DNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            ++   IDVI   S VPSA+KAP YS+TW +T  SI  GGNIF
Sbjct: 473 SDNDEYIDVIE--SAVPSALKAPNYSNTW-STYESIVPGGNIF 512

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  357 bits (915), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/480 (43%), Positives = 277/480 (57%), Gaps = 43/480 (8%)

Query: 11  AYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQS 70
           A +S   LG+  +  +S   +    ++ L F+KL G S++ A K           N   +
Sbjct: 7   ALISGFLLGSQAV-ALSDVDEKPGKYVHLSFDKLRGNSYEEAGKG----------NKPSA 55

Query: 71  ELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGST 130
           EL KR    Y+E+EI N+Q+FYS++L IGTP QNVTV +DTGSSDLWV+   NPYC  S 
Sbjct: 56  ELRKR-DDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDS- 113

Query: 131 FSDTVPSREL----------------------FNCSQYGXXXXXXXXXXXXXXXXXXIQY 168
             DT P  +L                       +CS+YG                  I Y
Sbjct: 114 -DDTKPVTQLSTSTLATSSGTATSSGNSGIATVDCSEYGTFDPSKSTSFRSNNTAFSISY 172

Query: 169 GDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHS- 227
           GDTTFASGTWG D   +  LNVT L+F            +GIGL  L++TY G NS+ S 
Sbjct: 173 GDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG 232

Query: 228 -YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYK 286
            Y Y NFP+ LK+ G+ +  +YSLFLNE DA+ GS+LFGAVDHSKYSG LYT+P++N Y+
Sbjct: 233 AYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYR 292

Query: 287 DRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNG 346
           +RG  NPIEF VT+QG+ + SGS    +T T+  A+LDSGT+L+ +P T+   IA ++  
Sbjct: 293 NRGIQNPIEFDVTVQGVSVTSGSTIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGA 352

Query: 347 RYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTI--KGTLSNFILEIEDDICILGLSSVDEN 404
           +YS     Y + C   N+ +T L FDFGGF I    +            C LG+  +  N
Sbjct: 353 QYSQYTGYYSMRCPSENN-DTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSN 411

Query: 405 SVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464
           + I GD FL  AYVVYDLEN +ISMAQA F+NS S I+VI  +  +PSA++A GYSSTW+
Sbjct: 412 AAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVI--SDSIPSAVRAQGYSSTWS 469

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  339 bits (869), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 254/410 (61%), Gaps = 14/410 (3%)

Query: 71  ELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGST 130
           EL KR   +Y +++I N+Q+FYS++L IGTP Q VTV +DTGSSDLW+ G++   C    
Sbjct: 56  ELKKR-DDEYVDVKIHNEQTFYSVNLSIGTPAQEVTVLVDTGSSDLWIIGADVD-CG--- 110

Query: 131 FSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNV 190
             D   S E  +C +YG                  I YGDT+FASG WG D + +  LN 
Sbjct: 111 -PDNSDSTEPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNA 169

Query: 191 TGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSL 250
            GLTF            LGIGLT +E T   ++  + Y Y N P+VLK  G+ +  +YSL
Sbjct: 170 DGLTFAVATASNSSVAVLGIGLTGIEVTR--ASGDNGYEYDNLPIVLKRNGVIDKTAYSL 227

Query: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK 310
           +LN+LDA SGS+LFGAVDHSKY+G L T+PLVN     GFP PIE  +TL G+G  SG K
Sbjct: 228 YLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKK 287

Query: 311 KTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLV 370
           + TI+ TK+ A+LDSGT+L+  P  +  +IAS++   ++  +  +L+ CS     N +L+
Sbjct: 288 RGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDLI 347

Query: 371 FDFGGFTIKGTLSNFILEIE-DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISM 429
           ++FGG  I   L N++ E   +D+C+LG+     N +ILGD FL S Y VYDLE L++S+
Sbjct: 348 YNFGGVEITSPLVNYLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVYDLEALEVSI 407

Query: 430 AQAKFDNST--SDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           AQA +  S    +I+VI+  S VP A KAPGYS+TW+ T + ISTGGN+F
Sbjct: 408 AQAAYGASAEKENIEVIK--STVPGATKAPGYSNTWS-TYAPISTGGNMF 454

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  339 bits (869), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 256/417 (61%), Gaps = 21/417 (5%)

Query: 66  NFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPY 125
           N + S L KR SS ++   + N+QSFYS++L IGTP QN+TV +DTGS+DLWV G  NPY
Sbjct: 38  NSESSVLSKR-SSGHENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPY 96

Query: 126 CNGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXX-XIQYGDTTFASGTWGRDVMS 184
           C             + +C QYG                     YGD TFA G +G+D + 
Sbjct: 97  CG-----------SVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLK 145

Query: 185 INGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNS---SHSYTYANFPVVLKNAG 241
            N L+++GL F            LGIGL+ LE TY+G  +     SY Y NFP+ LK++G
Sbjct: 146 YNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSG 205

Query: 242 LTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQ 301
             ++ +YSLFLN+    SGSILFGAVDHSKY G LYT+PLVN YK +G+ +P+ F VTLQ
Sbjct: 206 AIDATAYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQ 265

Query: 302 GIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSL 361
           G+G+ +  + TT+T TK  A+LDSGT+LT LP   +  +A SLN  YS  +  Y  +C  
Sbjct: 266 GLGLQTDKRNTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCP- 324

Query: 362 RNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS-VILGDTFLASAYVVY 420
            +   T++ FDFGGF I   LS+F ++     C L L     N+  ILGD+FL +AYVVY
Sbjct: 325 SSDNKTSIAFDFGGFRINAPLSDFTMQTSVGTCALALIPQAGNATAILGDSFLRNAYVVY 384

Query: 421 DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           DL+N +IS+AQAK+  +  +I+ I+  S VP A +AP Y++TW+ T +S+++GGNIF
Sbjct: 385 DLDNYEISLAQAKYGKAKENIEAIK--STVPGATRAPSYNNTWS-TYASVTSGGNIF 438

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  341 bits (875), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/452 (43%), Positives = 281/452 (62%), Gaps = 28/452 (6%)

Query: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95
           +L L F K YG SF          L   + N   ++L KR    Y+++ + NQQSFYS++
Sbjct: 33  YLALNFEKRYGDSF----------LNSSSSNGPSAQLIKR-DDGYEQVTLTNQQSFYSVE 81

Query: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTV---PSRELFNCSQYGXXXXX 152
           + +GTP Q +TV +DTGSSD WVT S+NPYC  ++   ++    +++  +CS YG     
Sbjct: 82  VEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTTSTEGSLYGGETQDTIDCSTYGTFDSS 141

Query: 153 XXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSIN-GLNVTGLTFXXXXXXXXXXXXLGIG 211
                        I YGD +FA GTWG DV+ ++  L++  ++             LGIG
Sbjct: 142 KSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIG 201

Query: 212 LTQLETTYNGS---NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVD 268
           L  LETTY+ +   N   SY Y NFP+ LK +GL ES +YSL+LN+  ++SG+ILFG VD
Sbjct: 202 LRPLETTYSSTKSVNEKTSYMYDNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGGVD 261

Query: 269 HSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV--SGSKKTTITQTKLAAILDSG 326
           HSKY+G LYT+P++++     +  P+EF VTL GIGI+  SG+KK T+T T+   +LDSG
Sbjct: 262 HSKYTGQLYTVPMLSS--TTSYKTPVEFDVTLNGIGIIDSSGNKK-TLTATQFYGLLDSG 318

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           T+ + LP  ++  I   L   Y   I  Y + CS  +S +T +VFD GGF I  TLS+F+
Sbjct: 319 TTFSYLPSALVAMIGEELGASYDSNIGYYTIDCSAEDSDDTKIVFDMGGFHINTTLSDFV 378

Query: 387 LEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNS-TSDIDVIR 445
           ++I    CIL +   D   V+LGD+FL +AY+VYDL+N +I+MAQA +D++  ++IDVI 
Sbjct: 379 IQISTSTCILSIVPQD-GKVVLGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANIDVI- 436

Query: 446 GNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            ++ +PSAI+APGYSSTW +T  SIS+GG+IF
Sbjct: 437 -STTIPSAIRAPGYSSTW-STSRSISSGGDIF 466

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  338 bits (866), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 185/412 (44%), Positives = 256/412 (62%), Gaps = 21/412 (5%)

Query: 71  ELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGST 130
           EL KR S+ +++  + N+QSFYS++L IGTP QN+TV +DTGS+DLWV G  NPYC    
Sbjct: 43  ELSKR-SNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCG--- 98

Query: 131 FSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXX-XIQYGDTTFASGTWGRDVMSINGLN 189
                    + +C QYG                     YGD T+A G +G+D +  N L+
Sbjct: 99  --------SVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELD 150

Query: 190 VTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNS---SHSYTYANFPVVLKNAGLTESI 246
           ++GL+F            LGIGL+ LE TY+G  +     SY Y NFP+ LK++G  ++ 
Sbjct: 151 LSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDAT 210

Query: 247 SYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV 306
           +YSLFLN+    SGSILFGAVDHSKY G LYT+PLVN YK +G+ +P+ F VTLQG+G+ 
Sbjct: 211 AYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQ 270

Query: 307 SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTN 366
           +  +  T+T TKL A+LDSGT+LT LP   +  +A SLN  YS  +  Y  +C   +   
Sbjct: 271 TDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCP-SSDNK 329

Query: 367 TNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS-VILGDTFLASAYVVYDLENL 425
           T++ FDFGGF I   LS+F ++     C+L +     N+  ILGD+FL +AYVVYDL+N 
Sbjct: 330 TSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNY 389

Query: 426 QISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           +IS+AQAK+     +++VI+  S VPSAI+AP Y++TW+   S+ S GGNIF
Sbjct: 390 EISLAQAKYGTGKENVEVIK--STVPSAIRAPSYNNTWSNYASATS-GGNIF 438

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 179/409 (43%), Positives = 252/409 (61%), Gaps = 21/409 (5%)

Query: 75  RASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDT 134
           + S+ +++  + N+QSFYS++L IGTP Q++TV +DTGS+DLWV    NPYC        
Sbjct: 46  KRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCG------- 98

Query: 135 VPSRELFNCSQYGXXXXXXXXXXXXXXXXX-XIQYGDTTFASGTWGRDVMSINGLNVTGL 193
                + +C QYG                     YGD TFA G +G+D +  NGL+++GL
Sbjct: 99  ----SVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGL 154

Query: 194 TFXXXXXXXXXXXXLGIGLTQLETTYNGSNS---SHSYTYANFPVVLKNAGLTESISYSL 250
           +F            LGIGL  LE TY+G  +     SY Y NFP+ LK +G  ++ +YSL
Sbjct: 155 SFAVANESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSL 214

Query: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK 310
           FLN+    SGSILFGAVDHSKY G LYT+PLVN Y+ +G+ +P+ F VTL GIG+ +   
Sbjct: 215 FLNDESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRH 274

Query: 311 KTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLV 370
            TT+T TK+ A+LDSGT+LT LP   +  +A SLN  YS  +  Y  +C   +  +T++ 
Sbjct: 275 NTTLTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACP-SSDNDTSVA 333

Query: 371 FDFGGFTIKGTLSNFILEIE-DDICILGLSSVDENS-VILGDTFLASAYVVYDLENLQIS 428
           FDFGGF I   +S+F ++      C+L +     N+  ILGD+FL +AYVVYDL+N ++S
Sbjct: 334 FDFGGFHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVS 393

Query: 429 MAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           +AQAK+     DI+ I+  S VPSA +APGY+STW+   +S+++GGNIF
Sbjct: 394 LAQAKYGTGAEDIEAIK--STVPSATRAPGYNSTWS-NYASVTSGGNIF 439

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  333 bits (853), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 215/537 (40%), Positives = 293/537 (54%), Gaps = 77/537 (14%)

Query: 1   MLIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINL 60
           M + ++  FLA    A+    V+      +Q  + F+ + F+KL G   D A   +D   
Sbjct: 1   MKLLSTSTFLAACGLASAA--VVSSRDEGAQSASKFVKVSFDKLRG---DTA---EDATA 52

Query: 61  GQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTG 120
           G          L KRA    + + IKNQQ+FYS++L +G+P QNVT+ IDTGSSD+WV G
Sbjct: 53  GA----VAHGVLAKRADGS-ETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMG 107

Query: 121 SNNPYCNGSTFSDT---------------------------------------------- 134
           SNNPYC G +  ++                                              
Sbjct: 108 SNNPYCEGGSSGNSKHVLLGDHVDSRDEEVNRDWFSTLRSFLTATATATATATATATGSA 167

Query: 135 -----VPSRELFN-------CSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDV 182
                 PSR   N       CS YG                  I+YGD+T+A GTWGRD 
Sbjct: 168 DSGGNAPSRTSVNSQYATLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDN 227

Query: 183 MSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNG--SNSSHSYTYANFPVVLKNA 240
           +++  + ++G++             LGIGL  LE T  G  +   +SYTY N P  + + 
Sbjct: 228 VTLQDITLSGISMAVANESNSTFGVLGIGLAALEVTNVGTLATRGNSYTYENLPAKMVSE 287

Query: 241 GLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTL 300
           G+    +YSLFL+ LDA+ GS+LFGAVDHSKY+G+LYTLPL N+YK  G+ +PI+  VTL
Sbjct: 288 GIIHKNAYSLFLDSLDAKEGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTL 347

Query: 301 QGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCS 360
           QG G+ + +  +T T T L A+LDSGT+LT LP T++  +A+    RY      YL+SCS
Sbjct: 348 QGFGMTANNTNSTFTTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCS 407

Query: 361 LRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVY 420
               T+  LVFDFGGF I   + NF++    +IC LGL     +S+ILGD FL +AYVVY
Sbjct: 408 DVKDTD-ELVFDFGGFHINSKVENFLIRATSNICALGLIPQSSSSLILGDNFLTAAYVVY 466

Query: 421 DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           DL+NL+IS+AQA +D  +S+I+VI  +S VPSA+K P YSSTW+ T   ISTGGNIF
Sbjct: 467 DLDNLEISLAQANYDGGSSNIEVI--SSSVPSAVKGPSYSSTWS-TSVPISTGGNIF 520

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  337 bits (864), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/414 (44%), Positives = 253/414 (61%), Gaps = 21/414 (5%)

Query: 70  SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGS 129
           SEL KRA  D +   + N+QSFYS++L +GTP QNVTV +DTGS+DLWV  + NPYC  +
Sbjct: 43  SELGKRAGGD-ENFVLSNEQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNANPYCGSA 101

Query: 130 TFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXX-XIQYGDTTFASGTWGRDVMSING- 187
                       NC QYG                     YGD TFA G +G+D +  +G 
Sbjct: 102 -----------MNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGG 150

Query: 188 LNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNS---SHSYTYANFPVVLKNAGLTE 244
           L+++GL+F            LGIGL  LE TY+G  +     SY Y NFP+ LK +G  +
Sbjct: 151 LDLSGLSFAVANKSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAID 210

Query: 245 SISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIG 304
           + +YSLFLN+    SGS+LFGAVDHSKY G LYT+PLVN YK +G+  P+ F VTLQG+G
Sbjct: 211 ATAYSLFLNDETQTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLG 270

Query: 305 IVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNS 364
           + + +  TT+T T++ A+LDSGT+LT LP   +  +A SLN  +S  +  Y  +C     
Sbjct: 271 LQTRAHNTTLTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGD 330

Query: 365 TNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS-VILGDTFLASAYVVYDLE 423
             T++VFD GGF I   LS+F ++     C+L +     N+  ILGD+FL SAYVVYDL+
Sbjct: 331 NATSVVFDLGGFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLD 390

Query: 424 NLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           N ++S+AQAK+ +   DI+ IR  S VP A +APGY+STW    +S+++GGNIF
Sbjct: 391 NYEVSLAQAKYGSGKEDIEAIR--SSVPGATRAPGYNSTWV-NYASVTSGGNIF 441

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  325 bits (833), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 205/526 (38%), Positives = 286/526 (54%), Gaps = 77/526 (14%)

Query: 13  VSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSEL 72
            S  + G +   ++S+  + N   + + F+KL G            +  + +L+ ++   
Sbjct: 13  ASLGSAGYITKRDVSQVGEANKKHVFMSFDKLRGN-----------DASEASLSKRRVGH 61

Query: 73  YKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC------ 126
            K+ +  Y ++EI NQ +FYS+DL IGTP Q V V IDTGSSDLWV GS NP+C      
Sbjct: 62  LKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFCSASRSS 121

Query: 127 -----------------------------------NGSTFSDTVP--------------- 136
                                               GS  + TVP               
Sbjct: 122 SKKKRQDYTALLSSLLSVFGTDVATDYTYTGIASATGSAGTQTVPTALTSGTVAATSIRS 181

Query: 137 ---SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGL 193
              S    +CS++G                  I Y D TFA G WG D + ++ +NVTGL
Sbjct: 182 VPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDVNVTGL 241

Query: 194 TFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHS-YTYANFPVVLKNAGLTESISYSLFL 252
           +F            LGIGLT  E+TY+G  S+++ Y Y NFP+VL+  G+ E  +YS+FL
Sbjct: 242 SFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNRYQYDNFPIVLQRNGVIEKNAYSVFL 301

Query: 253 NELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKT 312
           N+LDA+SGSILFGAVDHSKY+G LYT+P+VN  +  G+   I  ++TLQGIG+ S     
Sbjct: 302 NDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTSSYGNE 361

Query: 313 TITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFD 372
           T+TQTK  A+LD+G +    P ++  +IASS++  YS     Y V C   + ++ +LVFD
Sbjct: 362 TVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCD--SGSDYDLVFD 419

Query: 373 FGGFTIKGTLSNFILEI-EDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQ 431
           FGGF I   LS++I+       C+LG+    +N + LGD FL SAYVVYDLE L+IS+AQ
Sbjct: 420 FGGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDLEELEISLAQ 479

Query: 432 AKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           A + +    I+VIR +  VPSA+ APGYSSTW+ T +S+STGGNIF
Sbjct: 480 ASYTSGDEKIEVIRDS--VPSAVAAPGYSSTWS-TAASLSTGGNIF 522

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  323 bits (828), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 203/488 (41%), Positives = 274/488 (56%), Gaps = 60/488 (12%)

Query: 1   MLIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINL 60
           M   TS +    +STA+ G +V P + +          L FNKL G +F+ A       +
Sbjct: 1   MKFLTSLVTSVLLSTASAG-LVSPPVYK----------LSFNKLRGETFEKA-------V 42

Query: 61  GQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTG 120
           G  N               +   +IKNQQ+FYS++L +GTP QNV V +DTGSSDLW+TG
Sbjct: 43  GNSN--------------GHANFDIKNQQNFYSVELKVGTPAQNVLVLLDTGSSDLWITG 88

Query: 121 SNNPYC-------------------NGSTFSDTVPSREL-FNCSQYGXXXXXXXXXXXXX 160
           S NPYC                   NG + +   PS     +CSQYG             
Sbjct: 89  SGNPYCSPSTRNSHLGSAGSNSSTNNGPSSTANFPSSSATIDCSQYGTFNLDGSETFKSN 148

Query: 161 XXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYN 220
                + YGD +FA G WG D + ++GLNV+ ++F             G+GL   E T  
Sbjct: 149 DSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGVGLPGEEATVT 208

Query: 221 -GSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTL 279
            G N +H Y Y NFP VLK+ G+ +  +YSL+LN  D+ SG+ILFGAVDHSKYSGNLYTL
Sbjct: 209 PGVNGNH-YQYKNFPQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTL 267

Query: 280 PLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHS 339
           P+VNTY D+G   P EF VT+QGI + + S  +T++  K  A+LDSGT+L  LP  +   
Sbjct: 268 PIVNTYADQGVA-PREFDVTVQGITVGNSSSNSTVSSDKTLALLDSGTTLMYLPTALADE 326

Query: 340 IASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE--DDICILG 397
           +A SL G++SP    YL+     N  +T + FDFGGF I+  LSN+IL+     D+ ILG
Sbjct: 327 LAKSLGGKFSPSTGYYLIPKPSEND-DTKITFDFGGFHIETKLSNYILQGSGPQDVAILG 385

Query: 398 LSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAP 457
           +   + +  I GD FL  AYVVYDLE+ +IS+AQA F++ +SDI+ I G+  VP A +AP
Sbjct: 386 ILRTEGDRAIFGDVFLVDAYVVYDLEDYEISLAQANFNSGSSDIEAISGS--VPGASRAP 443

Query: 458 GYSSTWTA 465
           GYS T+T 
Sbjct: 444 GYSQTYTG 451

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 222/367 (60%), Gaps = 6/367 (1%)

Query: 137 SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFX 196
           +R   NC++YG                  IQYGD+TFASGTWG D + ++ LNVTGL+F 
Sbjct: 188 ARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFA 247

Query: 197 XXXXXXXXXXXLGIGLTQLETTYNGSNS---SHSYTYANFPVVLKNAGLTESISYSLFLN 253
                      LGIGL  LE TY+G  +      Y Y NFP+VL   G  +S SYSLFLN
Sbjct: 248 VANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLN 307

Query: 254 ELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTT 313
              AE+GS+LFGAVDHSKY G+LYT+P+VNTY  +G+ NPI+F VTL G+GI S S  TT
Sbjct: 308 NASAETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNTT 367

Query: 314 ITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDF 373
           IT TK+ A+LDSGT+LT LP  ++  I   L   YS     Y+ SC    S +T +VFDF
Sbjct: 368 ITTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCP-SQSDDTEVVFDF 426

Query: 374 GGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAK 433
           GGF I   ++NFI+    D CILG+       +ILGD+FL SAYVVYDLEN +ISMAQA 
Sbjct: 427 GGFHINAPITNFIIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQAN 486

Query: 434 FDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIFPXXXXXXXXXXXXHKG 493
           +     DI+VI  +S VP A++APG+SSTW+   +S +T G+IF             + G
Sbjct: 487 YAGGQEDIEVI--SSSVPGAVRAPGFSSTWSTLATSFNTQGDIFTVQAAATVSGSATNTG 544

Query: 494 NSDASTT 500
              A+ T
Sbjct: 545 TGRATAT 551

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 79/129 (61%), Gaps = 18/129 (13%)

Query: 2   LIFTSQLFLAYVSTAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLG 61
           + F+S   LA V+  +     + ++S        ++ L F+K YG +F+ AK+      G
Sbjct: 1   MKFSSLCMLASVAAHSKAAKNVADLS--------YVKLDFDKYYGETFETAKR------G 46

Query: 62  QHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGS 121
           +   + +   + KRA+  Y+E++I NQ SFYS+ L +GTP Q+V V +DTGSSDLW+TGS
Sbjct: 47  RSQADIR---VNKRANG-YEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGS 102

Query: 122 NNPYCNGST 130
           +NPYC GST
Sbjct: 103 DNPYCRGST 111

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  315 bits (808), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 221/342 (64%), Gaps = 5/342 (1%)

Query: 137 SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFX 196
           S    +CSQYG                    YGD+TFASGTW  DV+++ GLN+TGL+F 
Sbjct: 191 SERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNLGGLNITGLSFA 250

Query: 197 XXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELD 256
                      LGIGL  LETTY+GS +S  Y Y NFP++LK +G  +S SYSLFL++LD
Sbjct: 251 VANMSNSTVGVLGIGLPGLETTYSGS-TSKLYQYNNFPMLLKQSGAIDSTSYSLFLDDLD 309

Query: 257 AESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQ 316
           A+ GS+LFGAVDH+KY GNLYT+P+VN    +G+PNPI+F VTL GIGI + SK  T+T 
Sbjct: 310 AKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAGIGIQNDSKNYTVTT 369

Query: 317 TKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGF 376
            K  A+LDSGT+++  P  ++ +IA  L  RYS  +  Y +SC+   S++TN VFDFGGF
Sbjct: 370 NKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCN-GVSSSTNFVFDFGGF 428

Query: 377 TIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDN 436
            I G +S+F+L    + C+L ++  +   ++LGD FL  AYVVYDL+N +IS+AQA    
Sbjct: 429 HITGPVSDFLLPTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEISLAQANTGT 488

Query: 437 STSDIDVIRGNSGVPSAIKAPGYSSTWT-ATPSSISTGGNIF 477
              D ++   +  VPSAIKAP YS TW+ A P  ISTGGNIF
Sbjct: 489 QNLDSNIQIISDSVPSAIKAPLYSETWSKAMP--ISTGGNIF 528

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 23  LPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQE 82
           +PE     Q +  ++ L FNKL G S++ A   +  +            L KR  S Y+ 
Sbjct: 24  IPEHETTDQSSK-YVILPFNKLVGDSYEDATPDKKPHFA----------LVKRDGS-YEN 71

Query: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126
           + IKN+QSFYS++L IGTP Q +TV +DTGSSDLW+ GS+NPYC
Sbjct: 72  VAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYC 115

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  309 bits (792), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 155/312 (49%), Positives = 222/312 (71%), Gaps = 4/312 (1%)

Query: 166 IQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSS 225
           I YGD++ A G WG+DV+SI+ ++V+G++F            LGIGL+ LETTY+G++SS
Sbjct: 207 ISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNSTVGVLGIGLSGLETTYSGTSSS 266

Query: 226 HSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTY 285
            SY Y N P++LK++G+ ++I+YSLFLNE    +G++LFGAVDHSKYSG+LYTLP+VN Y
Sbjct: 267 ESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNLLFGAVDHSKYSGSLYTLPIVNVY 326

Query: 286 KDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLN 345
              G+ NP+EF VT+ G+GI +    TTI   K+ A+LDSGT++   P T++  +A  L 
Sbjct: 327 ASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPALLDSGTTIVYFPETLLELVADQLG 386

Query: 346 GRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS 405
             YS  +  Y +SC + +S +T  VFDFGGF I   LS+F++ +    CIL +++ D+ S
Sbjct: 387 ASYSDELGFYAMSC-VSSSDDTEFVFDFGGFHITVPLSDFLIRVSGSECILAMAAQDDES 445

Query: 406 VILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTA 465
           +ILGD FL +AYVVYDLEN +ISMAQA +D+   DI+VI  +S VPSA+KA  YS++W++
Sbjct: 446 IILGDYFLTNAYVVYDLENYEISMAQANYDSEDEDIEVI--SSTVPSAVKAASYSNSWSS 503

Query: 466 TPSSISTGGNIF 477
           T  SI++GG+IF
Sbjct: 504 T-GSITSGGDIF 514

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 72/130 (55%), Gaps = 20/130 (15%)

Query: 1   MLIFTSQLFLAYVSTAAL--GNMVLPEISRFSQHN-NGFLDLQFNKLYGTSFDIAKKWQD 57
           M +  S+L L+     AL   ++V  +  + S  N N +L L F+K  G SFD + K   
Sbjct: 1   MKLLNSKLILSTSLITALTDASIVAKDSKQPSDFNKNKYLKLGFDKYVGESFDKSSK--- 57

Query: 58  INLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLW 117
                         L KRA  +Y    + NQ SFYS++L IGTP QNVTV +DTGSSDLW
Sbjct: 58  ------------DSLQKRA--EYAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLW 103

Query: 118 VTGSNNPYCN 127
           VTGS+NP C+
Sbjct: 104 VTGSDNPLCS 113

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  305 bits (782), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 178/419 (42%), Positives = 243/419 (57%), Gaps = 36/419 (8%)

Query: 87  NQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSD-----------TV 135
           N+  FYS++L +GTP Q ++V +DTGSSDLWV G++N +C     SD           T+
Sbjct: 65  NRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSNSTDKPLKSPTL 124

Query: 136 PS-RELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLT 194
           PS +   +C+QYG                  I+YGD ++A G +G+D + +N L++  ++
Sbjct: 125 PSPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVS 184

Query: 195 FXXXXXXXXXXXXLGIGLTQLETTYNGSNS---SHSYTYANFPVVLKNAGLTESISYSLF 251
                        LGIGL  LETT  G +S   S SYTY NFP VLK+ G+ ++ +YSLF
Sbjct: 185 LGVAHQANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLF 244

Query: 252 LNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFP-NPIEFAVTLQGIGI----- 305
           LN   A  G ILFG VDHSKY+G LYT+P++NT    G P NPI+F VTLQG+GI     
Sbjct: 245 LNSPGASQGGILFGGVDHSKYTGPLYTVPIINT----GAPGNPIQFQVTLQGVGISLDKS 300

Query: 306 -------VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVS 358
                     +   T+T +K   +LDSGT+L  LP  +   +A  L   Y+     Y + 
Sbjct: 301 NGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLK 360

Query: 359 CSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYV 418
           C  +N  NT L+ DFGGF +   ++N I   ++  C+LG++  D +S  LGD FL  AYV
Sbjct: 361 CPSQND-NTRLILDFGGFQVNAKITNHITRSQNGECLLGITPSDTDSGTLGDVFLVDAYV 419

Query: 419 VYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           VYDL+N +IS+AQA F +S   I+ I  +S VPSA KAPGYS+TWT +  SI TGGNIF
Sbjct: 420 VYDLDNYEISLAQADFSDSAQSIEPI--SSSVPSATKAPGYSNTWTGS-ESIKTGGNIF 475

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  306 bits (784), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 194/499 (38%), Positives = 273/499 (54%), Gaps = 47/499 (9%)

Query: 75  RASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG------ 128
           R + DY  ++++NQQ +YS++L++GTP QNV+V IDTGSSDLW+T  +NPYC G      
Sbjct: 47  RRADDYLSVDVENQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCIGFKQPGS 106

Query: 129 --------STFSDTV--------PSR------------ELFNCSQYGXXXXXXXXXXXXX 160
                      + TV        P+R            + F+C+  G             
Sbjct: 107 AKFALEEKEAANATVLTAQNAEGPTRSSKAAKATGGHLDQFDCALLGTFNNSESSSFKSN 166

Query: 161 XXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYN 220
                  Y D TFASG WG DV+ I  ++V+ ++             LGIG+  LE++  
Sbjct: 167 NTDFLTGYADNTFASGFWGTDVVRIGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSNA 226

Query: 221 G---SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLY 277
           G   + ++ SY Y NFPV LKN G+ E I+YSLFLN+ DA  GS+LFGAVDHSKY   L+
Sbjct: 227 GRLAAETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDATEGSVLFGAVDHSKYENGLF 286

Query: 278 TLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTII 337
           T+P+VNTYKD+G  +PIEF VT+ G+G        TIT T    +LDSG++ + LP T++
Sbjct: 287 TVPMVNTYKDQGVQHPIEFYVTMYGLGFKKDGFLNTITTTNFPVLLDSGSTTSYLPDTLV 346

Query: 338 HSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILG 397
             +AS+LN  +S  I+ Y + C       T L FD GGF I   LS+ + +   + C+L 
Sbjct: 347 SMLASALNATFSEKINGYTLKCPSEEDA-TFLSFDLGGFLIDVPLSDLVAKRHKNQCVLM 405

Query: 398 LSSVDENS--VILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIK 455
           +    E     ILGDTFL+SAYVVYDLE+ +IS+ QA   ++  DI+VI+  S VP A++
Sbjct: 406 VKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQASTGDAAEDIEVIK--STVPGAVR 463

Query: 456 APGYSSTWTATPSSISTGGNIFPXXXXXXXXXXXXHK-GNSDASTTSSTQTKKNYG--NR 512
           AP Y   WT   + IS  GNI               K  NS +STT S   +KN G  + 
Sbjct: 464 APFYDRPWTGG-TVISMSGNISTGPINGSYNGMGATKPRNSSSSTTLSGNVRKNIGVASA 522

Query: 513 ENPRILSSIYFLPIINLIL 531
             P ++++I  L I++ +L
Sbjct: 523 GMPSLVTAILAL-IMSFLL 540

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  306 bits (784), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 193/501 (38%), Positives = 260/501 (51%), Gaps = 99/501 (19%)

Query: 72  LYKRASSD-YQELEIKNQQSFYSLDLFIGTPGQNVT------------------------ 106
           L KR ++D Y  ++++NQ SFYS+DL IGTP Q VT                        
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64

Query: 107 -------------VQIDTGSSDLWVT---------------------------------G 120
                        V+I+    D WVT                                 G
Sbjct: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWTMMTG 124

Query: 121 SNNPYCNGSTFSDT-----VPSR-------ELFNCSQYGXXXXXXXXXXXXXXXXXXIQY 168
           + N      T ++T     VP+R           CS YG                  I Y
Sbjct: 125 AENTMMMTGTGTETAVATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184

Query: 169 GDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSN----- 223
           GDT++ASG+WG D MSIN LNV+G++F            LGIGL  LE T   SN     
Sbjct: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244

Query: 224 ------SSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLY 277
                 SS  Y YANFP+VLKN G+   ++YSLFLN+   + GS+LFGAVDHSKY+G LY
Sbjct: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304

Query: 278 TLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTII 337
           T+PLV+ Y D     P+EF +TL G+G+     ++TI  T + A+LDSGT+++  P  + 
Sbjct: 305 TVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLA 364

Query: 338 HSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILG 397
           + IA   N  Y      Y +SCS  +++NTNLVFDFGGF I   L +F+++     C+L 
Sbjct: 365 NEIARKFNATYDSRSGFYTMSCSY-DTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLA 423

Query: 398 LSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSD-IDVIRGNSGVPSAIKA 456
           +    EN V+LGD FL++AYVVYDLENL++SMAQA FD+S  + ++VI  +S VPSA+KA
Sbjct: 424 IGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVI--SSTVPSAVKA 481

Query: 457 PGYSSTWTATPSSISTGGNIF 477
             YS+ W++    +STGGNIF
Sbjct: 482 ASYSNPWSSA-VMMSTGGNIF 501

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  305 bits (780), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 173/443 (39%), Positives = 253/443 (57%), Gaps = 38/443 (8%)

Query: 67  FKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126
           F  SE   +   D    ++KN+Q+FYS+ L +GTPGQ V V +DTGSSDLW+ GS+NPYC
Sbjct: 50  FTASEELSKRDKDVT-FDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYC 108

Query: 127 N-GSTFS--------------DTVP-------------SRELFNCSQYGXXXXXXXXXXX 158
              S+FS               T+P             +    +C ++G           
Sbjct: 109 KESSSFSISNQGKENGAEGPFQTLPGGVTATNMSGGSTASATLDCKEFGTFNREDSKTFH 168

Query: 159 XXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETT 218
                  + YGDT++A GTWG D ++IN +N+T ++             +GIGL+ LE T
Sbjct: 169 SNDTEFSVSYGDTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGLSNLENT 228

Query: 219 YNGS---NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGN 275
           Y G     + +++ Y NFP++LK  G  E   YSLFLN  +A  GSILFGAVDHSKYSG 
Sbjct: 229 YTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDHSKYSGQ 288

Query: 276 LYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGT 335
           LYT+P++N Y+ +G  +P++  VTLQG+GI + +   T + T + A+LDSGT+L  LP  
Sbjct: 289 LYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMTNTTSTTPVPALLDSGTTLVYLPDK 348

Query: 336 IIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL-EIEDDIC 394
           ++  +A  LN  +   I  Y+  CS  +  NTNL F+FGGF I   +S +++    ++ C
Sbjct: 349 MLAMLAEQLNAHWDRGIGYYVTDCSRVD--NTNLYFNFGGFNIVSNMSTYVVSRSNENSC 406

Query: 395 ILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAI 454
           +LGL      + ILGD F+  AY+V+DL++ +ISMAQA +    + ++ +     VPSA+
Sbjct: 407 VLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISMAQANYAGGKNQLEAV--TQQVPSAM 464

Query: 455 KAPGYSSTWTATPSSISTGGNIF 477
           KAPGYS T++ +   I+ GGNIF
Sbjct: 465 KAPGYSHTFSGS-QGITGGGNIF 486

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  307 bits (786), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 162/356 (45%), Positives = 229/356 (64%), Gaps = 11/356 (3%)

Query: 130 TFSDTVP-SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGL 188
           T ++ +P S    +C +YG                  I YGD+TFASGTW +DV++++ L
Sbjct: 230 TATNDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDL 289

Query: 189 NVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSS---HSYTYANFPVVLKNAGLTES 245
           NVTGL+F            LGIGL  LE+TY+G++ +     Y Y NFP+VLK +G   +
Sbjct: 290 NVTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHT 349

Query: 246 ISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGI 305
            +YSLFL++LD   GS+LFGA+DHSKY+G LYT+P++N  ++ G+ NPI+F VTL GIG+
Sbjct: 350 TTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL 409

Query: 306 VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNST 365
            +G +  T+T TKLAA+LDSGT+++  P +++  +A  +N +YS  +  Y V C    S+
Sbjct: 410 QNGERNLTLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCR-SVSS 468

Query: 366 NTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENL 425
           NTNLVFDFGGF I G L +F+++     CIL ++  +   VILGD FL  AYVVYDL+N 
Sbjct: 469 NTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNY 528

Query: 426 QISMAQAK----FDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            I++AQA       +S+SDI++I  NS +P AI+AP YS TWTA    + +GGNIF
Sbjct: 529 VIALAQADTSTSNQSSSSDIELIT-NSTIPRAIRAPLYSETWTAN-RPVQSGGNIF 582

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 64/103 (62%), Gaps = 13/103 (12%)

Query: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSD---YQELEIKNQQSFY 92
           ++ L F K  G SF+ A +           N   ++L KR + D   Y++++I NQQSFY
Sbjct: 57  YVKLPFEKYTGDSFESATRN----------NKPLNQLLKRDNEDGAGYEDVKITNQQSFY 106

Query: 93  SLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTV 135
           S++L IGTP Q+VTV +DTGS+DLWVTGS NP+C  S  S  V
Sbjct: 107 SVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  305 bits (780), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 183/447 (40%), Positives = 266/447 (59%), Gaps = 22/447 (4%)

Query: 35  GFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSL 94
           GF+ +QF+K YG      K   D +L + NL        KR SS   E+E+ N+  FY++
Sbjct: 26  GFVGVQFSKRYG------KSISDSSLAKGNL-------VKR-SSGTDEVELINESVFYAI 71

Query: 95  DLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXXXXX 154
           D+ IGTP Q+VTV +DTGSSD WV  S NPYC   + + T+ S +L +C+ YG       
Sbjct: 72  DMEIGTPKQSVTVLVDTGSSDFWVPSSTNPYCESKSATSTIASSDLIDCTTYGTFSVSDS 131

Query: 155 XXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQ 214
                       QY D + A+G WG DV+   G  ++ ++             LGIGLT 
Sbjct: 132 SSFVYNNTDFQTQYADGSSATGFWGHDVVDFGGQELSDISIAVADQTDSSFGVLGIGLTG 191

Query: 215 LETTYNGSNSSHS----YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHS 270
           LE+TY+GS ++ S    Y Y NFP+ L    + ++ +YSL+L+     SG+ILFG VDH+
Sbjct: 192 LESTYSGSAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPATGSSGTILFGGVDHN 251

Query: 271 KYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLT 330
           KYSG+L T+PL+NT +  G+ +PI+  VTL G+G+  GS  +T+T T++ A+LDSGT+LT
Sbjct: 252 KYSGDLNTIPLINTLEANGYTSPIKLQVTLNGLGVSDGSSTSTVTTTQIPALLDSGTTLT 311

Query: 331 VLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE 390
            LP  +   +A  +   YS   + Y++SC+  +  ++ +V+DFGGF I+  L+  + ++ 
Sbjct: 312 YLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDE-DSMIVYDFGGFQIQTPLAGSLYQLS 370

Query: 391 DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGV 450
           DD C L + S   +   LGD FL  AYVVYDL+N +ISMAQ  ++ +T DI++I  +  V
Sbjct: 371 DDQCELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYNATTEDIEIISDS--V 428

Query: 451 PSAIKAPGYSSTWTATPSSISTGGNIF 477
           P A KA GY +TWT T  SI+ GGNIF
Sbjct: 429 PGATKAAGYYNTWT-TSESITAGGNIF 454

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  308 bits (788), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 264/461 (57%), Gaps = 45/461 (9%)

Query: 35  GFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQEL--EIKNQQSFY 92
           G++ + F K  G S+      QD  +G      + ++L KRA S  + L  E+ N   FY
Sbjct: 34  GYVAIDFAKAKGISY------QDARVGA-----RPAKLQKRALSQGETLNSELVNNNVFY 82

Query: 93  SLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC-NGST-------FSDTVPSREL---- 140
           S+ L IGTP Q VTV  DTGSSDLWV+ ++NPYC NG +        +D   S  L    
Sbjct: 83  SVGLDIGTPPQQVTVLFDTGSSDLWVSSNDNPYCSNGDSTESYANYRADLKSSSALTAAP 142

Query: 141 ------------FNCSQYGXXXXXXXXXXXXXXXXXX-IQYGDTTFASGTWGRDVMSING 187
                        +C+QYG                   + Y D ++A G W RD + ++G
Sbjct: 143 TTTISGITIAPTIDCAQYGTFNADRSTSLFANYSKPFFVSYNDDSYALGYWARDKLVVDG 202

Query: 188 LNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESIS 247
            +++ L F            LG+GL  LE+T +  + + S  Y NFP+VLK  G  + I+
Sbjct: 203 DDISSLEFAVAEISNSTVGVLGVGLQGLESTVHYRSPNISSIYPNFPMVLKENGAIDKIA 262

Query: 248 YSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVS 307
           YSL+LN LDA SGS+LFG VDHSKY+G LYTLPLVNTYKD G   P++F VT+QGIGI S
Sbjct: 263 YSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKDYGVKTPVQFDVTVQGIGIES 322

Query: 308 --GSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNST 365
               ++ T T TK+AA++DSGT+L      I++ IA  +N  +SP    ++  C   +  
Sbjct: 323 EKACRQETFTTTKIAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCP-SDGD 381

Query: 366 NTNLVFDFGGFTIKGTLSNFILEIEDD-ICILGLSSVDENSVILGDTFLASAYVVYDLEN 424
           +T  +FDFGGF IK  LSN+IL  +D+ IC LGL S ++ + I GD FLASAYVVYDLEN
Sbjct: 382 DTQFIFDFGGFQIKSPLSNYILRTDDENICGLGLISSNQGT-IFGDEFLASAYVVYDLEN 440

Query: 425 LQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTA 465
           L++S+AQA ++  + +I+ I   S +P A +A  Y +TW +
Sbjct: 441 LELSLAQANWNPGSPEIEKIV--SEIPRAQRASQYWNTWVS 479

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  299 bits (765), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 180/461 (39%), Positives = 254/461 (55%), Gaps = 30/461 (6%)

Query: 16  AALGNMVLPEISRFS----QHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSE 71
           AALG ++   ++  S    +    F+ + F+K  G SF  ++ W     G+  +      
Sbjct: 6   AALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSF--SEAWS----GRAAV----PR 55

Query: 72  LYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTF 131
           L KR  +D+ ++EI NQQ FYS++L IGTP Q V V +DTGSSDLWV G+    C  + +
Sbjct: 56  LAKR--NDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG-VRCGPNNY 112

Query: 132 SDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVT 191
               P+    NC ++G                  I+YGD+T+A GTWG D + +   NV 
Sbjct: 113 ----PNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVD 168

Query: 192 GLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLF 251
           GLTF            LGIGL  +ETT   S+    Y Y N P+VLK   + +   YS+F
Sbjct: 169 GLTFAVAHASNSSVAVLGIGLPAMETTM--SSQQFGYQYDNLPMVLKRNNVIKKTVYSMF 226

Query: 252 LNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGS-- 309
           +NEL+A++GS+LFGAVDHSKY G L T+PLVN    R    P+E  VTL  IG+ +G   
Sbjct: 227 INELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDE 286

Query: 310 -KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTN 368
            K  T+  +K+ A+LDSGT+LT  P  +   +A +   R+      Y+V C+ R    T 
Sbjct: 287 DKVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTA 346

Query: 369 LVFDFGGFTIKGTLSNF-ILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQI 427
            ++DFGGF I+  LS++ ++      C  G+     + VILGD FL  AYVV+DLE L++
Sbjct: 347 YIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEV 406

Query: 428 SMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTA-TP 467
           SMAQA ++     I+VI G   VP A++APGY+  W A TP
Sbjct: 407 SMAQANYEGGKEQIEVIAG--AVPRAVRAPGYNDPWKAYTP 445

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  300 bits (768), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 180/485 (37%), Positives = 260/485 (53%), Gaps = 69/485 (14%)

Query: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRA-SSDYQELEIKNQQSFYSL 94
           FL+L+F++ YG S+      +D  LG+      +   +  A +  Y+++ + NQ +FYS+
Sbjct: 46  FLELKFDRHYGESY------EDSTLGKDGAVHLEKRTFDSAYNGSYEDVILTNQLTFYSV 99

Query: 95  DLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCN--------------------------- 127
           +L IGTP Q VTV +DTGSSDLW+T ++NP+C+                           
Sbjct: 100 ELDIGTPAQKVTVVVDTGSSDLWITETSNPFCSTGDDDTEDSVWSPFLLKDKIDPRVLKH 159

Query: 128 -------------------------GSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXX 162
                                    GS F  T+P   L NC+++G               
Sbjct: 160 KGKRTTSIDVTATATTGSINISIDLGSNF--TLPPEFLINCTEFGTFNTKKSSTFKNNHT 217

Query: 163 XXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGS 222
              I YGD TFASG WGRDV+S   +NVTGL+F            LGIGL +LE+TY G+
Sbjct: 218 DFFISYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTYFGT 277

Query: 223 NSS---HSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTL 279
            +S    SY Y NFP VLKN+G+    +YSLFLN+ D+  GS+L GAVD SK++  LYT+
Sbjct: 278 VNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKLYTV 337

Query: 280 PLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHS 339
           P++N    +G+ +P  F V +Q +      +   +  +++  +LDSGT++  LP +I+  
Sbjct: 338 PMLNINPSKGYTDPSAFLVLMQKMTRYKYGQGHLVPSSRIPVLLDSGTTMVYLPRSIVEQ 397

Query: 340 IASSLNGRYSPLIDSYLVSCSLRNSTN-TNLVFDFGGFTIKGTLSNFILEIEDDICILGL 398
           I      +Y   +D Y + C   N  N T+  FDFGGF IK +LS+FI+  ++  CI G+
Sbjct: 398 IMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPTDNGQCIFGM 457

Query: 399 SSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSD-IDVIRGNSGVPSAIKAP 457
              D N  ILGD+FL  AYVVYDLE+ +ISMAQA +D    + I ++   S VPSA++A 
Sbjct: 458 IPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIV---STVPSAVRAK 514

Query: 458 GYSST 462
            YS+T
Sbjct: 515 YYSAT 519

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  296 bits (759), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 170/370 (45%), Positives = 232/370 (62%), Gaps = 19/370 (5%)

Query: 123 NPYCNGSTFSDTV------------PSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGD 170
           NP+  GST + T             PS+   NC  YG                  I+Y D
Sbjct: 231 NPFGWGSTATATTGGNSGYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYAD 290

Query: 171 TTFASGTWGRDVMSI-NGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGS-NSSHSY 228
           T++A+G WGRDV++  +GLNVTGL+F            LGIGL QLE TY+G   S+  Y
Sbjct: 291 TSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPY 350

Query: 229 TYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGN-LYTLPLVNTYKD 287
            Y NFP+VLKN+G      YSL+LN+ +A++G++LFGAVDHS+Y G+ LYT+PLVN    
Sbjct: 351 IYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSS 410

Query: 288 RGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGR 347
            G+  PIEF +TLQG+G+   +   T+T T++ A+LDSGT+LT  P  +++ +A ++N  
Sbjct: 411 SGYSTPIEFDITLQGLGVTDNTNNYTVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINAS 470

Query: 348 YSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVI 407
           YS  +  Y+++C   +  NT +VFDFGGF I   L+NF+L      C+LGL   + NS I
Sbjct: 471 YSDALGYYVMNCP-DSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAI 529

Query: 408 LGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATP 467
           LGD FL  AYVVY+L++L+ISMAQA +DNS  DI+VI   S VP+A+KAPGYS T+ +T 
Sbjct: 530 LGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVIT--STVPNAVKAPGYSYTY-STS 586

Query: 468 SSISTGGNIF 477
            SI +GGNIF
Sbjct: 587 KSIVSGGNIF 596

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 69/104 (66%), Gaps = 10/104 (9%)

Query: 33  NNGFLDLQFNKLYGTSF-DIAKKWQ----DINLGQHN--LNFKQSELYK---RASSDYQE 82
           N+ FL L F K Y  S  DI  ++     D  L + +  ++ K+S+ Y    + +  Y+E
Sbjct: 38  NSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEE 97

Query: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126
           ++I NQQSFYS++L IGTP Q++TV +DTGSSDLWVTGS+NPYC
Sbjct: 98  IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  293 bits (750), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 211/344 (61%), Gaps = 13/344 (3%)

Query: 141 FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXX 200
            +CSQYG                  I YGD +FASG WG D ++   +N+ G++F     
Sbjct: 178 MDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANE 237

Query: 201 XXXXXXXLGIGLTQLETTYNGS---NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDA 257
                   GIGL + E TY      N  H Y Y NFP VLK+ G     +YSLFLN LDA
Sbjct: 238 TNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDA 297

Query: 258 ESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQT 317
            SG ILFGAVD SKY G+LYTLPL+N+   + + NP+EF VTLQG+G  +GS KTT T T
Sbjct: 298 SSGDILFGAVDRSKYKGDLYTLPLLNSDPTK-YKNPMEFDVTLQGVGFTNGSSKTTFTTT 356

Query: 318 KLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFT 377
           K+ A+LDSGTSL  LP  +   IA  L G Y+  I  Y++ C   N  ++ LVFDFGGFT
Sbjct: 357 KIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSEND-DSQLVFDFGGFT 415

Query: 378 IKGTLSNFILEIEDD----ICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAK 433
           IK  LSN++L   DD     C+LG+   D  + ILGD FLA AYVVYDL++ ++S+AQA 
Sbjct: 416 IKNNLSNYLLGSPDDGDDSQCVLGILPSDVQA-ILGDVFLADAYVVYDLDDYEVSLAQAS 474

Query: 434 FDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           FDNS  DI +I  +  +P A +APGYS TW+ TP+SI +GGNIF
Sbjct: 475 FDNSKEDIQII--SDSIPGAKRAPGYSKTWS-TPASIKSGGNIF 515

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 63  HNLNFKQSELYKRASSDYQELE----IKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWV 118
           H   +++S L +R+       E    ++NQQ+FYS+DL +GTPGQN+TV +DTGSSDLW+
Sbjct: 38  HGPTYEESSLERRSLETRNNKEFNFIVENQQNFYSVDLLVGTPGQNITVLLDTGSSDLWL 97

Query: 119 TGSNNPYC 126
           T  NNPYC
Sbjct: 98  TAKNNPYC 105

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 186/477 (38%), Positives = 265/477 (55%), Gaps = 44/477 (9%)

Query: 14  STAALGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELY 73
           S +A    ++  ++     N  ++   F K  G+SF  A+              +  +L+
Sbjct: 6   SISAFAAGLVSVVAASESSNGDYVSFNFGKSLGSSFHGARGGS-----------RPGKLH 54

Query: 74  KR--ASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG--- 128
           +R   SSD     +KN++ FYS+ L IGTP Q++TV  DTGSSDLWV+ ++NP+C     
Sbjct: 55  RRDSGSSDSALSVLKNEEVFYSVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFCEADGV 114

Query: 129 ---------STFSDTVPSREL--------FNCSQYGXXXXXXXXXXXXXXXXX-XIQYGD 170
                    ST+S   PS  +         +C+++G                   I YGD
Sbjct: 115 NRRADLKSSSTYS-VAPSTTIDGFEVAPTVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGD 173

Query: 171 TTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTY 230
            TFA+G W +D +S++G +++ L F            LG+GLT LE++ +  +   S  Y
Sbjct: 174 GTFANGLWAKDTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLESSADPFDDEPS-QY 232

Query: 231 ANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGF 290
            NFPVVLK   +   ++YSL++N LDAE+GS+LFGAVDHSKY+G LYT+PLVN       
Sbjct: 233 PNFPVVLKQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFV 292

Query: 291 PNPIEFAVTLQGIGIVSGSK--KTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRY 348
              +EF VT+QG+GI S     + T+T  +  A++DSGT+L  +   +  +IA SL    
Sbjct: 293 DEILEFDVTVQGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATM 352

Query: 349 SPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDD-ICILGLSSVDENSVI 407
           S   + Y   C  ++  +T LVFDFGGF I   LSN++LE +D+ +C LG+  V   S I
Sbjct: 353 SDDYELYTFECPAKDD-DTQLVFDFGGFQITNPLSNYVLETDDEKVCGLGV--VPSYSNI 409

Query: 408 LGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464
           LGD FLASAYVV+DLENL++S+ QA  +    DI+ I   S VP A KAPGYSSTWT
Sbjct: 410 LGDEFLASAYVVFDLENLELSIGQANLNPGPEDIEPII--STVPGAQKAPGYSSTWT 464

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  290 bits (743), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 183/505 (36%), Positives = 263/505 (52%), Gaps = 68/505 (13%)

Query: 18  LGNMVLPEISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRAS 77
           +G+++ PE S+        + + F K  G +F           G  + N  ++ L KR  
Sbjct: 17  VGSVIEPETSKH-------VSIPFKKAKGKTFS----------GSADSNKWRNRLSKRGD 59

Query: 78  SDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGS-------- 129
            DY+ L +K  +  Y ++L +GTPGQ   VQ+DTGSSDLWV  S+NPYC  S        
Sbjct: 60  -DYENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTHNEKV 118

Query: 130 ---------------------------------TFSDTVPSREL-FNCSQYGXXXXXXXX 155
                                            T ++ VPS E   +C+ +G        
Sbjct: 119 YGEAAYGETAFDQTALDQFETLLASATEDDPSYTQTEAVPSSEATIDCASFGTFNYTLSS 178

Query: 156 XXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQL 215
                     I Y D+T A G W +DV+ +  L ++ + F             G+G    
Sbjct: 179 SFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPFAVAVVGDVQTPVFGVGFPGT 238

Query: 216 ETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGN 275
           E+T  GS+    Y YANFPV+LK+ G  + + YSLFL+  D+ SGS L GAVDHSKYSG 
Sbjct: 239 EST-AGSSVKEPYEYANFPVLLKSQGYVKKVVYSLFLDAQDSSSGSFLLGAVDHSKYSGG 297

Query: 276 LYTLPLVNTY--KDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLP 333
           LYTLP+ +     D     P  F +TLQG+GI    +  T+  T+    LDSG++ TV P
Sbjct: 298 LYTLPMYSGTDGDDTLSSTPSRFIITLQGLGISDKGENKTVATTRSLVYLDSGSTGTVFP 357

Query: 334 GTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDD- 392
                 IA SL   YS   ++Y++ C  ++  +TN V+DFGGFTI   LSN++    DD 
Sbjct: 358 SEYAELIADSLGASYSGDYEAYVMKCPSKDD-DTNFVYDFGGFTISSPLSNYMEATGDDS 416

Query: 393 ICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPS 452
           +C+L + + D   ++LGD FL SAYVVYDLE+ +IS+AQA +D  + +I+V+  +  +PS
Sbjct: 417 VCVLDIDTDDIPYIVLGDAFLVSAYVVYDLEDYEISIAQANYDGGSENIEVV--SDSIPS 474

Query: 453 AIKAPGYSSTWTATPSSISTGGNIF 477
           A+KAP YSSTW+ T  + ++GGNIF
Sbjct: 475 AVKAPFYSSTWS-TYVTATSGGNIF 498

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  291 bits (744), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 162/341 (47%), Positives = 221/341 (64%), Gaps = 9/341 (2%)

Query: 142 NCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSI-NGLNVTGLTFXXXXX 200
           NC  YG                  I+Y DT+FASG WGRDV++  +GLNVTGL+F     
Sbjct: 283 NCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVANQ 342

Query: 201 XXXXXXXLGIGLTQLETTYNGS-NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES 259
                  LGIGL QLE TY G   ++  YTY NFP+VLKN+G     +YSL+LN+  A++
Sbjct: 343 TNSTVGVLGIGLPQLEVTYAGVYQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQSAKN 402

Query: 260 GSILFGAVDHSKYSGN-LYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKT-TITQT 317
           G++LFGA+DHS+Y G+ LYT+PLVN+    G+  PIEF VTLQG+G+        T+T T
Sbjct: 403 GNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTVTTT 462

Query: 318 KLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFT 377
           ++ A+LDSGT+LT  P  +++ +A  +N  YS  +  Y+++C   +  NT LVFDFGGF 
Sbjct: 463 QIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCP-DSRDNTQLVFDFGGFH 521

Query: 378 IKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDN- 436
           IK  L+NF+L      C+LGL   + NS ILGD FL  AYVVY+L++L+ISMAQA F+N 
Sbjct: 522 IKTNLTNFVLSSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMAQANFNNG 581

Query: 437 STSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           +  DI+VI  +S +P+A+KAPGYS T++ +  SI  GG+IF
Sbjct: 582 NDEDIEVI--SSTIPNAVKAPGYSYTYSVS-KSIVPGGDIF 619

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 80/131 (61%), Gaps = 9/131 (6%)

Query: 8   LFLAYVSTAALGNMVLPEISRFSQH---NNGFLDLQFNKLYGTSF-DIAKKWQDINLGQH 63
           + LA  +      ++LPE +  S++    + FL L+F K Y  S  DI  +    N    
Sbjct: 9   IILALSNITRADPILLPEKTENSKNIVGKDKFLKLEFQKFYADSVNDIPPRDYSFNKRDS 68

Query: 64  NLNFKQSELY----KRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVT 119
            L+ K S+ Y    KR    Y++++I NQQSFYS++L IGTP Q++TV +DTGSSDLWVT
Sbjct: 69  VLDLKNSKPYIKLIKRHDG-YEKIQIINQQSFYSVNLQIGTPAQSITVLVDTGSSDLWVT 127

Query: 120 GSNNPYCNGST 130
           GSNNPYC G++
Sbjct: 128 GSNNPYCKGNS 138

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  286 bits (732), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 246/408 (60%), Gaps = 18/408 (4%)

Query: 72  LYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTF 131
           L+KR + +   L +KN+Q FY+ DL +GTP QN+TV +DTGSSDLWVTGS+NPYC  S  
Sbjct: 41  LWKR-NQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYC-LSNE 98

Query: 132 SDTVPSREL----FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSING 187
           + T PS+ +     +CS+YG                  I Y D TFA+G W +DV+S   
Sbjct: 99  TTTEPSKNITKSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGD 158

Query: 188 LNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESIS 247
             +  + F            LGIG  +LE+      + ++Y Y NFP+ LKN G+ +  +
Sbjct: 159 NFIADMQFAVANETNSTVGVLGIGFERLESVKGYEGAPNTY-YQNFPLALKNNGVIDKTA 217

Query: 248 YSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGI-V 306
           YSL+LN LD+ SGSILFG +D +KY+G+LYT PLVN +       P +F VT+QGIG+  
Sbjct: 218 YSLYLNSLDSSSGSILFGGIDSNKYTGDLYTFPLVNIHPSV-VNKPAKFHVTVQGIGVQS 276

Query: 307 SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTN 366
           SGS+++ +  TK  A+LDSGT+L V P     S+A+ +N  Y+ L   Y ++C   N  +
Sbjct: 277 SGSEQSILMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPEND-D 335

Query: 367 TNLVFDFGGFTIKGTLSNFILEIED-DICILG-LSSVDENSVILGDTFLASAYVVYDLEN 424
           T  +FDFG   IK  L NFIL  ED + C  G L +VD  ++ILGD FL++AYVVYDLE+
Sbjct: 336 TEFLFDFGDLKIKVPLKNFILAPEDNEYCGFGVLPTVD--TMILGDMFLSAAYVVYDLES 393

Query: 425 LQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSIST 472
            ++S+AQA +++  S+I  IR    VP A KA   ++TW+   ++ +T
Sbjct: 394 YEVSLAQANWNSDESEIQAIRHT--VPGATKAT--AATWSPYETTATT 437

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  281 bits (719), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 173/428 (40%), Positives = 241/428 (56%), Gaps = 31/428 (7%)

Query: 61  GQHNLNFKQ----SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDL 116
           G  NL FK+     +L +R   D   + +  Q  FYS+DL IGTP Q VTV +DTGSSDL
Sbjct: 18  GNVNLPFKRVRQSPQLVRREDGD--SVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDL 75

Query: 117 WVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASG 176
           WVTG+NNPYC  S  S+         C +YG                  I Y D T   G
Sbjct: 76  WVTGANNPYCQTSLSSE---------CKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDG 126

Query: 177 TWGRDVMSIN--GLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFP 234
            WG D + +N   + +                 +G+G   LETT N   +  SYTYANFP
Sbjct: 127 RWGVDTLELNNGAIQLQNTMIGVADSSDSVAGVIGLGFPGLETTNNVQANGESYTYANFP 186

Query: 235 VVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPI 294
           + LK  G+T++  +++ L+  ++  G ILFGAVD  KY G LYTLP+VN+   RG   PI
Sbjct: 187 MQLKQQGVTDATVFAIALD--NSYGGDILFGAVDEGKYIGGLYTLPVVNS---RGTATPI 241

Query: 295 EFAVTLQGIGIVS-GSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLID 353
              VTLQGIG+ S G  + T + T + A++DSG+++  LP  I  +I + +  RY    +
Sbjct: 242 RMEVTLQGIGVDSDGGDQETFSSTPMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSE 301

Query: 354 SYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE---DDICILGLSSVDENSVILGD 410
            Y + C   N  N NL+FDFGGF I   +SN+I+  +   +  C+ G+ S   N+V+LGD
Sbjct: 302 MYTIDCGT-NVENDNLIFDFGGFHISTPVSNYIITDQRSSNGQCLFGILSQSGNTVVLGD 360

Query: 411 TFLASAYVVYDLENLQISMAQAKFDNSTSDI-DVIRGNSGVPSAIKAPGYSSTWTATPSS 469
           TFL+SAYVV+DL++ +ISMAQ   +N   ++ DV  G   +P+A KAP YS TW +T + 
Sbjct: 361 TFLSSAYVVFDLDHYEISMAQGNSNNGDGNVKDVTSGT--IPNARKAPMYSQTW-STNAP 417

Query: 470 ISTGGNIF 477
           +++GGNIF
Sbjct: 418 VTSGGNIF 425

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  277 bits (709), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 183/511 (35%), Positives = 278/511 (54%), Gaps = 75/511 (14%)

Query: 27  SRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIK 86
           S   + +  ++ L F+K  G++++ + K        HN   K   +  +    +QE+E+K
Sbjct: 19  SVLKKRSPKYVSLPFDKSRGSTYEESSK--------HN---KPYAVLSKRDDGFQEIELK 67

Query: 87  NQQSFYSL--------------------DLFI----------GTPG-------------- 102
           NQ SF+S+                    DL++          G+ G              
Sbjct: 68  NQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPYCRAGSVGNRRNDASSGSGSGS 127

Query: 103 ------QNVTVQIDTGSS-DLWVT--GSNNPYCNGS---TFSDTVPSR-ELFNCSQYGXX 149
                 + V ++ D  SS   W+T  G+N    +GS   T ++++ S     +CSQYG  
Sbjct: 128 GSSNNKKRVNIKRDEISSVRSWLTASGTNTRTQSGSASATRANSLSSALATIDCSQYGTF 187

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           I YGD+++A GTWG+D + ++ +++ GL+F            LG
Sbjct: 188 NTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVGVLG 247

Query: 210 IGLTQLETTYNG--SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAV 267
           IGL  LE TY+G  S++ + Y Y NFP++LK   + ++ +YSLFLN  ++ SGS+LFGAV
Sbjct: 248 IGLPGLEVTYSGYASSARNRYQYDNFPLILKRNNVIKANAYSLFLNSTNSSSGSLLFGAV 307

Query: 268 DHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGT 327
           DHSKYSG LYT+PL+NT +  G+ +PI+F V +QGIG+ +    TT+T T + A+LDSG 
Sbjct: 308 DHSKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTSGSNTTLTTTVIPALLDSGA 367

Query: 328 SLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL 387
           +L+  P  +   IA +L+  YS     Y+V C   +  +T +++DFGGF I   L+++IL
Sbjct: 368 TLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSDD-DTEIIYDFGGFHIASKLTDYIL 426

Query: 388 EI-EDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRG 446
                 IC+LG+   + N  ILGD FL SAYVVYDL+N +IS+AQA ++     I+VI  
Sbjct: 427 TTNRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEISLAQANYEGGDEQIEVI-- 484

Query: 447 NSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           +  VPSAIKAP YSST  ++ S+ STGG+IF
Sbjct: 485 SESVPSAIKAPSYSSTRFSSASA-STGGDIF 514

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  275 bits (702), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 203/344 (59%), Gaps = 13/344 (3%)

Query: 142 NCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXX 201
           +CS+YG                  IQYGD ++A G WGRD +++  + V+ ++       
Sbjct: 195 SCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANIS 254

Query: 202 XXXXXXLGIGLTQLETTYNGSNS-SHSYTYANFPVVLKNAGLTESISYSLFLNELDAESG 260
                 LGIGL  LE T   + S S +YTY NFP +L + G     +YSLF+N+L+A  G
Sbjct: 255 NSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHG 314

Query: 261 SILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLA 320
           S+LFGAVDHSKY+G L T+PLVN+ K    P PI+F VTL G+GI      TTIT T   
Sbjct: 315 SVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLNDTNTTITTTPFP 374

Query: 321 AILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKG 380
           A+LDSGT+ T LPG ++ +IA  LN  Y      Y   C    S +  LVFDFGGF IK 
Sbjct: 375 ALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCD-EISDSDELVFDFGGFHIKS 433

Query: 381 TLSNFILEI------EDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKF 434
            L NF L        E D+C L L   +   +ILGD FL +AYVVYDLENL+ISMAQA  
Sbjct: 434 KLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANL 493

Query: 435 DNSTSDIDVIRGNSGVPSAIKAPGYSSTWT-ATPSSISTGGNIF 477
           D  + DI+ I   S VPSA+KAPGYSSTWT A P  ISTGGNIF
Sbjct: 494 DGGSEDIEEIV--STVPSAVKAPGYSSTWTSAIP--ISTGGNIF 533

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 15/106 (14%)

Query: 27  SRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSD--YQELE 84
           +++SQ  + F+ L F+KL G   D+ +          N    Q    KR   D      E
Sbjct: 25  AKYSQDESKFVKLSFDKLRG---DLVE----------NARAGQIPRVKRVKRDDGTASFE 71

Query: 85  IKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGST 130
           I NQ +FYS+ + +G+P Q+VT+ IDTGSSD+WV GSNNPYC GS+
Sbjct: 72  IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSS 117

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  272 bits (696), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 166/453 (36%), Positives = 239/453 (52%), Gaps = 54/453 (11%)

Query: 68  KQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCN 127
           K S L  +    Y  + I + + +Y + L +GTPGQNVT+ +DT SSD+WVT  +NP C+
Sbjct: 50  KSSRLPLQKRDTYATVNI-SAEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLCD 108

Query: 128 GSTFSDTV------------------------------------------PSRELFNCSQ 145
           G  F D V                                          P+  L +C  
Sbjct: 109 GDIFYDNVEKTAKHVVVAAAEESTVSDGDSNGLLDGEPVSTTPFESSVIYPAEGLVDCGF 168

Query: 146 YGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXX 205
           +G                  I Y D + A G WG+DV+SI GL+++G+ F          
Sbjct: 169 FGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANYTNSSL 228

Query: 206 XXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFG 265
             LGIGL   ETTY     ++SY Y N P+VLK +G+ +S +YSL L   +  +  +LFG
Sbjct: 229 GVLGIGLPGSETTY----LTNSYMYDNLPMVLKKSGVIDSAAYSLLLAAYNNYTSGLLFG 284

Query: 266 AVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDS 325
           AVDHSKYSG+LYT+P++N Y+ RG+ +P+EF VT+ G+GI S    TTI   K  A+LDS
Sbjct: 285 AVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSNTTIATMKTPALLDS 344

Query: 326 GTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF 385
           G++    P T+++  A  LN  YS     Y +  S     N + VFDFGGF I   +   
Sbjct: 345 GSTAIFFPTTLLNLAAEQLNATYSEEKGLYTIPYS---PANISFVFDFGGFHINLPIREL 401

Query: 386 I-LEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVI 444
             +   +   IL + + +EN ++LG+ FLA AYVV+D EN +ISM Q+ +D +  DI+ I
Sbjct: 402 CSVSYGEPEYILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSYDYAEEDIEAI 461

Query: 445 RGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
              S VP A+K   YS++W++   SI++GG+IF
Sbjct: 462 I--STVPGAVKVASYSNSWSSF-GSITSGGDIF 491

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  270 bits (689), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 164/435 (37%), Positives = 240/435 (55%), Gaps = 35/435 (8%)

Query: 71  ELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC-NGS 129
           EL KRA +D     + N    Y++ + +GTP QN+TVQ+DTGSSDLW   ++NPYC N  
Sbjct: 30  ELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYCKNNK 89

Query: 130 TFS----DTVP----------------SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYG 169
            F+    D +P                +    NC++YG                  + YG
Sbjct: 90  KFAPKKQDLMPITSDDGFPTSPNQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYG 149

Query: 170 DTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTY----NGSNSS 225
           D TFASG WG D +S+NG+ V  +TF             GIGL   E+TY      +N +
Sbjct: 150 DETFASGPWGTDTISLNGVKVENVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGT 209

Query: 226 HSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTY 285
            +  Y+NFP+ LK  G  + ++YS++LN   ++ GSILFGAVDHSKYSG LYTLP+VN +
Sbjct: 210 TNTQYSNFPLQLKQQGKIDKVAYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRF 269

Query: 286 KDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLN 345
                 NP E  VTL G+G+   +   T+    L A+LD+GT+ T +P ++   +A+  N
Sbjct: 270 -GHLVENPYELEVTLSGLGLQRATSNITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTN 328

Query: 346 G---RYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVD 402
           G   + + LI   L  C  + S +T +VF+F G  IK  + +F+ E     C L   S +
Sbjct: 329 GVIDKKTSLIK--LAKCPSKKSNDT-IVFNFSGAQIKIKMVDFV-EKHKGKCYLPCVSQE 384

Query: 403 ENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSST 462
            +  +LGD+F+   Y V+DL++ +IS+AQA F+++  DI+ I  +S VPSA+KAP Y S+
Sbjct: 385 SSFFLLGDSFMRHVYTVFDLDDKEISIAQANFNSTKEDIEEI--SSTVPSAVKAPQYYSS 442

Query: 463 WTATPSSISTGGNIF 477
           +   P+ IS  G+IF
Sbjct: 443 YVDFPTEISVTGDIF 457

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  268 bits (685), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 193/523 (36%), Positives = 264/523 (50%), Gaps = 90/523 (17%)

Query: 31  QHNNGFLD----LQFNKLYGTSFDIAKKWQDINLG---QHNLNFKQSELYKRASSDYQEL 83
           ++N+ F D    L  NK YG S          NLG     +++   + L KR    ++ +
Sbjct: 20  ENNDAFQDKVLRLDINKFYGDS--------KFNLGSEIDEDISTPSARLVKREDG-HEII 70

Query: 84  EIKNQQSFYSL--------------------DLFI----------GTPGQNVTVQIDTGS 113
           EI+NQQ+FYS+                    DL++          GT  + V+  I+  S
Sbjct: 71  EIQNQQAFYSVDLMLGTPPQKVTVLVDTGSSDLWVTGNNNPYCIDGTSSKAVSSNIEDDS 130

Query: 114 S-------------------------DL-WVTGSNNPYCNGSTFSDTVPSRELFNCSQYG 147
                                     DL ++  S +   N S   D  P     +CS YG
Sbjct: 131 QTKNPISKVVGTTINKIRKYFSHNLPDLSFLEDSGSGKYNSSQLKDVTPQDAHIDCSTYG 190

Query: 148 XXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSI-NGLNVTGLTFXXXXXXXXXXX 206
                             I+YGD TFASGTWGRD +   + LN+T  +F           
Sbjct: 191 TFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADLTNSTIS 250

Query: 207 XLGIGLTQLETTYNGSNSSHS-YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFG 265
            LG+GL +LE TY+G +   S YTYANFP+ LK +GL + + YSL+LN+  A +GS+LFG
Sbjct: 251 VLGMGLPRLEVTYSGLSLDRSPYTYANFPMALKQSGLIDRMVYSLYLNKAGASTGSVLFG 310

Query: 266 AVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKT-TITQTKLAAILD 324
           AVDHSKY G+L T+PL++     G   PI F V LQG+G+ S S+ T T   T L A+LD
Sbjct: 311 AVDHSKYHGSLNTIPLISL---SGSGIPIAFNVALQGLGMSSDSQGTQTFLSTPLPALLD 367

Query: 325 SGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSN 384
           SGT++T LP  ++ ++AS+L   +      YL+ C    S +    FDFGGF I   LSN
Sbjct: 368 SGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCP-SGSDDREFNFDFGGFQISVPLSN 426

Query: 385 FILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNST-SDIDV 443
           FILE   D+C+L L        ILGD+FL  AYVVYDLENL+ISMAQA++D+   SDI+ 
Sbjct: 427 FILEALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEISMAQARYDDDNDSDIEK 486

Query: 444 IRGN---------SGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
              +         S +PSA +APGYSST     S+I   GN++
Sbjct: 487 YNADNKVLLEVVTSNIPSANQAPGYSSTLI-NRSTIQPSGNMY 528

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  275 bits (702), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/419 (38%), Positives = 241/419 (57%), Gaps = 21/419 (5%)

Query: 63  HNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSN 122
           +N +  +++L KR   D +++ + N+ +FYS ++ +GTP Q + V +DTGSSDLWV G +
Sbjct: 47  YNTSTSETKLVKR---DGEDIVLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHD 103

Query: 123 NPYCNGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDV 182
           N  C        + S   FNC ++G                  I Y       G WG+D 
Sbjct: 104 NLTC-------PLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDN 156

Query: 183 MSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGL 242
           + I G+N TGL+F            LGIGL   ETT  G      Y Y NFP+VLKN G+
Sbjct: 157 LIIGGVNATGLSFGVVHTTTSSAGILGIGLPDTETTAVGQYGH--YKYDNFPMVLKNKGI 214

Query: 243 TESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQG 302
                YS++L+   +  G  L G VD SKY+G LY LPLVN Y    F +P +F VTLQG
Sbjct: 215 ISHQGYSIYLDSSSSTYGEFLLGGVDTSKYTGTLYKLPLVNWYNTY-FSSPGDFHVTLQG 273

Query: 303 IGIVSGS-KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSL 361
           +G+++ S    T+T+TK+A ILD+G+++T +P T+ +++ SSL G YS    +Y+ +C  
Sbjct: 274 LGLITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPT 333

Query: 362 RNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYD 421
             S    LVF+FGG   K  +S+FI  + D++C L +SS  +++ ILGD FL + Y  +D
Sbjct: 334 ETS---KLVFNFGGINYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFD 390

Query: 422 LENLQISMAQAKFDNSTSDID---VIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
           LEN +I +A A FD+S+++     VI   SG+P A++AP YS+TW  T  ++ TGG++F
Sbjct: 391 LENKEIGLAMADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATW-VTYEAVVTGGSMF 448

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  260 bits (664), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 164/428 (38%), Positives = 230/428 (53%), Gaps = 42/428 (9%)

Query: 82  ELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGS------------ 129
           +LE++N    Y++ L +GTP QN+TVQ+DTGSSDLW T   NPYC  +            
Sbjct: 40  QLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNRKHSPKKSQIEP 99

Query: 130 -------TFSDTVP-SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRD 181
                  T  + +P S    +C  +G                  + Y DTTFASG WG D
Sbjct: 100 LNDADYPTSPNQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVD 159

Query: 182 VMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETT----YNGSN-SSHSYTYANFPVV 236
            +S NG+ V  +TF             GI L   ETT     NGS    +SY Y+NFP++
Sbjct: 160 TLSFNGVKVDNVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPML 219

Query: 237 LKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNT-YKDRGFPNPIE 295
           LK  G+ + I+YS++LN+  ++ GSILFGAVD SKY G LYTLPLVN+ YK      P +
Sbjct: 220 LKEQGIVKKIAYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQ--VSKPFQ 277

Query: 296 FAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDS- 354
           F +TL GIG+ +  K  T+   KLA +LD+G + +VLP  +   +AS +NG     ID  
Sbjct: 278 FEITLNGIGLQTADKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNG----TIDDD 333

Query: 355 ----YLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDE-NSVILG 409
                L  C  +    T +VF+FGG  I   + +   +I+   C L + + D+     LG
Sbjct: 334 NGFIKLDKCPNKKEKRT-VVFNFGGAEISIDIRDLTRKIKGK-CYLQMQARDDIEFAALG 391

Query: 410 DTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSS 469
           D FL   YVVY+LE+ +IS+A A F+ ST DI  I   S VP A+KAP Y +T++  P++
Sbjct: 392 DIFLRHVYVVYNLEDEEISIANANFNYSTPDIQEIV--STVPGAVKAPQYYNTYSVYPTA 449

Query: 470 ISTGGNIF 477
            +  G++F
Sbjct: 450 TAVTGDVF 457

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  260 bits (664), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 167/491 (34%), Positives = 262/491 (53%), Gaps = 37/491 (7%)

Query: 70  SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGS 129
           S L KRA  D   + ++N    Y + L +GTP Q V+VQ+DTGS+DLW +G++NPYC   
Sbjct: 28  SVLEKRAD-DLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCK-- 84

Query: 130 TFSDTVP-SREL---------------------FNCSQYGXXXXXXXXXXXXXXXXXXIQ 167
           T     P S++L                      +C +YG                  + 
Sbjct: 85  TNKKKAPKSKDLQPVDNSGFPTNPDQIGKKARNLDCKKYGFFNMSSSSTFKNNDTDIFLY 144

Query: 168 YGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTY----NGSN 223
           Y D +F  GTWG DV+S+ GLN++G+ F            LG+ L   E+TY    NG+ 
Sbjct: 145 YEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEISNSSSGVLGVSLPSEESTYSINSNGTT 204

Query: 224 SSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVN 283
           ++ +Y Y+N P+ LK  G+ + ++YS++LN+  ++ GSILFGAVDHSKY+G LYTLPLVN
Sbjct: 205 NATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVN 264

Query: 284 TYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASS 343
           +  D     P E  +TL GIG  S S   T+   K+AA++DSGT+++  P  I+  +A  
Sbjct: 265 SEYDV-VNKPYELDITLNGIGYQSMSSNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQ 323

Query: 344 LNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGL--SSV 401
           +N    P  +   ++       N  L+F+ GG  I   +  F  +++   C L +  S  
Sbjct: 324 MNATVDPNGNGIRLAKCPSKKDNAKLLFNLGGALIYVDIKEFTTKVKGK-CYLEIIPSGA 382

Query: 402 DENSVILGDTFLASAYVVYDLENLQISMAQAKFDNS-TSDIDVIRGNSGVPSAIKAPGYS 460
           + + VILGD F+ S Y V+DLE  ++S+AQA F++S  + I+ I+  S VPSA+KAP Y 
Sbjct: 383 ESDLVILGDNFMRSVYTVFDLEANEVSIAQANFNSSLPAQIEEIK--STVPSAVKAPQYY 440

Query: 461 STWTATPSSISTGGNIF-PXXXXXXXXXXXXHKGNSDASTTSSTQTKKNYGNRENPRILS 519
           +T++A  S  S  G+IF P               ++ +++++ +  +++Y N   P  L+
Sbjct: 441 NTFSAIASISSVTGDIFGPEATAYMAPPANVSNSSNSSNSSAVSLERRSYDNAATPLRLN 500

Query: 520 SIYFLPIINLI 530
           SI  + +  ++
Sbjct: 501 SIILIGVAAIL 511

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  259 bits (661), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 166/487 (34%), Positives = 255/487 (52%), Gaps = 37/487 (7%)

Query: 70  SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGS 129
           S+L KR   +Y  + +KN    Y + L +GTP QN+TVQ+DTGSSDLW   ++NP+C  +
Sbjct: 29  SDLVKR-DDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNPFCKEN 87

Query: 130 -------------------TFSDTVP-SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYG 169
                              + S+ VP S    NC +YG                  + Y 
Sbjct: 88  KKYAPKGKDVQPLDDSGYPSASNQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYA 147

Query: 170 DTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNG------SN 223
           D +FA+G WG DV+S N LN++ + F            LG+GL  +E+TY+G       N
Sbjct: 148 DMSFATGNWGSDVVSFNELNISNVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKN 207

Query: 224 SSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVN 283
            S S+ YANFP+ LK  G+ + I+YSL+LN   ++ GS+LFGAVDH++Y+G LYTLPL N
Sbjct: 208 ISDSHQYANFPITLKQNGVIDKIAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLAN 267

Query: 284 TYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASS 343
           +   + F +P +  +T+ G+G+       T+   K AA+LDSGT+LTV+   I   IA+ 
Sbjct: 268 SLF-QNFTDPFQLEITMNGLGLQGNDANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQ 326

Query: 344 LNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDE 403
           +NG  +       +        N  L+F+F G  +   + N ++      C L  +  ++
Sbjct: 327 VNGTIAGKDQCIRLPKCPSKKENKKLIFNFSGAEVAVDI-NQMMNKHKGKCYLQFAVHED 385

Query: 404 NS---VILGDTFLASAYVVYDLENLQISMAQAKFDNS-TSDIDVIRGNSGVPSAIKAPGY 459
            S   +I GD FL S Y+VY+LE+ +IS+A A F++S   +I+ I+  S VPSAI+AP Y
Sbjct: 386 TSNDAIIFGDNFLRSVYLVYNLEDKEISIAPANFNSSLPENIEPIK--STVPSAIRAPQY 443

Query: 460 SSTWTATPSSISTGGNIFPXXXXXXXXXXXXHKGNSDASTTSST--QTKKNYGNRENPRI 517
            +T++   ++ +  G+IF               G+S+ +  SS     K+ Y N+ + + 
Sbjct: 444 YNTYSEHATATAVTGDIFAPEATMSMAPINKTNGSSNRTLNSSRFDLQKRVYSNQASLKN 503

Query: 518 LSSIYFL 524
            S I F 
Sbjct: 504 SSLIAFF 510

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  258 bits (660), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 214/339 (63%), Gaps = 7/339 (2%)

Query: 142 NCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXX 201
           +CS+YG                  I YGD +FASG WGRD + +  LN++ ++       
Sbjct: 200 DCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDT 259

Query: 202 XXXXXXLGIGLTQLETTYNGSNSSHS---YTYANFPVVLKNAGLTESISYSLFLNELDAE 258
                 LGIGL  LETTY+   S  S   + Y+NFP+VLK  G+T+   YSL+LN  DA 
Sbjct: 260 NSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319

Query: 259 SGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTK 318
           +GSILFGAVD SK+ G+LYT+P++N YK RG   PI+F VTLQG+G+ + +  TT++ TK
Sbjct: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLSTTK 379

Query: 319 LAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTI 378
           + A+LDSG++L  LP  ++  +A  L  R+S  ++ YL+ C  ++   T +VF+FGGF I
Sbjct: 380 IPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD-ETKIVFNFGGFNI 438

Query: 379 KGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNST 438
           +  L+ +   I  D C+L +    ++S ILGD FL  AYVVYDLE+ +ISMAQA FD + 
Sbjct: 439 ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNH 498

Query: 439 SDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477
            DI+V+  +S +P A  A GYSST++++  SI++GGNIF
Sbjct: 499 EDIEVV--SSSIPQATAAAGYSSTYSSS-KSITSGGNIF 534

 Score = 79.0 bits (193), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (58%), Gaps = 24/121 (19%)

Query: 22  VLPEISR---FSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASS 78
           +L  ++R   FSQ     ++ Q  K+   SFD           +H  N+++S L KR + 
Sbjct: 11  LLANVARSAAFSQE----VEEQTPKIVKLSFD----------KRHGENYEESLLGKRDAL 56

Query: 79  DY-------QELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTF 131
            +        EL ++N+Q+FYS+DL +G+P Q +TV +DTGSSDLW+TGS+NPYC  ++ 
Sbjct: 57  PFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSH 116

Query: 132 S 132
           S
Sbjct: 117 S 117

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  256 bits (653), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 157/496 (31%), Positives = 241/496 (48%), Gaps = 52/496 (10%)

Query: 51  IAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQID 110
           + KK+  +   +   +     ++ +   DY  +++ N++  Y++ L +GTP QN+TV I+
Sbjct: 30  LPKKYVQMGFDKSCTSATGDMVFAKRDGDYVLVDLINEKILYTVQLAVGTPPQNITVSIN 89

Query: 111 TGSSDLWVTGSNNPYC--------------------------NGSTFSDTVPS------- 137
            GS+D W+T  +NPYC                          +  T S TV +       
Sbjct: 90  IGSADPWMTSPDNPYCEIKKHSGYEKQVGANTSVSLLSSLSNDRVTMSGTVTTGTSSSMV 149

Query: 138 RELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXX 197
           + + +C+ YG                  + Y D T AS  WG DV+ +  L +  ++F  
Sbjct: 150 QPIIDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEILDMSFGV 209

Query: 198 XXXXXXXXXXLGIGLTQLETT--YNGS-NSSHSYTYANFPVVLKNAGLTESISYSLFLNE 254
                      GIG   LETT  +N   +   SY YANFP  L N G  + ++YSLFLN+
Sbjct: 210 ANVFNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLND 269

Query: 255 LDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTI 314
             A  GS+LFGAVDHSKY  +L+T+PLVN ++D+G  +P  F V     G  +  +    
Sbjct: 270 SHAMKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNVFNARRGCPNKRRPQNR 329

Query: 315 TQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFG 374
              +   +LDSG +++ LP  ++  +  SLN  +   ++SY + C  +  T+    FD G
Sbjct: 330 RHDEFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSV-ASFDIG 388

Query: 375 GFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKF 434
            F I G LSNF+ + E + CIL L   D    IL D FL+ AYVV+DLE+ +ISM QA  
Sbjct: 389 RFHIDGPLSNFVRKYEKNKCILRLDPADNQPYILCDNFLSRAYVVHDLESYEISMGQANT 448

Query: 435 DNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIFPXXXXXXXXXXXXHKGN 494
           + +   I+ I+  S VP  ++AP Y  TW    + +S  GNI+                N
Sbjct: 449 EYAPEQIEAIK--SKVPGTVRAPSYDKTW-GNGTDVSPSGNIYTVST------------N 493

Query: 495 SDASTTSSTQTKKNYG 510
             ++TT S+  ++N G
Sbjct: 494 GTSTTTQSSNARENLG 509

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  249 bits (635), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 152/432 (35%), Positives = 235/432 (54%), Gaps = 28/432 (6%)

Query: 70  SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCN-- 127
           S+L KR   D +  ++   +  Y +++ +GTP Q V +QIDTGSSDL+V   +NPYC   
Sbjct: 28  SDLAKRDVVDPEAAQLTFDKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPYCKNN 87

Query: 128 -------------GSTFSDT---VP-SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGD 170
                        G  +  T   VP S    +C +YG                  I YGD
Sbjct: 88  KNKAPKKKDLESPGDDYPRTPNQVPKSDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGD 147

Query: 171 TTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNS---SHS 227
             F  GTWG D +S+  LN++ L+             LG+GL   E+T+N S++     +
Sbjct: 148 NGFVRGTWGTDSVSVGNLNLSNLSIGVSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSN 207

Query: 228 YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKD 287
           Y Y+NFP+ LK  GL E I+YS++LNE  ++ GSILFGAVDHSKY G LYT PLVN+   
Sbjct: 208 YQYSNFPIRLKEEGLIEKIAYSIYLNETGSKYGSILFGAVDHSKYQGPLYTFPLVNSKYK 267

Query: 288 RGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGR 347
            G  +P +F +T+ G+G+V  +   T+   KL  +LDSG+++++LP  +   +A  +NG 
Sbjct: 268 EG-SDPFQFEITMNGVGLVGKTDNITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGT 326

Query: 348 YSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDE-NSV 406
                +   +        N  L+F+F G      +++F +E     C L  S++D  N  
Sbjct: 327 VDGKGNCIKLPKCPSKKDNQKLIFNFSGAEFSVNVTDF-MEKHKGKCYLQFSALDGINFA 385

Query: 407 ILGDTFLASAYVVYDLENLQISMAQAKFDNS-TSDIDVIRGNSGVPSAIKAPGYSSTWTA 465
           +LGD F+ + Y V++L++ ++S+AQA +++S   DI+ I+    VPSA+ AP Y +T++A
Sbjct: 386 LLGDNFMNNVYTVFNLDDKELSLAQANYNSSLKPDIEEIKDT--VPSAVLAPQYYNTFSA 443

Query: 466 TPSSISTGGNIF 477
            P++ +  GNIF
Sbjct: 444 DPTATAVTGNIF 455

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  244 bits (624), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/397 (38%), Positives = 208/397 (52%), Gaps = 31/397 (7%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCN------------------GSTFSD 133
           Y +++ IGTP Q    Q+DTGSSD+    +++ YC                    S  S 
Sbjct: 66  YVVEMEIGTPPQAAYFQLDTGSSDMCANEADSSYCESFTDESNIWTSNYELTATASEISS 125

Query: 134 TVPSRELFN--CSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVT 191
           T  S + +N  CS +G                  I Y D  + +GT+G DV+S+  + ++
Sbjct: 126 TATSSKAYNTPCSYWGTFSPNVSSTFKYNETIFNISYADNMYYAGTYGTDVVSLGNITLS 185

Query: 192 GLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHS----YTYANFPVVLKNAGLTESIS 247
             TF            LG+ L  +E T +  ++  S    + Y NFP+ LK+ G  E I+
Sbjct: 186 NFTFGVSNDTKMSYGILGVSLPSVEETDDIEDALSSNTTPFVYENFPMALKSQGKIEKIA 245

Query: 248 YSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV- 306
           YSLFLNE  A  GSILFGAVD SKYSG LYTLP++  Y          F VT Q   I+ 
Sbjct: 246 YSLFLNEPSARFGSILFGAVDKSKYSGQLYTLPMLQAYNTLDALYSGMF-VTAQSAAIID 304

Query: 307 SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTN 366
           S S   T+++ +   + DSGTS +VLP  I  +I  S +G+YS   + Y+  CS  N  N
Sbjct: 305 SKSGNKTVSEVQFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVN--N 362

Query: 367 TNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQ 426
           T L  DFGGF I   +SNF+  +  D C+L +   D  SV LGD FL   YVVYDLEN +
Sbjct: 363 TQLSIDFGGFNISANISNFVTPLTKDHCVLQILPSDTVSV-LGDAFLVDTYVVYDLENHE 421

Query: 427 ISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTW 463
           +S+AQA F+N   DI++I  +  VP A  APGYSSTW
Sbjct: 422 VSVAQASFNNEEEDIEII--SDSVPGATPAPGYSSTW 456

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  244 bits (624), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 167/446 (37%), Positives = 238/446 (53%), Gaps = 40/446 (8%)

Query: 65  LNFKQS---ELYKRASSDYQELEIKNQQS--FYSLDLFIGTPGQNVTVQIDTGSSDLWVT 119
           L+F++S   +L KR   D Q++++ N Q    Y++ L +GTP QN+T Q+DTGSSDLW  
Sbjct: 17  LDFEKSHGDDLVKR---DVQDVKLINSQKAMLYNIQLSVGTPPQNITAQLDTGSSDLWFP 73

Query: 120 GSNNPYCNGS-----------------TFSDTVP-SRELFNCSQYGXXXXXXXXXXXXXX 161
            S NPYC  +                 T    VP S    +C+++G              
Sbjct: 74  DSTNPYCKANKKQAPKSIASLDAGTRPTSPAQVPKSLRNLDCAEFGLFNSSASTTFNSNK 133

Query: 162 XXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYN- 220
               I Y D+++A G W  D + +NGLN++GL F            LG+GLT LE +Y+ 
Sbjct: 134 TEFFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYDT 193

Query: 221 --GSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYT 278
               + S  + Y NFP +LK  G    ++YSL+LN+  ++ G ILFG VDHSKY G LYT
Sbjct: 194 DIKQDDSPRFQYPNFPQILKQKGAISKVTYSLYLNDTKSKYGQILFGGVDHSKYVGQLYT 253

Query: 279 LPLVNTYKDRGFPNPI-EFAVTLQGIGI--VSGSKKTTITQTKLAAILDSGTSLTVLPGT 335
           +PLVN+ K +  P  I +  VTL G+GI   + +  TT+   KL A+ DSGTS + +P T
Sbjct: 254 IPLVNS-KYQKSPGVIADLEVTLNGLGIRDNTTNTNTTLYTQKLPALFDSGTSYSYVPYT 312

Query: 336 IIHSIASSLNGRYSPLIDS-YLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDIC 394
           +   IAS +NG      ++  L  C  +  T   +VF+F G  I   L  F  + +   C
Sbjct: 313 MAQVIASQVNGTIDNKTEAIRLPKCPSKKDTR-EVVFNFNGVEIAIPLKQF-YQKKSGKC 370

Query: 395 ILGLSSVDENS---VILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVP 451
            L L     N+   ++LGDTFL   Y V+DLE  ++S+A+A F NS+   DV    S VP
Sbjct: 371 YLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIARANF-NSSLPADVEEIKSTVP 429

Query: 452 SAIKAPGYSSTWTATPSSISTGGNIF 477
           SAIKAP Y +T++A  ++    GNIF
Sbjct: 430 SAIKAPQYYNTFSAYDNATQVVGNIF 455

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  241 bits (615), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 166/450 (36%), Positives = 252/450 (56%), Gaps = 44/450 (9%)

Query: 31  QHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQS 90
           + ++GF+ + FN+LYG S D A               K+S  + + S +Y+++ +KN+  
Sbjct: 26  ESSSGFVSMNFNRLYGASPDTAVS-------------KRSMSHIKRSENYEQVRLKNEAC 72

Query: 91  FYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXX 150
           FYS+DL IG+  QNVTV +DTGSSDLWV G ++    G  FS    +   FN +++    
Sbjct: 73  FYSMDLAIGSNHQNVTVLVDTGSSDLWVPGPDSSASYG-VFSPKDSTSLKFNGTEFST-- 129

Query: 151 XXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGI 210
                           QY D T A G W  D +++    V+ +TF            LG+
Sbjct: 130 ----------------QYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDSNFGVLGL 173

Query: 211 GLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHS 270
           GLT LE TY  + SS  Y Y NFPV L   GL ++ +YSL+LN+ DA SG++LFGAVDH+
Sbjct: 174 GLTGLEATYTNALSS-PYQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNVLFGAVDHA 232

Query: 271 KYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLT 330
           KY+G L+T+P VNT +  G+ + IEF VTL G+ + +   +TT+T +K   ++DSG + +
Sbjct: 233 KYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQTTLTTSKFPVLVDSGNTFS 292

Query: 331 VLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE 390
            LP  ++  IAS +   YS     Y+++C   +  +T + ++FGGF I   LS  + E+ 
Sbjct: 293 YLPDNLLQQIASQIGATYSNEYVGYVLTCPSEDD-DTVISYNFGGFNIDTPLSGSVTELG 351

Query: 391 DD--ICILGLSSVDENSVILGDTFLASAYV--VYDLENLQISMAQAKFDNSTSDIDVIRG 446
           DD   CIL ++        LGDTFL + Y    + +E+L  S+AQA++   T + ++   
Sbjct: 352 DDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESL--SLAQAQY---TDEEEIEII 406

Query: 447 NSGVPSAIKAPGYSSTWTATPSSISTGGNI 476
           +S +P AIKA GYS  W+A+  + ST GN+
Sbjct: 407 SSSIPGAIKAAGYSDIWSASAKN-STSGNV 435

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  241 bits (614), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 150/402 (37%), Positives = 225/402 (55%), Gaps = 25/402 (6%)

Query: 62  QHNLNFKQSELYKRAS-SDYQELEIKN-QQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVT 119
           + NL   +++  KR S S + E+E+++ +Q++Y+  L IGTP QN+TV  D+GSSDLWV 
Sbjct: 30  EPNLRSSKNQYAKRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVM 89

Query: 120 GSNNPYC----------NGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQY- 168
            ++NPYC          NGS+ +         +CS +                     Y 
Sbjct: 90  DASNPYCESQYTGSQTYNGSSINQA----STIDCSSFMTFNKSLSSSFKTKGTSRFYAYY 145

Query: 169 GDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHS 227
            D TFA G+W  + +++NG++V+ L F             LGIG  + E+     N+ + 
Sbjct: 146 SDKTFADGSWATEKLTMNGVDVSSLQFGLGNCVTTPVSGVLGIGFPRRESVKGYDNAPNE 205

Query: 228 YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKD 287
           + Y NFP VLKN G+ + ++YS+FLN+L++++GSILFGA+D SKY+G+L T P++N Y D
Sbjct: 206 F-YPNFPQVLKNQGIIDVVAYSMFLNKLESDTGSILFGAIDTSKYTGDLVTFPMLNIYPD 264

Query: 288 RGFPNPIEFAVTLQGIGIV--SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLN 345
                P    V LQG+G    +  K  T   +K+  +LDSGT+L   P  I   +A  +N
Sbjct: 265 VT-DKPATLMVILQGLGAQDNANCKAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMN 323

Query: 346 GRYSPLIDSYLVSCSLRNS-TNTNLVFDFGGFTIKGTLSNFILEIEDD--ICILGLSSVD 402
             +S     Y++ C  + +  NT+ +FDFGG  IK  LSNFIL  + +   C   +   D
Sbjct: 324 ATFSEDEGIYIMECPTKETLANTDYIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDD 383

Query: 403 ENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVI 444
            N+++LGD FL+SAYVV+DL+N QIS+A A  DN+ S  D I
Sbjct: 384 SNTMVLGDIFLSSAYVVFDLDNYQISLAAANLDNNVSLEDSI 425

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  239 bits (611), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 153/403 (37%), Positives = 212/403 (52%), Gaps = 32/403 (7%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG---------STFSDTVPSRELFN 142
           Y + + IGTP Q   +Q+DTGSSD+ +  ++  YC           S +  T  + E+ +
Sbjct: 70  YVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCESLADENNISTSNYELTATAIEILS 129

Query: 143 -----------CSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVT 191
                      CS +G                  + YGD ++ +GT+G DV+S+  + ++
Sbjct: 130 TAAPSAAYNAPCSYWGTFSPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLS 189

Query: 192 GLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHS----YTYANFPVVLKNAGLTESIS 247
             TF            LG+ L   E T +  ++  S    + Y NFP+ LK+ G  + I+
Sbjct: 190 NFTFGVSNDTTNNGGILGVSLPSAEVTDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIA 249

Query: 248 YSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV- 306
           YSLFLNE  A  GSILFGAVD S+YSG LYTLP++  Y      +   F VT Q + I+ 
Sbjct: 250 YSLFLNEPSARFGSILFGAVDKSEYSGQLYTLPMLQAYNTLDATDAGMF-VTAQSVAILD 308

Query: 307 SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTN 366
           S S   T+++ +   + DSGTS +VLP  I  +I  S +G+YS     Y+  C+  N  N
Sbjct: 309 SKSGNKTVSEVQFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVN--N 366

Query: 367 TNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQ 426
           T L FDFGGF I   +SNF+   +D  CIL +   D    +LGD FL   YVVYDLEN +
Sbjct: 367 TLLSFDFGGFNISANISNFVTPAKDH-CILQILPSD-TIFVLGDAFLVDTYVVYDLENHE 424

Query: 427 ISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSS 469
           +S+AQA FDN   DI +I  +  VP A  APGYSSTW  TP S
Sbjct: 425 VSVAQASFDNKEEDIGII--SDSVPGATPAPGYSSTWRYTPGS 465

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  236 bits (603), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 192/315 (60%), Gaps = 13/315 (4%)

Query: 166 IQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSS 225
           I+YGD ++ASG W  D +++  ++V  +T              GI    LE++  G N  
Sbjct: 202 IEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGLESSVFGDNLQ 261

Query: 226 HSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTY 285
             + Y NFP +LK+ G+ +  +YSL+LN   A  G+ILFG VDH+KYSG+LYTLP++   
Sbjct: 262 DPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSGDLYTLPVLKGQ 321

Query: 286 KDRGFPNPIE-FAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSL 344
           +D    +P E F VT+QGIGI     + T+T T    +LDSGT+   LP  +   +A++ 
Sbjct: 322 EDS---DPWERFVVTVQGIGIKGSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVANAY 378

Query: 345 NGRY--SPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVD 402
            G +   P + SY++SC    S +  +VF+FGGF I+ +LSN+I +  +  CIL +S   
Sbjct: 379 GGSFDDDPEVQSYVISCP---SDDEKIVFNFGGFNIETSLSNYITDNGNGQCILNISPTS 435

Query: 403 ENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSST 462
           +   ILGD+FL  +YVVYD++N +IS+AQA FD ST D++ I G   VP A KAPGYSST
Sbjct: 436 DYMGILGDSFLRDSYVVYDMDNNEISLAQANFD-STEDVEAITGP--VPGATKAPGYSST 492

Query: 463 WTATPSSISTGGNIF 477
           ++  P +  TGGNIF
Sbjct: 493 YSG-PQTFQTGGNIF 506

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 14/93 (15%)

Query: 34  NGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYS 93
           +G   + F+K YG SFD +++          ++F +    K    D QE++I NQ  +YS
Sbjct: 27  DGVGKIPFSKRYGKSFDESRQ----------ISFSE----KGTGGDDQEIDISNQNVYYS 72

Query: 94  LDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126
             +++GTPGQ +T+ +DTGSSDLW+      +C
Sbjct: 73  ASIYLGTPGQELTLLLDTGSSDLWIPQKGGYHC 105

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  226 bits (577), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 184/310 (59%), Gaps = 11/310 (3%)

Query: 168 YGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYN--GSNSS 225
           YGD T+  GT+G DV+S+  + +   +F            LGI L   E T++  G+ ++
Sbjct: 9   YGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGGAYNT 68

Query: 226 HSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTY 285
             + Y NFP+ LK+ G  E I+YSLFLNE  A  GSILFGAVD SKYSG LYTLP++  Y
Sbjct: 69  TPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAY 128

Query: 286 KDRGFPNPIEFAVTLQGIGIVSG-SKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSL 344
                 +P  F VT Q + +++G S   T+++ +   + DSGT+ + LP  + H+I  S 
Sbjct: 129 DTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSF 187

Query: 345 NGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDEN 404
           +G+YS     Y   CS     +T L  DFGGF I   +SNF+   +D  C+L + + D +
Sbjct: 188 DGKYSSGDQGYTFDCS--KVKDTLLSIDFGGFNISANISNFVTRTKDH-CLLNIEAAD-S 243

Query: 405 SVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464
             +LGD FL  AYVV+DLE+ ++S+AQA FD+   +I+VI     VP AI+APGYSSTW 
Sbjct: 244 GFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDR--VPGAIRAPGYSSTWV 301

Query: 465 ATPSS-ISTG 473
            TP S I TG
Sbjct: 302 YTPGSPIGTG 311

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  230 bits (586), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 169/453 (37%), Positives = 232/453 (51%), Gaps = 42/453 (9%)

Query: 49  FDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQ 108
           F + K    IN+   ++    S ++KR  ++     + N    Y + + IGTP Q + +Q
Sbjct: 30  FPVQKLADIINICTQDV----STVFKR--NEVLNTTVINGIGVYVVKMEIGTPPQTLYLQ 83

Query: 109 IDTGSSDLWVTGSNNPYC----NGSTFSDT-----------VPS----RELFN--CSQYG 147
           +DTGSSD+ V  ++  YC    +GS ++ T           +PS     E +N  CS +G
Sbjct: 84  LDTGSSDMIVNNADIAYCKSMSDGSDYASTDNYELTATFNGLPSTTISSEAYNTLCSYWG 143

Query: 148 XXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXX- 206
                               YGD T+ +GT+G DV+S   + +   TF            
Sbjct: 144 TFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNPSG 203

Query: 207 XLGIGLTQLETT----YNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSI 262
            LGI L   E T    Y  + +   + Y NFP+ LKN G    I+YSLFLN  DA  GSI
Sbjct: 204 ILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKINKIAYSLFLNGPDAHFGSI 263

Query: 263 LFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV-SGSKKTTITQTKLAA 321
           LFGAVD SKY+G LYTLP++  +   G  NP    +T Q + I+ S S   T++  +   
Sbjct: 264 LFGAVDKSKYTGQLYTLPMLQAFNTLG-SNP-GMIITAQSVAILDSESGNKTVSDIQFPV 321

Query: 322 ILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGT 381
           +LDSGT+ + LP  I  +I  S +G YS     Y+  CS  N  +T L  DFGGF I   
Sbjct: 322 MLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKVN--DTLLSVDFGGFNISAN 379

Query: 382 LSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDI 441
           +SNF+   +D  C+L +    E++ +LGD FL  AYVVYDLEN +IS+AQA F+N   DI
Sbjct: 380 ISNFVTSAKDR-CVLNVKQ-SESTYMLGDAFLVDAYVVYDLENYEISIAQASFNNQEEDI 437

Query: 442 DVIRGNSGVPSAIKAPGYSSTWTATPSS-ISTG 473
           +VI     VP A  APGY STW   P S I TG
Sbjct: 438 EVISDT--VPGATPAPGYFSTWVYKPGSPIGTG 468

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  228 bits (582), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 152/406 (37%), Positives = 220/406 (54%), Gaps = 46/406 (11%)

Query: 168 YGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGS----- 222
           YGD ++ASG WG D + +  L++  + F            LG+GL  LE+ YN +     
Sbjct: 194 YGDNSYASGLWGTDDVRLGNLSIADVFFAVANFSNSSTGVLGVGLPALES-YNPALSDNF 252

Query: 223 --------NSSHS-------YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAV 267
                   N+S +        TYANFP +LK   + E ++YSLFLN+ +A +G ILFGAV
Sbjct: 253 NVSDYLPVNASDADIDNISKPTYANFPQILKQKNVIEKVAYSLFLNDTNATNGQILFGAV 312

Query: 268 DHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGT 327
           DHSKY+G+L TLPLVN+    G  +  +  +TL G+G+ +   + TI   K+ A+LDSGT
Sbjct: 313 DHSKYTGSLSTLPLVNSLYVEGINDTTQLEITLDGMGLKNSQGQFTIYNQKMPALLDSGT 372

Query: 328 SLTVLPGTIIHSIASSLNGRYSP---LIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSN 384
           +++ LP  +   +A  L G   P    I+  L +C  +N  NT LVF+FGG  I    + 
Sbjct: 373 TVSYLPIDLHSLVAKQLKGIVDPQTGFIE--LKNCPAKND-NTQLVFNFGGAFISIKYTE 429

Query: 385 FILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVI 444
           FI + +DD C +      E  ++LGD FL +AY+VYDLE+++IS+AQA F+    +I+ I
Sbjct: 430 FIEKSDDDNCYVTFMPQGEPGILLGDNFLRNAYIVYDLEDMEISIAQANFNGGAENIEAI 489

Query: 445 RGNSGVPSAIKAPGYSSTWTATPSSISTGGNIFPXXXXXXXXXXXXHKGNSDASTTSS-- 502
             N  VPSA+KAPGYS+++T  PSS +T GNIF              K    +S TS   
Sbjct: 490 VKN--VPSAVKAPGYSASFTEFPSSYATTGNIFSGYNSTNSTGSAGSKTTMTSSRTSRNT 547

Query: 503 ------------TQTKKNYG-NRENPRILSSIYFLPIINLILDPLF 535
                       T+ KKN G   E P  +S+I  + + N++L  L 
Sbjct: 548 NTASAAGNSSSSTRAKKNAGFAHEVP--VSAISVIMVFNILLSMLL 591

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 9/87 (10%)

Query: 52  AKKWQDINLGQHNLNFKQS---------ELYKRASSDYQELEIKNQQSFYSLDLFIGTPG 102
           A+K+  ++  +H  +  +          +L KRAS D     +  Q+++YS++L +GTP 
Sbjct: 18  AEKYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPLVAQENYYSINLEVGTPP 77

Query: 103 QNVTVQIDTGSSDLWVTGSNNPYCNGS 129
           QNV++ +DTGSSD+WV GSNN YC  S
Sbjct: 78  QNVSLLLDTGSSDMWVIGSNNGYCKNS 104

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  222 bits (566), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 184/314 (58%), Gaps = 25/314 (7%)

Query: 166 IQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNG---- 221
           I Y D ++ +GT+G D++S+  + ++  TF            LGI L   E T +G    
Sbjct: 10  ITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAEITDSGQGAL 69

Query: 222 SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPL 281
           S+++  + Y NFP+ LKN G  E I+YSLFLNE +A  GSILFGAVD SKY+G LYTLP+
Sbjct: 70  SSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYTGQLYTLPM 129

Query: 282 VNTYKDRGFPNPIE-----FAVTLQGIGI---VSGSKKTTITQTKLAAILDSGTSLTVLP 333
           +  Y      N ++       VT Q + I   +SG+K  T+++ +   + DSGTS +VLP
Sbjct: 130 LQAY------NTLDALGGGMLVTAQSVAILDSISGNK--TVSEVQFPVLFDSGTSTSVLP 181

Query: 334 GTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDI 393
             I  +I  S +G+YS   + Y+  CS  N  NT L  DFGGF I   +SNF+  +  D 
Sbjct: 182 TEIADAIGRSFDGKYSSDDEGYIFDCSKVN--NTQLSIDFGGFNISANISNFVTPLTKDH 239

Query: 394 CILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSA 453
           C+L +   D  SV LGD FL   YVVYDLE+ ++S+AQA F+N   DI++I  +  VP A
Sbjct: 240 CVLQILPSDTVSV-LGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEII--SDSVPGA 296

Query: 454 IKAPGYSSTWTATP 467
             APGYSSTW  TP
Sbjct: 297 TPAPGYSSTWVYTP 310

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  225 bits (574), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 144/429 (33%), Positives = 218/429 (50%), Gaps = 37/429 (8%)

Query: 72  LYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC----- 126
           L KRA  DY  +++ N+Q FY +++ IG+  QN+T+ +DTGSSD WV G+ NPYC     
Sbjct: 28  LAKRADDDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNRG 87

Query: 127 ----------------NG-STFSDTVPSREL-FNCSQYGXXXXXXXXXXXXXXXXXXIQY 168
                           NG  T ++ +P  E  F+CS +                   I Y
Sbjct: 88  KKPKKKDQPSSVDPGRNGYPTKAEAIPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITY 147

Query: 169 GDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETT-------YNG 221
           GD ++  GTWG D +++ G  +  +TF            LGIGL +LE++          
Sbjct: 148 GDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTN 207

Query: 222 SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPL 281
           ++S     Y NFP  LK   L   + YS++LN  + + GSILFGAVDH++Y GNL T+PL
Sbjct: 208 TSSVKKNPYMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPL 267

Query: 282 VNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTI---TQTKLAAILDSGTSLTVLPGTIIH 338
           V + +D G P P E  VTL G+   +     T      +K  A+LD+G++ T LP  + +
Sbjct: 268 VFSNRDFGTPRPNELMVTLNGMSFEATDGNVTQILNATSKFPALLDTGSTDTHLPVDVYN 327

Query: 339 SIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGL 398
           ++A S NG Y    +   +   L     T L F  GG  I       + +I+   C + +
Sbjct: 328 ALAESTNGTYDQTQNKIRIPKCLSKKDKTILNFSLGGVNIGVPYKEMVKKIKGK-CYINV 386

Query: 399 SSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNS-TSDIDVIRGNSGVPSAIKAP 457
           +    +  ILGD  +  AY+V+DLE+ +IS+AQA F+++   DI+V+   S +P A +A 
Sbjct: 387 APTGSDFAILGDDVIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVV--STIPGATRAS 444

Query: 458 GYSSTWTAT 466
            YS T++ T
Sbjct: 445 AYSETYSPT 453

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  219 bits (557), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 174/309 (56%), Gaps = 7/309 (2%)

Query: 166 IQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGS--- 222
           IQY D ++ASG WG D + +  L V  ++F             GIG    E+++      
Sbjct: 216 IQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVANDTNSTTPVFGIGFPGGESSFASVGPE 275

Query: 223 -NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPL 281
             ++H + YANFP  LKN G+ + ++YSL+LN  ++  G++LFG VDHS+Y G LYTLP+
Sbjct: 276 YRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPNSTYGNVLFGGVDHSQYQGQLYTLPI 335

Query: 282 VNTYKDRGFPNPIE-FAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSI 340
           +         +P    A+TLQG+ +     K  +    +  +LDSGT+   LP  +  SI
Sbjct: 336 LQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKVKTKPIPVVLDSGTTAMYLPYKLAKSI 395

Query: 341 ASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSS 400
           AS  +G   P    Y++ C  ++  N  + FDFGG TIK  + N+I E  ++ C+LG+  
Sbjct: 396 ASRYHGILGPEDQGYIIDCP-KSGDNDYITFDFGGVTIKTDIRNYIFEQSENKCLLGIIP 454

Query: 401 VDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYS 460
             +   + GD FL  AYVVYDLE  +IS+AQA F++S+  I+ I  +SGVP A +APGYS
Sbjct: 455 NSDILAVFGDVFLTDAYVVYDLEGKEISLAQASFNSSSEQIEAIT-SSGVPGAKRAPGYS 513

Query: 461 STWTATPSS 469
            TW    SS
Sbjct: 514 KTWKVVHSS 522

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 61/103 (59%), Gaps = 21/103 (20%)

Query: 22  VLPEI--SRFSQHNNGFLDLQFNKLYGTSFDIA---KKWQDINLGQHNLNFKQSELYKRA 76
            LP +  SR SQ       + FNK+YG SF  A   +K+  +NL      F+     K  
Sbjct: 18  CLPAVHDSRSSQ---SVAKIGFNKVYGKSFSEATADRKY--VNL------FRN----KNI 62

Query: 77  SSDYQELEIKNQ-QSFYSLDLFIGTPGQNVTVQIDTGSSDLWV 118
           S D  E+ ++N   ++YS+++ +GTPGQN+T+Q+DTGSSDLWV
Sbjct: 63  SDDNDEVALQNNANTYYSVNISLGTPGQNMTIQLDTGSSDLWV 105

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  214 bits (546), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 156/478 (32%), Positives = 245/478 (51%), Gaps = 50/478 (10%)

Query: 21  MVLPEISRFSQHNNGF-LDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSD 79
           +VL E S+ + HN    L+L F+     +F    K   + L    +  ++  + +  S+ 
Sbjct: 31  LVLQEFSKMNLHNVILALNLLFSLNKCNAFPRQSKSGLLELELKRMPVEEKFIKRDGSA- 89

Query: 80  YQELEIKNQ--QSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC---NGST---- 130
            +EL++ N+      ++ + IG  GQN+    DTG SD WV G N+ YC   NG+T    
Sbjct: 90  -RELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYCDIENGTTPANH 148

Query: 131 ---FSDTVPS--RELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSI 185
              FS+   +     F C                       Q+ D TFASGTW +D + +
Sbjct: 149 TANFSENTFAFKNHAFPCYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEV 208

Query: 186 NGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTES 245
             + +    F            LG+GL   E T  G    ++YTY NFP  LKN+G+ + 
Sbjct: 209 GSIIIEKFNFGVAQETNATIGSLGLGLEGNEITNEGD---YTYTYENFPTKLKNSGMIKR 265

Query: 246 ISYSLFLNELDAESGSILFGAVDHSKYSGN-LYTLPLVNTYKDRGFPNPIEFAVTLQGIG 304
           + YS++  ++D E GS+LFGAV+HS+Y G+ LYTLPLVN   +    +P+EF VTLQ + 
Sbjct: 266 VIYSIYAGKIDTEDGSLLFGAVEHSRYVGDTLYTLPLVNV--NNASSDPVEFHVTLQNLV 323

Query: 305 IVSGSKKTTITQTKLAAILDSGTSLTVLPGTI----IHSIASSLNGRYSPLIDSYLVSCS 360
           +      TTI   + AA+L++G  +T LP  +    I     S + +Y  +   Y+  C 
Sbjct: 324 VSVNKTNTTIMSDRYAALLNTGAIVTYLPTHLFSDFIKKTGLSESQKYYGM---YVTDC- 379

Query: 361 LRNSTNTNLVFDFGGFTIKGTLSNFILEIEDD-----ICILGLSSVDENSVILGDTFLAS 415
              S+  +  +DFGGF I+ +L++++ EI++       C + ++S DE  ++LG  F +S
Sbjct: 380 ---SSEISFSYDFGGFKIESSLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSS 436

Query: 416 AYVVYDLENLQISMAQAK--FDNST-------SDIDVIRGNSGVPSAIKAPGYSSTWT 464
           AYVV+DLE L++S+AQA   +DN T        D++++     +PSA KA  YS+TWT
Sbjct: 437 AYVVFDLERLEVSIAQAAHVYDNFTYSNIEDNPDVEIVI--DSIPSATKAASYSNTWT 492

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  213 bits (542), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 208/413 (50%), Gaps = 38/413 (9%)

Query: 91  FYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG-----------------STFSD 133
            Y++ L +GTP QNVTVQ+DTGSSDLW   ++NPYC                   +T +D
Sbjct: 52  MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAPKKVKALPATGFATEND 111

Query: 134 TVPSR-ELFNCSQYGXXXXXXXXXXXXXXXXXX-IQYGDTTFASGTWGRDVMSINGLNVT 191
            V  +   F+C  +G                   ++Y D T+ASG WG D   +N  NV+
Sbjct: 112 QVAKKLRTFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTFKLNHHNVS 171

Query: 192 GLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSS----HSYTYANFPVVLKNAGLTESIS 247
            +TF            LG+G    ETT + S  S      Y Y NFP+ LK     + +S
Sbjct: 172 NITFALANIANASMGVLGVGFPAEETTDDPSPGSLIDKEHYQYDNFPIALKRTRTIKKVS 231

Query: 248 YSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVS 307
           YS+FLN+ +++ G ILFG VDHSKY G L+T+P+VN              +TL G+G   
Sbjct: 232 YSIFLNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPEITLNGLGFRD 291

Query: 308 GSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNST-- 365
             K  T+   K+  +LD+GT+L   P  ++  IA  +NG     IDS      L+     
Sbjct: 292 DKKNVTLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGT----IDSKTGGIKLKKCPNA 347

Query: 366 --NTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS---VILGDTFLASAYVVY 420
             N+ L+F+F G  I  +L N + E     C L +   +E S   ++LGD F+   Y V+
Sbjct: 348 KDNSELIFNFAGAEIPVSLLNMV-EKRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVF 406

Query: 421 DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTAT--PSSIS 471
           ++E++++S A A   N ++ + +    S VPSA+KAP Y +T+ ++  PS+++
Sbjct: 407 NMEDMEVSFAVAN-GNDSAPLQIEAIISDVPSAVKAPQYYNTFASSNLPSTVT 458

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  212 bits (539), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 147/409 (35%), Positives = 216/409 (52%), Gaps = 28/409 (6%)

Query: 78  SDYQELEI-KNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC----NGSTF- 131
           S + EL + + +Q +Y+  L IGTP Q +TV  DTGS+D WV  S+NP+C    N S + 
Sbjct: 30  SGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSNPSLYQ 89

Query: 132 ------SDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSI 185
                 S   PS +  + S Y                   I Y D TF+ G+WG++ +S+
Sbjct: 90  NATYNGSKITPSVDCSSMSTYNENSSSTYQDLDNGRFY--IIYADETFSDGSWGKETVSV 147

Query: 186 NGLNVTGLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTE 244
           NG+++  + F             LGIG  + E+      +   Y Y NFP +LK+  + +
Sbjct: 148 NGIDIPDIQFGLAKYATTPVSGVLGIGFPRRESVKGYEGAPDKY-YPNFPQLLKSEQIID 206

Query: 245 SISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIG 304
            ++YSLFLN  D+  GSI+FGA+D SK+ G+L T P+VN Y       P   A+T+QG+G
Sbjct: 207 VVAYSLFLNSPDSGMGSIVFGAIDESKFYGDLLTFPMVNEYPTI-VDAPATLAMTIQGLG 265

Query: 305 I--VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLR 362
               SG ++ T   TK   +LDSGTSL   P TI   +AS +N  YS     Y+++C   
Sbjct: 266 AQNKSGCERETFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCP-D 324

Query: 363 NSTNTNLVFDFGGFTIKGTLSNFIL--EIEDDICILGLSSVDENSVILGDTFLASAYVVY 420
           ++ +    FDFG   I   L++ IL  E+E   C   +   ++ S++LGD FL+SAYVV+
Sbjct: 325 SADDIEYTFDFGDLQINVPLTSLILSPEVEGGYCGFAVQPTND-SMVLGDVFLSSAYVVF 383

Query: 421 DLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSS 469
           DL+N +IS+AQA ++ S     VI     +P+    PG  S  TA P S
Sbjct: 384 DLDNYKISLAQANWNASEDSKQVIN----IPTDGSIPGGKSA-TAEPWS 427

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  211 bits (538), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 149/433 (34%), Positives = 213/433 (49%), Gaps = 27/433 (6%)

Query: 63  HNLNFKQSELYKRASSDYQ------ELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDL 116
           H+    Q +L K A    Q      E ++  Q  FY+++L +GTP Q +    DTGSSDL
Sbjct: 25  HDSKVIQLQLLKPADRSLQKRSKSFESKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDL 84

Query: 117 WVTGSNNPYCNGSTFSDTVPSRE--------LFNCSQYGXXXXXXXXXXXXXXXXXXIQY 168
           WV   +NP+C G+   DT  + E        + +C + G                   QY
Sbjct: 85  WVPAKSNPFCLGNKL-DTNGTNEFHGTEITPILDCDKIGVFDPGSSYSLSATGYNFSTQY 143

Query: 169 GDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSY 228
            D +++ G W  D +SI    V  L F            LG+GL +LE    G + + + 
Sbjct: 144 FDGSYSDGFWVVDDISIADQQVPDLQFAVANISSAPSGVLGVGLPRLEAV-RGYDGAPNA 202

Query: 229 TYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDR 288
            Y NFP  LK+  L   + YSL+ +  D ESG++LFG +D  KY G LYTLPLVN Y+  
Sbjct: 203 NYDNFPQTLKSNRLINRVLYSLYFDSGDLESGTVLFGGIDEKKYDGVLYTLPLVNIYEQ- 261

Query: 289 GFPNPIEFAVTLQGIGIVSGS--KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNG 346
               P  F +TLQG+GI S S  K T I   K  A+LDSG+++   P   + SIA  L  
Sbjct: 262 -IDEPAAFDITLQGLGIRSESNCKDTVIAHKKAPALLDSGSTIMGAPQEALESIAQELGA 320

Query: 347 RYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSN--FILEIEDDICILGLSSVDEN 404
            +S     Y++ C   N   T   FDFG   +K  + +  ++ E   + C L + +  E 
Sbjct: 321 AFSESDGLYVLDCPASNDDRT-FYFDFGELKLKVPIHDLLYLPESGQNYCGLAIIASGEE 379

Query: 405 SVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464
             ILGD  L SAYVVYDL+NL+IS+AQ K   S S I  +     +P   K+   S+ W+
Sbjct: 380 -WILGDLVLKSAYVVYDLDNLEISIAQVK-TTSGSRIQTVSATGSLPQTRKS--NSTPWS 435

Query: 465 ATPSSISTGGNIF 477
            + S+ S+  ++F
Sbjct: 436 LSGSTNSSTDSVF 448

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  210 bits (535), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 22/366 (6%)

Query: 88  QQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC----NGSTFSDTV-------P 136
           ++ +Y+  L IGTP Q++TV  DTGS+D WV  S+NP+C    N S++S+         P
Sbjct: 41  EEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNGEEVKP 100

Query: 137 SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFX 196
           S +  + S Y                   I Y D TFA G+WG + +SING+++  + F 
Sbjct: 101 SIDCRSMSTYNEHRSSTYQYLENGRFY--ITYADGTFADGSWGTETVSINGIDIPNIQFG 158

Query: 197 XXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNEL 255
                       LGIG  + E+      + + Y Y NFP +LK+  + + ++YSLFLN  
Sbjct: 159 VAKYATTPVSGVLGIGFPRRESVKGYEGAPNEY-YPNFPQILKSEKIIDVVAYSLFLNSP 217

Query: 256 DAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGI--VSGSKKTT 313
           D+ +GSI+FGA+D SK+SG+L+T P+VN Y       P   A+T+QG+G    S  +  T
Sbjct: 218 DSGTGSIVFGAIDESKFSGDLFTFPMVNEYPTI-VDAPATLAMTIQGLGAQNKSSCEHET 276

Query: 314 ITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDF 373
            T TK   +LDSGTSL   P  I   +AS +N  YS     Y++ C + +  +    FDF
Sbjct: 277 FTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPV-SVGDVEYNFDF 335

Query: 374 GGFTIKGTLSNFIL--EIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQ 431
           G   I   LS+ IL  E E   C   +   ++ S++LGD FL+SAYVV+DL+N +IS+AQ
Sbjct: 336 GDLQISVPLSSLILSPETEGSYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQ 394

Query: 432 AKFDNS 437
           A ++ S
Sbjct: 395 ANWNAS 400

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  203 bits (517), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/405 (34%), Positives = 208/405 (51%), Gaps = 40/405 (9%)

Query: 86  KNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC--------------NGSTF 131
           + +  +Y+  L IGTP Q +TV  DTGS+D W+  S+NP+C              +GS  
Sbjct: 39  RKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFCLSTSSTSSYLNATYDGSII 98

Query: 132 SDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVT 191
           + +V  + +   S+                    I Y D TFA GTWG + +SI+G+ + 
Sbjct: 99  TPSVDCQSMVTYSE-----GNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSIDGIVIP 153

Query: 192 GLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSL 250
            + F             LGIG  + E+      + + Y Y NFP +LK+  + + ++YSL
Sbjct: 154 NIQFGLAKYATTPVSGVLGIGFPRRESVKGYEGAPNKY-YPNFPQILKSEQIIDVVAYSL 212

Query: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPN----PIEFAVTLQGIGI- 305
           FLN  ++ +GSI+FGA+D SK+SG+L+T P+VN Y     PN    P   A+T+QG+G  
Sbjct: 213 FLNSPESGTGSIIFGAIDESKFSGDLFTFPMVNEY-----PNIVDTPATLAMTIQGLGAQ 267

Query: 306 -VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNS 364
             +  +  T   TK   +LDSGTSL   P  I   +AS +N  YS     Y++ C    +
Sbjct: 268 NKNSCEYETFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAF-A 326

Query: 365 TNTNLVFDFGGFTIKGTLSNFIL--EIEDDICILGLSSVDENSVILGDTFLASAYVVYDL 422
                 FDFG   I   L++ IL  E E   C   +   ++ S++LGD FL+SAYVV+DL
Sbjct: 327 DEIEYTFDFGDLKISVPLTSLILSPEAEGGYCGFAVQPTND-SMVLGDVFLSSAYVVFDL 385

Query: 423 ENLQISMAQAKFDNS--TSDIDVIRGNSGVPSAIKAPGYSSTWTA 465
           +N +IS+AQA +D S  T+ +  +R +  +P    A   +  WTA
Sbjct: 386 DNYKISLAQANWDVSEITTKLVNVRADGSIPGGKTAT--AEPWTA 428

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  193 bits (491), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 149/241 (61%), Gaps = 9/241 (3%)

Query: 235 VVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPI 294
           + LK+ G  E I+YSLFLNE  A  GSILFGAVD SKYSG LYTLP++  Y      +P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 295 EFAVTLQGIGIVSG-SKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLID 353
            F VT Q + +++G S   T+++ +   + DSGT+ + LP  + H+I  S +G+YS    
Sbjct: 61  MF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQ 119

Query: 354 SYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFL 413
            Y   CS     +T L  DFGGF I   +SNF+   +D  C+L + + D +  +LGD FL
Sbjct: 120 GYTFDCS--KVKDTLLSIDFGGFNISANISNFVTRTKDH-CLLNIEAAD-SGFVLGDAFL 175

Query: 414 ASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSS-IST 472
             AYVV+DLE+ ++S+AQA FD+   +I+VI     VP AI+APGYSSTW  TP S I T
Sbjct: 176 VDAYVVFDLESHEVSIAQASFDDKKEEIEVISDR--VPGAIRAPGYSSTWVYTPGSPIGT 233

Query: 473 G 473
           G
Sbjct: 234 G 234

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  192 bits (488), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 132/402 (32%), Positives = 208/402 (51%), Gaps = 35/402 (8%)

Query: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC--------NGSTFSDT 134
           +++ N    Y  ++ +GTP Q + V  DTGS+DLW   S+N YC        N +  +D 
Sbjct: 43  MDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAASYPQGDNSTNTNDN 102

Query: 135 VPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLT 194
             +   F CS                     I Y +T F+ G W +D + I   +V+GL 
Sbjct: 103 EQNMASF-CSSSRTYNFQRSSTFTPTGYKFFIDYVNT-FSRGIWAKDRLVIGNADVSGLQ 160

Query: 195 FXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLN 253
           F             LG+G  +LE+   G + + + TY N P++LK +G  + ++YS+FLN
Sbjct: 161 FGVSNISNTTINGILGVGYERLESV-KGYSGAPNRTYPNLPMLLKESGKIDKVAYSVFLN 219

Query: 254 ELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVS--GSKK 311
            L++   ++ FG VD  KY+G+LY  PLVN YK    P P +F +TLQ + +     S  
Sbjct: 220 HLNSNVSTVTFGGVDSEKYTGDLYKFPLVNIYK--SIPRPSKFHITLQALEVHGNYSSLN 277

Query: 312 TTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVF 371
            T++ T L A+ D+GT+  V+P  +  +IAS+++  +      YL +C      +T LVF
Sbjct: 278 KTVSNTPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLFACPAEED-DTKLVF 336

Query: 372 DFGGFTIKGTLSNFIL---EIEDDICILGLSSVDEN-SVILGDTFLASAYVVYDLENLQI 427
           DFG   I+  L+NFI+   E+  + C  G++ + E+ +  LG  FL S YVVY+LE+ ++
Sbjct: 337 DFGDIQIEAPLANFIVPAAELGTEQC--GVAIIPEDGTFTLGIPFLRSTYVVYNLEDYEV 394

Query: 428 SMAQA--KFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATP 467
           ++AQA  K+D  +    +I   S +P A +A       TATP
Sbjct: 395 ALAQANWKWDGKSKITPII---SNIPGATQA-------TATP 426

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  189 bits (480), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 138/402 (34%), Positives = 205/402 (50%), Gaps = 16/402 (3%)

Query: 69  QSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG 128
            + L KR++ D Q     N   +Y   L  GTP Q++ + +DTGSSDLWVT   NP C  
Sbjct: 32  HASLSKRSAVDLQFRRFNNL--YYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYN 89

Query: 129 STFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXX-XIQYGDTTFASGTWGRDVMSING 187
                  P + L +CS                      I Y DTT+ SG W  D++++  
Sbjct: 90  K--GSGKPPKCLIDCSGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPE 147

Query: 188 LNVTGLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESI 246
            ++  L F             LGIG   +E+  NG   +    Y NFP+ LKNAG T   
Sbjct: 148 GHLKDLQFGMAFATNATFSGVLGIGFPAMESV-NGYEFAPGKFYPNFPLALKNAGFTNIA 206

Query: 247 SYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV 306
           +YS+  N+ +++ GSILFG++D S++ G LYT P++N +       P   ++TL GIGI 
Sbjct: 207 AYSIEYND-ESKKGSILFGSIDTSRFIGPLYTFPMINEFPGIA-DEPSTLSLTLDGIGID 264

Query: 307 SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRN-ST 365
              ++  I+ TKL A+LD+G++L  LP  I  SIAS LN  +S     ++++C   +  T
Sbjct: 265 GSCEQWVISNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLT 324

Query: 366 NTNLVFDFGGFTIKGTLSNFIL---EIEDDICILGLSSVDENSVILGDTFLASAYVVYDL 422
            T+L F FG   +K  L +FIL   E  + +C LG++S  +  VILGD+FL   Y V+DL
Sbjct: 325 TTDLAFTFGELHMKIPLRSFILLPDEESNGLCGLGITS-SKGRVILGDSFLTHVYTVFDL 383

Query: 423 ENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464
           +N  IS+A     +    +  I  N  + +A+ +   S  WT
Sbjct: 384 DNYMISLAPMAKSSLPGKVIEIPANGLIENAVISK--SEKWT 423

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  189 bits (479), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 133/410 (32%), Positives = 205/410 (50%), Gaps = 27/410 (6%)

Query: 70  SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC--- 126
           ++L KR    + +L+ +++ SFY+  L IG P Q +TV  D+GS+D WV    NP+C   
Sbjct: 37  TQLAKRNHLKF-DLQFEDE-SFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSS 94

Query: 127 -----NG-STFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXX-XXXIQYGDTTFASGTWG 179
                NG  T  D        +CSQ                     I YGD TFA G WG
Sbjct: 95  SNITANGLKTLYDGKAIIPKVDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIWG 154

Query: 180 RDVMSINGLNVTGLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLK 238
            +     G+ +  + F             LGIG  + E+    +N+   + Y NFP VLK
Sbjct: 155 TETFEFGGVKIPNVQFGLADYATTPIGGVLGIGFQRRESVKGYTNAPEVF-YPNFPQVLK 213

Query: 239 NAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAV 298
           N G+ ++++YSL L     +S  I+FGA+D + Y G++ T P++N + +     P   ++
Sbjct: 214 NEGIIDTVAYSLSL----GQSSHIMFGAIDRNSYIGDMVTFPMINMFPN-AVSKPATLSI 268

Query: 299 TLQGIGIVSG--SKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYL 356
           T+QG+G  +    K  T + TK  A+LDSG++L   P  I   +A+ +  ++S     Y 
Sbjct: 269 TIQGLGAQNKQECKFQTFSTTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDGIYT 328

Query: 357 VSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE--DDICILGLSSVDENSVILGDTFLA 414
           + C   ++TN + +FDFG       LSN IL  +   ++C  GL   D N ++LGD FL 
Sbjct: 329 LECP-NDTTNIDYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGLQRSD-NEIVLGDVFLC 386

Query: 415 SAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWT 464
           S  VV+DL++ QIS+A++   +S  DI  I  +  +P AI A   +  WT
Sbjct: 387 STLVVFDLDHYQISLAKSNQKSSAEDIVNIPSDGKIPGAIIAK--AEAWT 434

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  188 bits (477), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 142/397 (35%), Positives = 210/397 (52%), Gaps = 29/397 (7%)

Query: 66  NFKQSELYKRASSDYQELEIKNQQS-FYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNP 124
           N  + +L +R S+   E++++++   +YS  L IGT  Q + V  D+GSSD+WV+ S+NP
Sbjct: 44  NLSKRKLQRRKST---EIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNP 100

Query: 125 YC-----------NGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTF 173
           YC           NG T +  +  + L      G                  I+Y D +F
Sbjct: 101 YCLESEGYVNQTYNGETVTPFIDCKALGTFDYNGSSSFERLDIGRFY-----IKYSDESF 155

Query: 174 ASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYAN 232
           A G W ++ + +NG++++ L F             LGIG  + E+   G + + +  Y N
Sbjct: 156 ADGFWAKEKLRLNGIDISTLQFGVADYATVPVGGVLGIGFPRRESV-KGYDDAPNEFYPN 214

Query: 233 FPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPN 292
           FP VLKN G+    +YS+FLNE+ +++GSILFGAVD +KY+G+LYT P+VN Y +     
Sbjct: 215 FPQVLKNEGVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYTGSLYTFPMVNEYPNV-VDK 273

Query: 293 PIEFAVTLQGIGIVSGS--KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNG-RYS 349
           P   A+TLQ +G  S S  K  T T TK A +LDSGT+L   P  I   +A    G  Y+
Sbjct: 274 PATLAMTLQALGAKSDSSCKYKTFTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYN 333

Query: 350 PLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE-DDICILGLSSVDENSVIL 408
                +   C   +  +T  +FDFG   I   L++ ++    D  C  GL+     S+ L
Sbjct: 334 ESEGIFYFDCP-SDDDDTEFIFDFGDLKITLPLASLVISSSGDGHCGFGLTPA-SYSMTL 391

Query: 409 GDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIR 445
           G  FL+SAYVVYDL+N QIS+AQAK+D + S    +R
Sbjct: 392 GAIFLSSAYVVYDLDNYQISIAQAKWDGNPSQKSRVR 428

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  186 bits (471), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 128/392 (32%), Positives = 198/392 (50%), Gaps = 31/392 (7%)

Query: 88  QQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNP-----YCNGSTF----SDTVPSR 138
           QQ++Y+  L +GTP QN+TV +D+GSSD W+  S NP     YCN +      +D +   
Sbjct: 52  QQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFCMENYCNSTEIPKYNNDLITQN 111

Query: 139 ELFNCS---QYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTF 195
              +CS   +Y                   +QY D +F  G W ++ + I+  N+T L  
Sbjct: 112 LTIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQIDNYNITSLQL 171

Query: 196 XXXXXXXXXX-XXLGIGLTQLETT--YNGSNSSHSYTYANFPVVLKNAGLTESISYSLFL 252
                        LGI   + E+   Y+G+ + +   Y NFP VLKN  + + + YS++L
Sbjct: 172 AVANYATTPVGGLLGISFPRRESVKGYDGALNEY---YPNFPQVLKNENIIDIVLYSMYL 228

Query: 253 NELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVS---GS 309
           N+L+ + GS+LFGA+D SK+ G++ T P+VN Y +     P   A+T+QG+   +    +
Sbjct: 229 NDLN-QDGSLLFGAIDTSKFEGDMITYPMVNVYPNV-VDKPATLALTIQGVAAQNTNDCT 286

Query: 310 KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTN-TN 368
           +  T   +K   +LDSGT+L   P  +   +A  +N  YS     Y+++C  +   N   
Sbjct: 287 QNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVLNDIE 346

Query: 369 LVFDFGGFTIKGTLSNFILEIED--DICILG-LSSVDENSVILGDTFLASAYVVYDLENL 425
            +FDFGG  +K  L  FIL  +D    C  G L     + ++LGD FL+  Y V+DL++ 
Sbjct: 347 YIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHY 406

Query: 426 QISMAQA-KFDNSTSDIDV---IRGNSGVPSA 453
           QIS+A   K  NS S+ D    I  N  +P A
Sbjct: 407 QISLANINKNANSESNEDSIINIPSNGAIPGA 438

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  185 bits (469), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 136/411 (33%), Positives = 205/411 (49%), Gaps = 37/411 (9%)

Query: 91  FYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC--------------NGSTFSDTVP 136
           FYS  L IG+P Q + + +D+GS+D WV  S NP+C              NG   ++T+ 
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKNYTYNGKAITETID 105

Query: 137 SRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFX 196
            + L                         I Y D +F  G W  D +S  G +++GL F 
Sbjct: 106 CQGL-----TALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFG 160

Query: 197 XXX-XXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNEL 255
                       LG+G  + E+      + + + Y NFP +LK  G+ + ++YS++LN+ 
Sbjct: 161 VAQYASEEIPGILGLGFPRRESVRGYPGAPNKF-YDNFPQMLKKDGIIDVVAYSMYLNDP 219

Query: 256 DAESG-SILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGS--KKT 312
           +   G S+LFG VD SKYSG+LYT P+ N Y +     P   AVTLQG G    S  ++ 
Sbjct: 220 NGSGGGSVLFGGVDPSKYSGDLYTFPMANQYPNI-VSKPATLAVTLQGFGAQKKSEGRQE 278

Query: 313 TITQTKLAAILDSGTSLTVLPGTIIHSIASSL--NGRYSPLIDSYLVSCSLRNSTNTNLV 370
           T      A +LDSGTSL   P  ++  +A  +  N R+S     Y++ C  ++  +T  V
Sbjct: 279 TFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDD-DTEFV 337

Query: 371 FDFGGFTIKGTLSNFILEIE-DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISM 429
           FDFG   I   +S  IL    +  C LG+   D  +  LGD FL+ AY+V+DL+N ++SM
Sbjct: 338 FDFGDLQIAVPVSTLILPPSGESYCGLGVLPKD-GTWTLGDVFLSYAYLVFDLDNYKVSM 396

Query: 430 AQAKF--DNSTSDIDVIRGNSGVPSAIKAPGYSSTWTAT-PSSISTGGNIF 477
           A+AKF  D   S    I+ +  +P A  A   +  W+++ PS++S  G+IF
Sbjct: 397 AKAKFSGDGDQSPQIKIQTDGTIPGAKSAS--AKPWSSSEPSTVS--GSIF 443

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  162 bits (409), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 125/211 (59%), Gaps = 11/211 (5%)

Query: 228 YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKD 287
           Y Y NFP+ LK  G  E I+YSLFLNE +A  GSILFGAVD SKYSG LYTLP++  Y  
Sbjct: 21  YVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYSGQLYTLPMLKAYNT 80

Query: 288 RGFPNPIEFAVTLQGIGIV------SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIA 341
                 +E  +T Q + I+      S S   T+++ +   + DSGTS + LP  I  +I 
Sbjct: 81  LDSSAGME--ITAQSVAILSVAIIDSKSGNKTVSEVQFPVLFDSGTSTSALPTEIADAIG 138

Query: 342 SSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSV 401
            S +G+YS     Y+  CS  N  NT L  DFGGF I   +SN +  I  D C+L + + 
Sbjct: 139 RSFDGKYSSDNQGYIFDCSKVN--NTLLSIDFGGFNISANISNSVTPITKDHCLLNIEA- 195

Query: 402 DENSVILGDTFLASAYVVYDLENLQISMAQA 432
           D++  +LGD FL   YVV+DLE+ ++S+AQA
Sbjct: 196 DDSGYVLGDAFLIDTYVVFDLESHEVSVAQA 226

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  166 bits (420), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 180/386 (46%), Gaps = 18/386 (4%)

Query: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDT----VPSR 138
           + + +    Y +++ +GTP Q +   +DTGS+DLW+   NNP+C G+         V   
Sbjct: 37  MPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEVRGVTVT 96

Query: 139 ELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXX 198
              +C                      I Y DT F  G+W  D + I G +V+G+ F   
Sbjct: 97  PSIDCRGIKTFCNESSTTLRILPNPFYIDYADT-FVDGSWATDRLVIGGHDVSGMKFGVG 155

Query: 199 XXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDA 257
                     LG+G   LE+   G   + + TY N P  LK  G  + ++YS+ L +   
Sbjct: 156 RTSNTELSGVLGVGHANLESV-RGYAGAPNATYPNLPRQLKLDGSVQKLAYSVSLQKTSE 214

Query: 258 ESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKT--TIT 315
             G ILFGA+D SKY G L+T P++N   D    +P  F + LQGI I  G   T   + 
Sbjct: 215 RDGEILFGAIDTSKYVGKLHTFPILNI--DPHLNSPSNFYIALQGIDIQGGRSSTGRPLI 272

Query: 316 QTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGG 375
            +   A+LD+GT   V+  ++   I ++LN  Y      +++ C   + T     F+FG 
Sbjct: 273 NSSFHALLDTGTGGMVV-SSLAEDIGAALNATYDTEQCVFVIQCPTEDDTR-QFNFNFGE 330

Query: 376 FTIKGTLSNFILE---IEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQA 432
             I   +SNF++    +E   C L +      +  LG  FL   Y V++LE+ +ISMA+A
Sbjct: 331 LQIAVPISNFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNEISMARA 390

Query: 433 KFDNSTSDIDVIRGNSGVPSAIKAPG 458
             +    DI  I   +GVP+AI+  G
Sbjct: 391 NTNPQEPDIRPIP--AGVPAAIRDSG 414

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  162 bits (411), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 116/388 (29%), Positives = 184/388 (47%), Gaps = 29/388 (7%)

Query: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC---NG---------STFSDTVPSR-ELFN 142
           +++GTP Q +   +DT SSD+W+  SN+ +C   NG         ST ++   SR + + 
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCESENGTVNIDSNSNSTLANETASRSDAYQ 141

Query: 143 CSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXX 202
           C                      +QY D ++A+GTW +D  S    +   +         
Sbjct: 142 CKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETN 201

Query: 203 XXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSI 262
                LG+GL   + T  G +    + Y +    LK  G  E I+YS++ +EL+   G I
Sbjct: 202 LTVGSLGLGLRANQATNQGDDP---FVYNSLLYRLKTQGWIEKIAYSVYTSELNGTGGGI 258

Query: 263 LFGAVDHSKYSGN-LYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAA 321
            FG + H  Y GN LYTLPLVN   D     P  F +TLQ +         ++   K  A
Sbjct: 259 FFGGLYHDLYKGNVLYTLPLVNV--DPELDEPARFHITLQNLTTSINGTNFSVLSEKYPA 316

Query: 322 ILDSGTSLTVLPGTIIHSIASSLN-GRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKG 380
           +L +G+  T LP  +  S    ++  + +   D Y++ C     TN   ++DFGGF I+ 
Sbjct: 317 LLSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDLYVIPCD----TNATFIYDFGGFEIET 372

Query: 381 TLSNFILEIE-----DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFD 435
            LS +  ++E     DD+C + +   +++ + LG+ F A+ YV+++LE+L+ISMA A   
Sbjct: 373 PLSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEISMAPASGI 432

Query: 436 NSTSDIDVIRGNSGVPSAIKAPGYSSTW 463
                 D     S +PSA +A  YS+TW
Sbjct: 433 EYLDAFDYEYIESSIPSASRAASYSNTW 460

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  156 bits (395), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 156/303 (51%), Gaps = 12/303 (3%)

Query: 66  NFKQSE---LYKRASSDYQELEIKNQQ---SFYSLDLFIGTPGQNVTVQIDTGSSDLWVT 119
           NF+ S     Y R+  ++  LE+  Q     FYS  L  G P QNVTV +DTGSSDLWV+
Sbjct: 33  NFRSSNNNVHYSRSYDNHNYLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVS 92

Query: 120 GSNNPYCNGSTFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWG 179
             NN YC     +  +      NC+++G                  IQYGD +FA G W 
Sbjct: 93  SPNNIYCYEDGKNTNI--NHSINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWI 150

Query: 180 RDVMSINGLNVTGLTFXXXXXXXXXXX-XLGIGLTQLETTYNGSNSSHSYTYANFPVVLK 238
            D ++I   ++  + F             LG+G  + E+  +G + S +  Y N P  LK
Sbjct: 151 TDTLTIGPYDLQSVQFGISNNASTIISGVLGLGFLRTESI-DGYDGSPNKLYYNLPAYLK 209

Query: 239 NAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAV 298
           +  +T + ++SLFLN  +  SG++LFG +D+SK+SG+L T PLVN Y  +    P  F +
Sbjct: 210 DQEITNTNAFSLFLNNSNDASGTVLFGGIDYSKFSGDLVTFPLVNIYP-KLINEPCTFTI 268

Query: 299 TLQGI-GIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLV 357
           TLQ + G ++G K   + + K+ A+LDSG+SL  +P  I   IA  +N     +   + +
Sbjct: 269 TLQQLYGKINGGKSIGLIKEKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMTSLHNI 328

Query: 358 SCS 360
           +CS
Sbjct: 329 NCS 331

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  131 bits (330), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 105/370 (28%), Positives = 165/370 (44%), Gaps = 45/370 (12%)

Query: 88  QQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPY-------CNGSTFSDTVPSREL 140
             S+Y  ++ IG P QN+ V +DTGSSDLWV   NNP        C G TF +   S+  
Sbjct: 27  DDSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGNIDCTGFTFFNKSNSKTF 86

Query: 141 FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSIN----------GL-- 188
            N  +                    I Y D ++  G WG D +SIN          GL  
Sbjct: 87  SNIYK---------------NSIFQIGYQDASYTFGKWGVDSISINSSYSDSNEDTGLYA 131

Query: 189 NVTGLTFXXXXXXXX-XXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESIS 247
           N+    F             LG+G  + E   NG   + +  Y N P ++K  G +++++
Sbjct: 132 NIPNAQFAIATNSNVPVQAVLGLGFPRREAV-NGYKLATNKFYPNLPQLIKQHGYSDNVT 190

Query: 248 YSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVS 307
            +++L   +    SI+FGA D ++Y G+L+  P+VN Y +     P  FA+TL  + I  
Sbjct: 191 IAMYLGS-NETYNSIMFGAYDKTRYIGDLHNFPMVNQYPNVT-DKPATFAITLDSMYISM 248

Query: 308 GSKKT----TITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRN 363
            + ++         K + +LDSGTSL   P   +  IA  LN  +      YL+      
Sbjct: 249 DNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDL 308

Query: 364 STNTNLV--FDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS-VILGDTFLASAYVVY 420
           +   +++  F F  F +   +  FIL  +D      L + + N+  +LGD FL   Y ++
Sbjct: 309 TLYKDMIINFKFMDFNVPINMLEFILPYDDSYVFAILPTKNVNTGFVLGDIFLPHVYTIF 368

Query: 421 DLENLQISMA 430
           +L+N  IS+ 
Sbjct: 369 NLDNYTISLG 378

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 105/432 (24%), Positives = 168/432 (38%), Gaps = 81/432 (18%)

Query: 40  QFNKLYGTSFDIAKKWQDINLGQH--NLNFKQSELYKRASSDYQELEIKNQQSFYSL--- 94
           + +KL  T  ++  + +DI+  QH  +L  K    Y+RA+    E+E   +  FY +   
Sbjct: 23  KIHKLKLTKEELTNELKDISFEQHLAHLGVKYLNQYERANP---EVEFSREHPFYKISSE 79

Query: 95  ----------------------DLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFS 132
                                 D+ IGTP Q+  V +DTGSS+LWV              
Sbjct: 80  IVSKNGGHEVPLSNYMNAQYFADIKIGTPPQSFKVVLDTGSSNLWV-------------- 125

Query: 133 DTVPSREL--FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNV 190
              PS+E     C  +                   IQYG  +   G   +DVM I  L +
Sbjct: 126 ---PSKECGSLACYLHSKYNHDESSTYKANGSAFAIQYGSGSL-EGYISQDVMEIGDLKI 181

Query: 191 TGLTFXXXXXXXXXXXXLGI--GLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISY 248
           T   F             G   G+  L       N      Y        N GL +   +
Sbjct: 182 TKQDFAEATSEPGISFAFGKFDGILGLAYDTIAVNRVVPPVYNAI-----NQGLLDEPKF 236

Query: 249 SLFLNELDAES---GSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGI 305
           + +L +        G  +FG +D +K+ G++  LP+    + + +     + V L+G+G+
Sbjct: 237 AFYLGDASKSKDNGGEAVFGGIDETKFEGDITWLPV----RRKAY-----WEVKLEGLGL 287

Query: 306 VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNST 365
             G + T +      A +D+GTSL  LP  +   I S +  +       Y + C  R S 
Sbjct: 288 --GEEYTELENH--GAAIDTGTSLITLPSGLAEIINSEIGAKKG-WTGQYTIECDKRASL 342

Query: 366 NTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS-----VILGDTFLASAYVVY 420
             ++ F F G+    +  ++ LE+    CI  ++ +D         I+GD FL   Y VY
Sbjct: 343 -PDMTFTFDGYNFTISPYDYTLEVSGS-CISAITPMDFPEPVGPMAIIGDAFLRKYYSVY 400

Query: 421 DLENLQISMAQA 432
           DL N  + +A A
Sbjct: 401 DLGNDAVGLAPA 412

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 148/376 (39%), Gaps = 52/376 (13%)

Query: 68  KQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCN 127
           K+ + Y  A  D       N Q  Y  ++ +GTP QN  V +DTGSS+LWV         
Sbjct: 69  KEHQFYAEAGHDVPLTNYLNAQ--YYTEISLGTPPQNFKVILDTGSSNLWV--------- 117

Query: 128 GSTFSDTVPSREL--FNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSI 185
                   PS E     C  +                   IQYG  +   G   +D +SI
Sbjct: 118 --------PSAECGSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSL-EGYISQDTLSI 168

Query: 186 NGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPV--VLKNAGLT 243
             L +    F             G     L   Y+    S S      PV   + N GL 
Sbjct: 169 GDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYD----SISVDKVVPPVYNAIHN-GLL 223

Query: 244 ESISYSLFLNELDA--ESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQ 301
           +   +S +L   D   + G   FG +D SKY GN+  LP+    + + +     + V   
Sbjct: 224 DEPKFSFYLGNADKSTDGGEATFGGIDSSKYEGNITWLPV----RRKAY-----WEVKFD 274

Query: 302 GIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSL 361
           GIG+     +  I     AAI D+GTSL  LP  +   + + +  +       Y V C  
Sbjct: 275 GIGL---GDEYAILDGHGAAI-DTGTSLIALPSGLAEILNAEIGAKKG-WSGQYSVECDT 329

Query: 362 RNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS-----VILGDTFLASA 416
           R+S   +L  +FGG+    T  ++ LE+    CI   + +D         I+GD FL   
Sbjct: 330 RDSL-PDLTLNFGGYNFTITPYDYTLEVSGS-CISAFTPMDFPEPVGPLAIIGDAFLRKH 387

Query: 417 YVVYDLENLQISMAQA 432
           Y VYDL N  + +A+A
Sbjct: 388 YSVYDLGNDAVGLAKA 403

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 88.2 bits (217), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 84/149 (56%), Gaps = 6/149 (4%)

Query: 293 PIEFAVTLQGIGI--VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSP 350
           P   A+T+QG+G    S  +  T   TK   +LDSGTSL   P +I   +AS +N  YS 
Sbjct: 206 PATLAMTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSA 265

Query: 351 LIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL--EIEDDICILGLSSVDENSVIL 408
               Y++ C   ++ +    FDFG   I   L++ IL  E E   C   +   ++ S++L
Sbjct: 266 DEGIYILDCP-ESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTND-SMVL 323

Query: 409 GDTFLASAYVVYDLENLQISMAQAKFDNS 437
           GD FL+SAYVV+DL+N +IS+AQA ++ S
Sbjct: 324 GDVFLSSAYVVFDLDNYKISLAQANWNAS 352

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 141/351 (40%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  ++ +GTP Q+  V +DTGSS+LWV             SD   S   F  S+Y     
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWVP------------SDECGSLACFLHSKY---SH 142

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         IQYG  +   G   +D +SI  L +    F             G  
Sbjct: 143 DASSSYKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKF 201

Query: 212 LTQLETTYNGSNSSHSYTYANFPVVLK--NAGLTESISYSLFLNELD---AESGSILFGA 266
              L   Y+  +          P V K  N GL +   ++ +LN  D     +G + FG 
Sbjct: 202 DGILGLGYDTISVDKV-----VPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGG 256

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D SKY G++  LP+    + + +     + V   GIG+  G +   +  T   A +D+G
Sbjct: 257 IDSSKYKGDITWLPV----RRKAY-----WEVKFDGIGL--GDEYAELQGT--GAAIDTG 303

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   + S +  +       Y V C  R+    +L F F G     T  ++ 
Sbjct: 304 TSLIALPSGLAEVLNSEIGAKKG-WTGQYTVDCESRDQL-PDLTFTFNGKNFTITAYDYT 361

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI   + +D         I+GD FL   Y +YDL N  + +AQA
Sbjct: 362 LEVSGS-CISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQA 411

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 82/144 (56%), Gaps = 6/144 (4%)

Query: 298 VTLQGIGI--VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSY 355
           +T+QG+G    S  +  T   TK   +LDSGTSL   P +I   +AS +N  YS     Y
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIY 60

Query: 356 LVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL--EIEDDICILGLSSVDENSVILGDTFL 413
           ++ C   ++ +    FDFG   I   L++ IL  E E   C   +   ++ S++LGD FL
Sbjct: 61  ILDCP-ESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTND-SMVLGDVFL 118

Query: 414 ASAYVVYDLENLQISMAQAKFDNS 437
           +SAYVV+DL+N +IS+AQA ++ S
Sbjct: 119 SSAYVVFDLDNYKISLAQANWNAS 142

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 98/391 (25%), Positives = 161/391 (41%), Gaps = 48/391 (12%)

Query: 53  KKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQ-QSFYSLDLFIGTPGQNVTVQIDT 111
           K + +++  +H+  FK S       +   E+ + N   + Y  D+ +GTP Q   V +DT
Sbjct: 61  KAFPEVSFSKHHPFFKGSAQDSFEVAKGHEVPLSNYLNAQYYTDITLGTPPQQFKVILDT 120

Query: 112 GSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXXXXXXXXXXXXXXXXXXIQYG 169
           GSS+LWV                 PS E     C  +                   IQYG
Sbjct: 121 GSSNLWV-----------------PSSECGSLACFLHEKYDHSASSSYKANGTDFSIQYG 163

Query: 170 DTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYT 229
             +   G   +D +SI  L +    F             G     L   Y+    S    
Sbjct: 164 SGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYD--TISVDKV 220

Query: 230 YANFPVVLKNAGLTESISYSLFLNEL--DAESG-SILFGAVDHSKYSGNLYTLPLVNTYK 286
              F   L+   L E+  ++ +L +   DAE G   +FG VD SKY+G++  LP+    +
Sbjct: 221 VPPFYNALEQDLLDEA-KFAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVTWLPV----R 275

Query: 287 DRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNG 346
            + +     + V L+G+G+  G +   +      A +D+GTSL  LP  +   I S +  
Sbjct: 276 RKAY-----WEVKLEGLGL--GDEYAELESH--GAAIDTGTSLITLPSGLAEIINSEIGA 326

Query: 347 RYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENS- 405
           +       Y + C+ R+    +L F+F G+       ++ LE+    CI  ++ +D    
Sbjct: 327 KKG-WTGQYTLECNTRDQL-PDLTFNFNGYNFTIGPYDYTLEVSGS-CISAITPMDFPEP 383

Query: 406 ----VILGDTFLASAYVVYDLENLQISMAQA 432
                I+GD FL   Y +YDLE+  + +A+A
Sbjct: 384 VGPLAIVGDAFLRKYYSIYDLEHNAVGLAKA 414

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 140/351 (39%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  ++ +GTP Q+  V +DTGSS+LWV             SD   S   F  S+Y     
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWVP------------SDECGSLACFLHSKY---SH 147

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         IQYG  +   G   +D +SI  L +    F             G  
Sbjct: 148 DASSSYKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKF 206

Query: 212 LTQLETTYNGSNSSHSYTYANFPVVLK--NAGLTESISYSLFLNELD---AESGSILFGA 266
              L   Y+             P V K  N GL +   ++ +LN  D     +G + FG 
Sbjct: 207 DGILGLGYDTIAVDKV-----VPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGG 261

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D SKY GN+  LP+    + + +     + V   GIG+  G +   +  T   A +D+G
Sbjct: 262 IDSSKYKGNITWLPV----RRKAY-----WEVKFDGIGL--GDEYAELEGT--GAAIDTG 308

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   + + +  +       Y V C  R+    +L F F G     +  ++ 
Sbjct: 309 TSLIALPSGLAEVLNAEIGAKKG-WSGQYTVDCESRDQL-PDLTFTFNGKNFTISAYDYT 366

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI   + +D         I+GD FL   Y VYDL N  + +AQA
Sbjct: 367 LEVSGS-CISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQA 416

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 142/356 (39%), Gaps = 58/356 (16%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  ++ +GTP QN  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWV-----------------PSTECSSLACFLHSKY 147

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           I+YG  +   G   +D +++  L++T   F             G
Sbjct: 148 DHDSSSSYKPNGTEFAIRYGSGSL-EGYISQDTLNLGDLSITKQDFAEATSEPGLQFAFG 206

Query: 210 -----IGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GS 261
                +GL     + +G           F    K  GL +   ++ +L   D ES   G 
Sbjct: 207 KFDGILGLGYDTISVDG-------VVPPFYNAWKQ-GLLDEPKFAFYLGR-DGESQDGGV 257

Query: 262 ILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAA 321
             FG VD SKY G +  LP+    + + +     + V   GIG+  G +   +      A
Sbjct: 258 ATFGGVDDSKYEGEITWLPI----RRKAY-----WEVKFDGIGL--GEEYAELENH--GA 304

Query: 322 ILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGT 381
            +D+GTSL  LP  +   I + +  + S     Y V C  R+S   N+ F  GG   + T
Sbjct: 305 AIDTGTSLIALPSGLAEIINAEIGAKKS-WTGQYTVECEARSSL-PNMTFTLGGHNFELT 362

Query: 382 LSNFILEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
             ++ILE+    CI  +  +D         I+GD+FL   Y +YDL N  + +A A
Sbjct: 363 AYDYILEVSGQ-CISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLADA 417

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 89/351 (25%), Positives = 141/351 (40%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  D+ +GTP QN  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV-----------------PSNECGSLACFLHSKY 133

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           IQYG T    G   +D +SI  L +    F             G
Sbjct: 134 DHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFG 192

Query: 210 IGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GSILFGA 266
                L   Y+    S       F   ++   L E   ++ +L +   +S   G   FG 
Sbjct: 193 KFDGILGLGYD--TISVDKVVPPFYNAIQQDLLDEK-KFAFYLGDTSKDSENGGEATFGG 249

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D SK+ G++  LP+    + + +     + V  +GIG+  G +   +      A +D+G
Sbjct: 250 IDESKFKGDITWLPV----RRKAY-----WEVKFEGIGL--GDEYAELESH--GAAIDTG 296

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   I + L  +       Y + C+ R+S   +L+F+F G+       ++ 
Sbjct: 297 TSLITLPSGLAEMINAELGAKKG-WTGQYTLDCNTRDSL-PDLIFNFNGYNYTIGPYDYT 354

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI  ++ +D         I+GD FL   Y +YDL N  + +A+A
Sbjct: 355 LEVSGS-CISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAKA 404

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 89/351 (25%), Positives = 141/351 (40%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  D+ +GTP QN  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV-----------------PSNECGSLACFLHSKY 133

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           IQYG T    G   +D +SI  L +    F             G
Sbjct: 134 DHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFG 192

Query: 210 IGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GSILFGA 266
                L   Y+    S       F   ++   L E   ++ +L +   +S   G   FG 
Sbjct: 193 KFDGILGLGYD--TISVDKVVPPFYNAIQQDLLDEK-KFAFYLGDTSKDSENGGEATFGG 249

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D SK+ G++  LP+    + + +     + V  +GIG+  G +   +      A +D+G
Sbjct: 250 IDESKFKGDITWLPV----RRKAY-----WEVKFEGIGL--GDEYAELEGH--GAAIDTG 296

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   I + L  +       Y + C+ R+S   +L+F+F G+       ++ 
Sbjct: 297 TSLITLPSGLAEMINAELGAKKG-WTGQYTLDCNTRDSL-PDLIFNFNGYNFTIGPYDYT 354

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI  ++ +D         I+GD FL   Y +YDL N  + +A+A
Sbjct: 355 LEVSGS-CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAKA 404

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 134/341 (39%), Gaps = 44/341 (12%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  D+ IG+PGQ   V +DTGSS+LWV   +   CN               C  +     
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWVPSVD---CNS------------LACFLHNKYDH 143

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         I+YG      G    D +++  L +    F            L   
Sbjct: 144 RVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEATSEPG----LAFA 198

Query: 212 LTQLETTYNGSNSSHSYTYANFPVV-LKNAGLTESISYSLFLNE--LDAESGSILFGAVD 268
             + +  +  +  + S   A  P     N GL ++  ++ +L +  L  E G + FG  D
Sbjct: 199 FGKFDGIFGLAFDTISVNRAVPPFYNAVNRGLLDAPQFAFYLGDKRLRKEGGEVTFGGYD 258

Query: 269 HSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTS 328
            ++++GN+  LP+              + V   GI    GS+   +T T   A +D+GTS
Sbjct: 259 ETRFTGNITWLPVRRE---------AYWEVDFNGISF--GSQYAPLTAT--GAAIDTGTS 305

Query: 329 LTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILE 388
           L  LP  +   + + +  R +     Y++ CS R ST  ++ F+ GG        ++ LE
Sbjct: 306 LITLPSGLAEILNAQIGARKN-WSGQYVLDCS-RRSTLPDITFNLGGSNFSIGPYDYTLE 363

Query: 389 IEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLEN 424
                CI  +  +D         I+GD FL   Y VYDL N
Sbjct: 364 AS-GTCISAIVPMDFPEPVGPLAIIGDAFLRRWYSVYDLGN 403

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 83/349 (23%), Positives = 137/349 (39%), Gaps = 43/349 (12%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  D+ +GTP QN  V +DTGSS+LWV  S    CN               C  +     
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSSE---CNS------------LACFLHSKYDH 136

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         IQYG  +   G   +D ++I  L +    F             G  
Sbjct: 137 DASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPKQDFAEATSEPGLTFAFGKF 195

Query: 212 LTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GSILFGAVD 268
              L   Y+    S       F   ++  GL +   ++ +L +   +    G I  G +D
Sbjct: 196 DGILGLAYD--TISVDKVVPPFYNAIEQ-GLLDEKKFAFYLGDTKKDEKNGGEITIGGID 252

Query: 269 HSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTS 328
            SK+ G++  LP+    + + +     + V  +GI +  G +   +      A +D+GTS
Sbjct: 253 ESKFKGDIEWLPV----RRKAY-----WEVKFEGIAL--GDQYAALENH--GAAIDTGTS 299

Query: 329 LTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILE 388
           L  LP  +   I + +  +       Y + C  R+    +L F+F G     +  ++ LE
Sbjct: 300 LITLPSGLAEIINTEIGAKKG-WTGQYTLDCDTRDGL-PDLTFNFNGKNFTISPFDYTLE 357

Query: 389 IEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           +    CI  +  +D         I+GD FL   Y +YDL+N  + +A+A
Sbjct: 358 VSGS-CISAIMPMDFPEPMGPMAIVGDAFLRKYYSIYDLDNHAVGLAEA 405

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 86/351 (24%), Positives = 141/351 (40%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  D+ +GTP QN  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV-----------------PSNECGSLACFLHSKY 133

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           IQYG T    G   +D +SI  L +    F             G
Sbjct: 134 DHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFG 192

Query: 210 IGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GSILFGA 266
                L   Y+    S       F   ++   L E   ++ +L +   ++   G   FG 
Sbjct: 193 KFDGILGLGYD--TISVDKVVPPFYNAIQQDLLDEK-RFAFYLGDTSKDTENGGEATFGG 249

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D SK+ G++  LP+    + + +     + V  +GIG+  G +   +      A +D+G
Sbjct: 250 IDESKFKGDITWLPV----RRKAY-----WEVKFEGIGL--GDEYAELESH--GAAIDTG 296

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   I + +  +       Y + C+ R++   +L+F+F G+       ++ 
Sbjct: 297 TSLITLPSGLAEMINAEIGAKKG-WTGQYTLDCNTRDNL-PDLIFNFNGYNFTIGPYDYT 354

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI  ++ +D         I+GD FL   Y +YDL N  + +A+A
Sbjct: 355 LEVSGS-CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKA 404

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 152/371 (40%), Gaps = 50/371 (13%)

Query: 74  KRASSDYQELEIKN--QQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSN--NPYC-NG 128
           +RASS+   + + N     +YS ++ +GTP Q+  V +DTGSS+LWV   N  +  C N 
Sbjct: 82  ERASSNGHPIALDNFVNNQYYS-EIGLGTPPQSFKVVMDTGSSNLWVPNKNCVSEACLNH 140

Query: 129 STFSDTVPSRELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGL 188
           + F     S    N S++                   + YG  +   G    D + I  L
Sbjct: 141 ARFDHDRSSSYAKNDSRF------------------SVSYGKGSM-EGFVSYDTLKIGDL 181

Query: 189 NVTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISY 248
            +    F             G     L   Y+G   +H        V   + GL +   +
Sbjct: 182 TIKNQGFAEATVEPGSAFVYGQFDGILGLAYDGLAVNHIVPPFYEAV---HQGLLDEPVF 238

Query: 249 SLFLNEL---DAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGI 305
           + +L++    D+ +G ++FG  D +K++G +  LP++             + V L  I +
Sbjct: 239 AFYLSDEKKGDSLAGEVVFGGYDETKFTGEISWLPVIRK---------AYWEVELNSITL 289

Query: 306 VSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNST 365
             GS+K  +        LD+GTS    P  +     S       P     +  CS   S 
Sbjct: 290 --GSQKFQLQN--YGGALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPCS--GSG 343

Query: 366 NTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVD----ENSVILGDTFLASAYVVYD 421
             +L F+  G +   + S+++++ +D  C + ++ +D       VI+GD FL   Y +YD
Sbjct: 344 FPDLTFELAGRSFTISSSDYVVQWDDTTCAVAITPLDLGGAGKMVIIGDVFLRRWYSIYD 403

Query: 422 LENLQISMAQA 432
           L    + +A++
Sbjct: 404 LSKNAVGLAKS 414

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 123/271 (45%), Gaps = 48/271 (17%)

Query: 237 LKNAGLTESISYSLFL---------------NELDAESGSILFGAVDHSKYSGNLYT--- 278
           L++ G+ ES+SYSL+L               +E++   G ++ G VD   YSG L     
Sbjct: 337 LRDNGIIESLSYSLWLGGDTRPYYDVGRNVPDEINC--GKLILGGVDPYYYSGPLKKFNN 394

Query: 279 LPLVNTYKD---RGFPNPIEFAVTLQGIGIVSGSKKT-TITQTKL--AAILDSGTSLTVL 332
           L  +++  D   RG+P      + ++ I +VS +  +  +T        +LDS  S + L
Sbjct: 395 LIFLDSRTDMLSRGYP-----VLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHL 449

Query: 333 PGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE-- 390
           P   I  IA  +N  Y   +D ++VSC + +    N+ F+FG  +I     +F++     
Sbjct: 450 PAETIVQIAVQVNAIYMKEVDMFVVSCKIAD-MGVNIQFEFGDVSIDVPFKDFLMSTHNP 508

Query: 391 -----------DDICILGLSSVDENSV-ILGDTFLASAYVVYDLENLQISMAQAKFDNST 438
                      D+ C + + S +E    ILG +FL + Y+  D ++  I++AQA+   +T
Sbjct: 509 ETNSTMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQARRKYTT 568

Query: 439 SDIDVIRGNSGVPSAIK--APGYSSTWTATP 467
                  G S   S     +P  SST  ATP
Sbjct: 569 LITPDGAGTSATASISHYLSPSLSSTGKATP 599

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 11/79 (13%)

Query: 52  AKKWQDINLGQH-------NLNFKQSELYKRASSDYQELEI----KNQQSFYSLDLFIGT 100
           A + +   +G H       N N K S  ++R S+  Q L      ++  S Y  ++ IGT
Sbjct: 125 ASQHKKTAIGHHTSAYAVCNGNSKSSSSHQRRSTVQQVLPTISLNRDNNSLYYTNVSIGT 184

Query: 101 PGQNVTVQIDTGSSDLWVT 119
           PGQ   + ID      WVT
Sbjct: 185 PGQKQPLVIDIVEPYNWVT 203

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 143/352 (40%), Gaps = 50/352 (14%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  ++ +G+P Q+  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 96  YFTEITLGSPPQSFKVILDTGSSNLWV-----------------PSAECGSLACFLHTKY 138

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           IQYG  +   G   RD+++I  L +    F            L 
Sbjct: 139 DHEASSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEATSEPG----LA 193

Query: 210 IGLTQLETTYNGSNSSHSYTYANFPV--VLKNAGLTESISYSLFLNELDA--ESGSILFG 265
               + +     +  S S      PV   +KN  L + + ++ +L + D   + G   FG
Sbjct: 194 FAFGKFDGILGLAYDSISVNRIVPPVYNAIKNKLLDDPV-FAFYLGDSDKSEDGGEASFG 252

Query: 266 AVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDS 325
            +D  KY+G +  LP+    + + +     + V  +GIG+  G +  T+      A +D+
Sbjct: 253 GIDEEKYTGEITWLPV----RRKAY-----WEVKFEGIGL--GEEYATLEGH--GAAIDT 299

Query: 326 GTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF 385
           GTSL  LP  +   + + +  +       Y V C  R+S   +L  +F G+    T  ++
Sbjct: 300 GTSLIALPSGLAEILNAEIGAKKG-WSGQYSVDCESRDSL-PDLTLNFNGYNFTITAYDY 357

Query: 386 ILEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
            LE+    CI   + +D         I+GD FL   Y +YD+ +  + +A+A
Sbjct: 358 TLEVSGS-CISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLAKA 408

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 86/351 (24%), Positives = 141/351 (40%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  D+ +GTP Q+  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV-----------------PSVECGSLACYLHSKY 136

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           I+YG T    G   +D ++I  LN+    F             G
Sbjct: 137 DHDKSSSYKPNGTDFAIRYG-TGSLEGYISQDTLNIGDLNIPKQDFAEATSEPGLTFAFG 195

Query: 210 IGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GSILFGA 266
                L   Y+  + S +     F   ++   L E   ++ +L + + +S   G I  G 
Sbjct: 196 KFDGILGLAYD--SISVNKVVPPFYNAIEQELLDEK-KFAFYLGDANKKSEDGGEITIGG 252

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D +K+ G++  LP+    + + +     + V  +GIG+  G +   +      A +D+G
Sbjct: 253 IDKTKFKGDIDWLPV----RRKAY-----WEVKFEGIGL--GDQFAELENH--GAAIDTG 299

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   I + +  +       Y V C  R +   +L F+F G        ++ 
Sbjct: 300 TSLIALPSGLAEIINTEIGAKKG-WTGQYTVECDARPNL-PDLTFNFNGKNFTIGPYDYT 357

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI  +  +D         I+GD FL   Y +YDLEN  + +A+A
Sbjct: 358 LEVSGS-CISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGLAEA 407

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 90/185 (48%), Gaps = 36/185 (19%)

Query: 260 GSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKL 319
           G I+FG  D +K++G+L  LP+      +GF   +EF     G        ++T+    L
Sbjct: 107 GEIIFGGYDSTKFAGSLEWLPITK----KGFWE-VEFNSISTG--------ESTVQGEGL 153

Query: 320 AAILDSGTSLTVLP--------GTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVF 371
            AILD+G+SLT+LP        G +  ++ S   GR         VSCS R  T   +VF
Sbjct: 154 GAILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGR---------VSCSARE-TAPEIVF 203

Query: 372 DFGGFTIKGTLSNFILEIEDDICILGL----SSVDENSVILGDTFLASAYVVYDLENLQI 427
           + GG     T + +I+    + C++ +    S    N VILG  FL   Y VYDL + ++
Sbjct: 204 ELGGKKFAITGNEYIMPAGSE-CMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRV 262

Query: 428 SMAQA 432
            +A+A
Sbjct: 263 GLAEA 267

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/351 (24%), Positives = 138/351 (39%), Gaps = 47/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  D+ +G P QN  V +DTGSS+LWV                 PS E     C  +   
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWV-----------------PSTECGSLACFLHSKY 134

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLG 209
                           IQYG T    G   +D +SI  L +    F             G
Sbjct: 135 DHEASSSYKPNGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFG 193

Query: 210 IGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES---GSILFGA 266
                L   Y+    S       F   ++   L E   ++ +L +   +S   G   FG 
Sbjct: 194 KFDGILGLGYD--TISVDKVVPPFYNAIQQDLLDEK-KFAFYLGDTSKDSENGGEATFGG 250

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D SK+ G++  LP+    + + +     + V  +GIG+  G +   +      A +D+G
Sbjct: 251 IDKSKFKGDVTWLPV----RRKAY-----WEVKFEGIGL--GHEFAELEGH--GAAIDTG 297

Query: 327 TSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI 386
           TSL  LP  +   I + +  +       Y + C+ R+    +L F+F G+       ++ 
Sbjct: 298 TSLITLPSGLAEMINAEIGAKKG-WSGQYALDCNTRDGL-PDLTFNFNGYNFTIGPYDYT 355

Query: 387 LEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           LE+    CI  ++ +D         I+GD FL   Y +YDL N  + +A+A
Sbjct: 356 LEVSGS-CISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLAEA 405

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 140/353 (39%), Gaps = 52/353 (14%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  D+ +GTP Q+  V +DTGSS+LWV   +   CN               C  +     
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWVPSVD---CNS------------LACYLHAKYDH 133

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         IQYG  +   G   +DV+ I  L + G  F             G  
Sbjct: 134 SDSSTYKKNGTTFSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEATSEPGLAFAFGKF 192

Query: 212 LTQLETTYNGSNSSHSYTYANFPVVLK-----NAGLTESISYSLFLNE--LDAESGSILF 264
              L   Y+        T A   VV       N  L +   +S +L +     + G + F
Sbjct: 193 DGILGLAYD--------TIAVNRVVPPFYNAINKKLVDEPIFSFYLGDDTKSEDGGQVTF 244

Query: 265 GAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILD 324
           G  D S ++G++  LP+    + + +     + V    I +  G++   +      A +D
Sbjct: 245 GGYDSSLFTGDITWLPV----RRKAY-----WEVKFDAIAL--GNEVADLVNH--GAAID 291

Query: 325 SGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSN 384
           +GTSL  LP  +   I S +  + S     ++V C  R+ T  ++ F F G+    T  +
Sbjct: 292 TGTSLITLPSGLAEVINSQIGAKKS-WSGQWIVDCKTRD-TLPDMTFTFDGYNFTITPYD 349

Query: 385 FILEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
           + LE+    CI  ++ +D  +      I+GD FL   Y +YD+ N  + +A A
Sbjct: 350 YTLEVSGS-CISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLAAA 401

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 106/235 (45%), Gaps = 41/235 (17%)

Query: 233 FPVVLKNAGLTESISYSLFL----------NELDAESGSILFGAVDHSKYSGNL------ 276
           F  +L +A   E  SYSL+L           E   + G +L G VD S ++G L      
Sbjct: 217 FLSLLTDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLI 276

Query: 277 -YTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTK---LAAILDSGTSLTVL 332
            Y  P+ N     G+P      V L  I I+S S ++    +K     A+LDS +S++ L
Sbjct: 277 PYVDPVSNVVS-TGYP-----IVPLGPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYL 330

Query: 333 PGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIED- 391
           P + I  IA  +   Y   +D +LV CS+ +     L F F   TIK  LS+ +    D 
Sbjct: 331 PTSTIIQIAVQIAATYVESLDRWLVECSMAD-MGVTLGFMFRSLTIKIPLSDLLSSTYDT 389

Query: 392 ------------DICILGLSSVDENSV-ILGDTFLASAYVVYDLENLQISMAQAK 433
                       + C L L +     V ILG+ F+ + Y+  DLE+  I++AQAK
Sbjct: 390 TTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQAK 444

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 137/352 (38%), Gaps = 46/352 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  D+ +GTP QN  V +DTGSS+LWV   +   C                C  +     
Sbjct: 91  YYTDISLGTPAQNFKVILDTGSSNLWVPSVD---CGS------------LACFLHSKYDH 135

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         IQYG  +   G   +D +S+  L +    F             G  
Sbjct: 136 SASSSYKPNGTDFAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEATSEPGLAFAFGKF 194

Query: 212 LTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAE------SGSILFG 265
              L   YN + S        +  + ++  L +   ++ +L +           G   FG
Sbjct: 195 DGILGLAYN-TISVDKVVPPFYNAIDQD--LLDEPRFAFYLGDSSDSEDSSVSGGVATFG 251

Query: 266 AVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDS 325
            +D SK+ G +  LP+    + + +     + V  +GIG+     +  I     AAI D+
Sbjct: 252 GIDKSKFKGEISWLPV----RRKAY-----WEVKFEGIGL---GDEFAILDGHGAAI-DT 298

Query: 326 GTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF 385
           GTSL  LP  +   I S +  +       Y V C  R+S   +L F+F G        ++
Sbjct: 299 GTSLITLPSGLAEIINSEIGAKKG-WSGQYTVDCETRSSL-PDLTFNFSGKNYTIGPYDY 356

Query: 386 ILEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
            LE+    CI  ++ +D         I+GDTFL   Y VYDL N  + +A+A
Sbjct: 357 TLEVSGS-CISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAKA 407

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 113/248 (45%), Gaps = 41/248 (16%)

Query: 220 NGSNSSHSYTYANFPVVLKNAGLTESISYSLFL----------NELDAESGSILFGAVDH 269
           N  +SS     + F  +LK+A + ES SYSL+L           +  +  G +L G VD 
Sbjct: 203 NAIDSSQYTEQSYFLSLLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDP 262

Query: 270 SKYSGNL-------YTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTK---L 319
           S ++G L       Y  P+ N     G+P      V L  I IVS S ++    +K    
Sbjct: 263 SLFTGTLGKFDLIPYVDPVSNAVS-VGYP-----IVPLGPIYIVSNSGQSLNMTSKDFLS 316

Query: 320 AAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIK 379
            A+LDS +S++ LP + I  IA  +   Y   +D +LV CS+ +    +L F     TI+
Sbjct: 317 PALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVQCSIAD-MGVSLGFRLRELTIE 375

Query: 380 GTLSNFILEIED-------------DICILGLSSVDENSV-ILGDTFLASAYVVYDLENL 425
             L + +    D             + C L L +     V ILG+ F+ + Y+  DLE+ 
Sbjct: 376 IPLRDLLSSTYDTSTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDN 435

Query: 426 QISMAQAK 433
            I++AQAK
Sbjct: 436 TIAIAQAK 443

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 109/229 (47%), Gaps = 37/229 (16%)

Query: 236 VLKNAGLTESISYSLFL----NELDA------ESGSILFGAVDHSKYSGNLY---TLPLV 282
           +LKNA   +S SYS++L    + L+A      + G++L GAVD + + GN Y    LP  
Sbjct: 203 MLKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLPFR 262

Query: 283 NTYKDRGFPN-PIEFAVTLQGIGIVSGSKKTTITQTKLA----AILDSGTSLTVLPGTII 337
           ++  +  F + PI   V L  + IV+ +K T +  T+       +LD   +++ LP  +I
Sbjct: 263 DSKTETTFNSLPI---VPLTKVDIVN-AKGTAVNVTQPGFMEPVLLDPRYTISYLPIELI 318

Query: 338 HSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI----------- 386
             IA   N  Y   +D +LV C + N  +  + F FG   I   LS+F+           
Sbjct: 319 LQIAMQTNAVYVKSLDLWLVDCDVAN-FDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIAS 377

Query: 387 --LEIEDDICILGL-SSVDENSVILGDTFLASAYVVYDLENLQISMAQA 432
             L   +  C L +  +      ILG TFL S Y+  DLE   ++MAQA
Sbjct: 378 TQLGASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA 426

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 143/352 (40%), Gaps = 48/352 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSREL--FNCSQYGXX 149
           Y  D+ +GTP QN  V +DTGSS+LWV                 PS++     C  +   
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWV-----------------PSKDCTSLACYLHSKY 146

Query: 150 XXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSI-NGLNVTGLTFXXXXXXXXXXXXL 208
                           IQYG  +   G   RD + I + L +    F             
Sbjct: 147 DHDESTTYEKNGTKFTIQYGSGSM-DGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAF 205

Query: 209 GIGLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFL---NELDAESGSILFG 265
           G     L   Y+    + +     F   +K   L E+  ++ +L   N+ +   G   FG
Sbjct: 206 GKFDGILGLAYD--TIAVNKVVPPFYNAIKQGILDEN-KFAFYLGDTNKDNKSGGEATFG 262

Query: 266 AVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDS 325
             D SK++G++  LP+    + + +     + V    I +  G +  ++      A +D+
Sbjct: 263 GYDKSKFTGDITWLPV----RRKAY-----WEVKFDSIAL--GDEVASLD--GYGAAIDT 309

Query: 326 GTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF 385
           GTSL  LP  +   I + +  + S     Y + C  R++   ++ F+F G+    +  ++
Sbjct: 310 GTSLITLPSGLAEVINTQIGAKKS-WSGQYTIDCDTRDAL-PDMTFNFNGYNFTVSPYDY 367

Query: 386 ILEIEDDICILGLSSVDENS-----VILGDTFLASAYVVYDLENLQISMAQA 432
            LE+    CI  ++ +D         I+GD FL   Y +YDL+N  + +A++
Sbjct: 368 TLEMSGS-CISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLAKS 418

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 111/245 (45%), Gaps = 41/245 (16%)

Query: 223 NSSHSYTYANFPVVLKNAGLTESISYSLFL----------NELDAESGSILFGAVDHSKY 272
           +SS    Y+ F  +LK+A   ES SYSL+L           +     G +L G VD S +
Sbjct: 196 DSSQYTEYSYFLSLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLF 255

Query: 273 SGNLYTLPLVNTYKDRGFPNPIEFAVT-------LQGIGIVSGSKKTTITQTK---LAAI 322
           +G L    L+       + +P+  A+T       L  I IVS S ++    +K     A+
Sbjct: 256 TGTLGQFDLI------PYADPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPAL 309

Query: 323 LDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTL 382
           LDS +S++ LP + I  IA  +   Y   +D +LV CS+ +     L F      I+  L
Sbjct: 310 LDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVQCSMAD-MGVTLAFRLRDLFIEIPL 368

Query: 383 SNFILEIED-------------DICILGL-SSVDENSVILGDTFLASAYVVYDLENLQIS 428
            + +    D             + C L L ++ +    ILG+ F+ + Y+  DLE+  I+
Sbjct: 369 RDLLSSTYDTSTNSSMLFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIA 428

Query: 429 MAQAK 433
           +AQAK
Sbjct: 429 IAQAK 433

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 111/246 (45%), Gaps = 39/246 (15%)

Query: 221 GSNSSHSYTYANFPVVLKNAGLTESISYSLFL----------NELDAESGSILFGAVDHS 270
            ++SSH    + F  +LK+  L ES SYSL+L           +     G +L G VD S
Sbjct: 204 AADSSHYTEQSYFLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPS 263

Query: 271 KYSGNLYTLPL------VNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTK---LAA 321
            ++G L    L      V++    G+P      V L  I IVS S ++    +K     A
Sbjct: 264 LFTGTLGKFDLIPYVDPVSSAVSTGYP-----IVPLGPIYIVSNSGQSLNMTSKDFLSPA 318

Query: 322 ILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGT 381
           +LDS +S++ LP   I  IA  +   Y   +D +LV CS+ N    +L F      I+  
Sbjct: 319 LLDSTSSVSYLPTNTIIQIAVQIAATYVESLDRWLVQCSMAN-MGVSLGFTLRELVIEIP 377

Query: 382 LSNFILEIED-------------DICILGL-SSVDENSVILGDTFLASAYVVYDLENLQI 427
           L + +    D             + C L L ++ +    ILG+ F+ + Y+  DLE+  I
Sbjct: 378 LRDLLSSTYDTSTNSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTI 437

Query: 428 SMAQAK 433
           ++AQAK
Sbjct: 438 AIAQAK 443

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 107/237 (45%), Gaps = 44/237 (18%)

Query: 237 LKNAGLTESISYSLFLNE-------------LDAESGSILFGAVDHSKYSGNLYTLPLVN 283
           L N G+ ++ SYSL+                  A+ G ++ GAVD S Y+G      ++ 
Sbjct: 199 LMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYTG------ILR 252

Query: 284 TYKDRGFPNPIEFA-------VTLQGIGIVSGSKKT---TITQTKLAAILDSGTSLTVLP 333
           ++K   F +P+  A       + L  I I S + K+   T  +     +LDS  S T LP
Sbjct: 253 SFKMIPFIDPVSQAQSNNYPILPLGTIYINSANGKSLNMTSEEFVEPVLLDSRYSTTYLP 312

Query: 334 GTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIED-- 391
              I  IA  +   +   +D +LV+CS+    + +L F FG   I+  L +F++   D  
Sbjct: 313 IDAIVQIAVQIGATFVESLDKWLVACSVAK-LDVSLDFTFGNIEIRVPLEDFLVTTYDPK 371

Query: 392 -----------DICILGLSSVDENSV-ILGDTFLASAYVVYDLENLQISMAQAKFDN 436
                      + C L + S D+    +LG  FL + Y+  D+E+  I++AQAK  N
Sbjct: 372 SNTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQAKMVN 428

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/351 (22%), Positives = 127/351 (36%), Gaps = 46/351 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y+ D+ IGTP Q+  V +DTGSS LWV G     C                C  +     
Sbjct: 93  YAADVTIGTPPQDFRVVVDTGSSTLWVPGKE---CRA------------MACRLHKRYDH 137

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         + YG  +   G    D   I+ L + G  F                
Sbjct: 138 DRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISDLEIPGQQFTETTDEPGSVFVFAAF 196

Query: 212 LTQLETTYNGSNSSHSYTYANFPVV--LKNAGLTESISYSLFLNELDAESG--SILFGAV 267
              L   Y       S  Y   P    L    L +   + ++L+++    G   ++ G  
Sbjct: 197 DGILGLAY------PSLGYGVTPPFQQLMEKKLVKEPVFGMYLDDMKTGEGNGQLVLGGY 250

Query: 268 DHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGT 327
           D +K+ G +  LP+    + + +   +  +VT+             I      A +DSGT
Sbjct: 251 DETKFKGEIAWLPV----RRQAYWEVVFDSVTV---------GDDNIPLENYGAAIDSGT 297

Query: 328 SLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL 387
           SL   P  + +   S L+G       +  V C+    T   L F FGG     +  ++I+
Sbjct: 298 SLITFPSELFNQFISKLSGVTKDRQGNVYVDCA-NKQTAPPLTFGFGGHKFSISGEDYII 356

Query: 388 EI--EDDICILGLSSVDENS----VILGDTFLASAYVVYDLENLQISMAQA 432
            +  +   C+  +  +D +S     I+GD FL   Y +YD  N  + +A A
Sbjct: 357 SVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLRRYYSIYDFGNNAVGLATA 407

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 112/238 (47%), Gaps = 39/238 (16%)

Query: 233 FPVVLKNAGLTESISYSLFLNELD----------AESGSILFGAVDHSKYSGNLYT---L 279
           F   LKNAG+ E+ SYSL++N             A +G++L G+VD   Y G+L +   +
Sbjct: 194 FLTHLKNAGVIETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSI 253

Query: 280 PLVNT---YKDRGFPNPIEFAVTLQGIGIVSGSKKTT-ITQTKL--AAILDSGTSLTVLP 333
           P  +    Y   G+P      V +  + I +  ++   +T +       + S    + LP
Sbjct: 254 PFKDESSGYLSTGYP-----IVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLP 308

Query: 334 GTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI------- 386
            ++I  ++   N  Y   +D +LV+C + +   +NL+F+FG   I     +F+       
Sbjct: 309 LSLIIQVSIQTNAVYVESLDRWLVACDIGD-MGSNLIFEFGNLNISVPTVDFLGATYNMY 367

Query: 387 ----LEIED--DICILGLSSVDENSV-ILGDTFLASAYVVYDLENLQISMAQAKFDNS 437
               L   +  + C L +      S  +LG +F+ +AY+V+D++N  I++AQA  D +
Sbjct: 368 SNSSLRFTNGKEACYLKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASDEA 425

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 139/302 (46%), Gaps = 45/302 (14%)

Query: 208 LGIGLT-QLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFL---------NELDA 257
           LG+G T   +T   G   +HS+ + +    LK A L  S SYSL+L         +  DA
Sbjct: 177 LGLGGTLNSDTELEGDFINHSFFFLD---ALKEARLINSSSYSLWLGSQKRNGFADTSDA 233

Query: 258 -ESGSILFGAVDHSKYSGNLYT---LPLVNTYKDR---GFPNPIEFAVTLQGIGIVSGSK 310
            E+G ++FGAVD +   G       +P ++    +   G+P      V +  I I S S 
Sbjct: 234 NEAGYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYP-----VVPMGPIYITSSSG 288

Query: 311 KT-TITQTKLAA--ILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNT 367
           ++  +T    +A  +LD   +L+ LP   I  IA  +   Y   +D +LVSC + +S  T
Sbjct: 289 RSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCDVASSGAT 348

Query: 368 NLVFDFGGFTIKGTLSNFILEIED-------------DICILGL-SSVDENSVILGDTFL 413
            + F FG  TIK  LS+ +    D             + C+L L  +      +LG  F+
Sbjct: 349 -VDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGYNVLGQAFM 407

Query: 414 ASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSS--TWTATPSSIS 471
            +AY+  DLE   ++M QA    S    ++I   + + +   +   +S  T++  PSS++
Sbjct: 408 KNAYLAVDLEGKGVAMGQAANFKSGERKEIITRQASIVTFTDSLNKTSVATFSTVPSSMT 467

Query: 472 TG 473
           +G
Sbjct: 468 SG 469

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 143/355 (40%), Gaps = 56/355 (15%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWV--TGSNNPYCN-GSTFSDTVPSRELFNCSQYGX 148
           Y  D+ IGTP Q   V +DTGSS+LWV   G ++  C   S +  ++ S    N S +  
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRSNGSDF-- 143

Query: 149 XXXXXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXL 208
                            IQYG  +   G   +D ++I  L +    F            L
Sbjct: 144 ----------------VIQYGSGSL-KGYISQDTLTIGDLIIPQQDFAEATAEPG----L 182

Query: 209 GIGLTQLETTYNGSNSSHSYTYANFPVVLKNA---GLTESISYSLFLNELDAES--GSIL 263
                + +     +  S S   A  P  L NA   GL +   ++ +L +  +    G   
Sbjct: 183 AFAFGKFDGILGLAYDSISVNKAVPP--LYNAIHRGLLDKPMFAFYLGDEKSSKNGGEAT 240

Query: 264 FGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAIL 323
           FG  D S++ G +  LP+    + + +     + V   GI +  G K   +      A +
Sbjct: 241 FGGYDPSRFEGEIKWLPV----RRKAY-----WEVQFDGIKL--GDKFMKLEGH--GAAI 287

Query: 324 DSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNS-TNTNLVFDFGGFTIKGTL 382
           D+GTSL  LP  I   + + +  + S     Y + C  R S     L F    FTI    
Sbjct: 288 DTGTSLITLPSQIADFLNNEIGAKKS-WNGQYTIDCKKRESLPKLTLNFYNHNFTIDPF- 345

Query: 383 SNFILEIEDDICILGLSSVDENSV-----ILGDTFLASAYVVYDLENLQISMAQA 432
            ++ LEI    CI  ++ +D         I+GD FL   Y +YDLEN  + +A++
Sbjct: 346 -DYTLEISGS-CISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVGLAKS 398

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 23/178 (12%)

Query: 260 GSILFGAVDHSKYSGNLYTLPLVNTY---KDRGFPNPIEFAVTLQGIGIVSGSKKTTITQ 316
           G I+ G  +  K+ G++  LP++       D        FA+ +QG              
Sbjct: 233 GEIVLGGYNTQKFKGDIKWLPVLRKAFWETDLSAFKVGNFALDVQG-------------- 278

Query: 317 TKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGF 376
             L A+ D+G+S  ++P        S   G        Y V CS  NS   +L  DFGG 
Sbjct: 279 --LTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY-VDCSTVNS-GPDLTLDFGGV 334

Query: 377 TIKGTLSNFILEIEDDICILGLS--SVDENSVILGDTFLASAYVVYDLENLQISMAQA 432
            +K +  ++++++  + CIL +S  S     VILGDTFL   Y +Y+  +  I +A A
Sbjct: 335 ALKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVASA 392

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 11/60 (18%)

Query: 69  QSELYKRASSDYQELEIK---------NQQSF-YSLDLFIGTPGQNVTVQIDTGSSDLWV 118
           + EL +R   D +EL++          N ++F YS+D+ +GTP QN  V +DTGSS LW+
Sbjct: 51  RHELSRRTVED-EELQVGGGKFSANVYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWI 109

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 25/195 (12%)

Query: 260 GSILFGAVDHSKYSGNLY---TLPLVNTYK---DRGFPNPIEFAVTLQGIGIVSGSKKTT 313
           G ++FGAVD S Y+G+     T+P  N       RG+P      +T   +   SG  K  
Sbjct: 241 GKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGYP---IIPLTKVNVQSKSGETKNM 297

Query: 314 ITQTKLAAIL-DSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFD 372
            + + L  +L DS      LP  II  IA   N  Y   ++ +L++C +      +++F+
Sbjct: 298 TSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLACDV-GRLGASIIFE 356

Query: 373 FGGFTIKGTLSNFI-------------LEIEDDICILGL-SSVDENSVILGDTFLASAYV 418
           FG  +I   L+N +                +   C L L  S      +LG  F+ + Y+
Sbjct: 357 FGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKNVYM 416

Query: 419 VYDLENLQISMAQAK 433
             +LE+ Q+++AQA+
Sbjct: 417 AAELESNQVALAQAQ 431

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 99/213 (46%), Gaps = 26/213 (12%)

Query: 242 LTESISYSLFLNELDAES-GSILFGAVDHSKYSGNLY---TLPLVNT---YKDRGFPNPI 294
           + ES +YS  L+ +  E+ G ++FG VD S Y+G+L    TLP  N       RG+P   
Sbjct: 222 VIESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGYPIVP 281

Query: 295 EFAVTLQGIGIVSGSKKTTITQTKLAAIL-DSGTSLTVLPGTIIHSIASSLNGRYSPLID 353
              V ++     SG  K   ++  L  +L D+      LP  +I  IA+  N  Y   ++
Sbjct: 282 LVKVDVKS---KSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLN 338

Query: 354 SYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI-------------LEIEDDICILG-LS 399
            +L++C +      +++FDFG   I   LS+ +                 D  C L  L 
Sbjct: 339 RWLLACDV-GKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLP 397

Query: 400 SVDENSVILGDTFLASAYVVYDLENLQISMAQA 432
           + D    ILG  F+ + Y+  +L++ Q+++AQA
Sbjct: 398 NSDLGFSILGGPFIKNVYLAAELQSNQVALAQA 430

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 101/234 (43%), Gaps = 45/234 (19%)

Query: 237 LKNAGLTESISYSLFL--------------NELDAESGSILFGAVDHSKYSGNLYTLPLV 282
           L N+G+ ++ SYS++                E  ++ G I+FG VD S   G   +  ++
Sbjct: 229 LLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDGTFQSFTMI 288

Query: 283 NTYKD-------RGFPNPIEFAVTLQGIGIVSGSKKT---TITQTKLAAILDSGTSLTVL 332
             Y+D        G+P      + +  I I++ S +T   T        +LDS  + + L
Sbjct: 289 -PYEDTSDGLTTSGYP-----ILPMGPIYIIANSGRTLNLTTLDFLEPVLLDSRITNSRL 342

Query: 333 PGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL----- 387
           P + I  +A  L   Y   +D ++V CSL +  N N  F FG   I+  L +F++     
Sbjct: 343 PASFIIQVAIQLEAMYLESLDRWVVPCSLAD-YNVNFDFSFGSVRIRVPLEDFLVPSGLT 401

Query: 388 --------EIEDDICILGL-SSVDENSVILGDTFLASAYVVYDLENLQISMAQA 432
                      +D C L +  + D    ILG  FL +A +  D  + QI++ +A
Sbjct: 402 GDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIAIGKA 455

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 238 KNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFA 297
           +   + + ISYSLFLN  +   GSILFGAVD SKY+  L T P+   Y      + I   
Sbjct: 5   RQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAYNTLDSNSRI--I 62

Query: 298 VTLQGIGIVSGS 309
           +T+Q + I+ G 
Sbjct: 63  ITVQSVAILDGK 74

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 91/205 (44%), Gaps = 33/205 (16%)

Query: 260 GSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIV----------SGS 309
           G+++ GAVD   Y G L    ++         N +  AVT  G+ I+          SG+
Sbjct: 249 GNLVLGAVDQRYYEGRLVQFDML-----PALLNNVTEAVTY-GLPIIPMGPIYIENSSGT 302

Query: 310 KKTTITQTKLAAIL-DSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTN 368
           +    T   L  +L DS  +   LP   +  IA+ LN  Y     S++V CSL    N N
Sbjct: 303 QLNLTTTNFLEPVLLDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVECSLA-EMNVN 361

Query: 369 LVFDFGGFTIKGTLSNFILEI--------------EDDICILGL-SSVDENSVILGDTFL 413
           L F+F G TI  +L++F+  +               +D C L +  + D    ILG  FL
Sbjct: 362 LNFNFQGLTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFL 421

Query: 414 ASAYVVYDLENLQISMAQAKFDNST 438
            + Y+  D E   +++A+A  ++ T
Sbjct: 422 KNIYLAIDNEGRSVAIAKAVKEDDT 446

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 122/273 (44%), Gaps = 48/273 (17%)

Query: 237 LKNAGLTESISYSLFLNEL---------DAESGSI----LFGAVDHSKYSGNLYTLPLVN 283
           + N  L +S SYSL+L            DA++GS+    + GAVD S Y G  +    ++
Sbjct: 208 MANLNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTIS 267

Query: 284 ----TYKDRGFPNPIEFAVTLQGIGIVSGSKK---TTITQTKLAAILDSGTSLTVLPGTI 336
               ++    F  PI   + +  I + S + +    T  Q    A+LDS    + LP   
Sbjct: 268 YIEPSHNLSTFGYPI---LPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANT 324

Query: 337 IHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIED----- 391
           I  IA  +   Y   ++ ++V CS+  S   ++ F F G  IK  LS+ +   +D     
Sbjct: 325 IIQIAIQIGAIYIESLNRWVVPCSVA-SMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNS 383

Query: 392 --------DICILGLSSVDENSV-ILGDTFLASAYVVYDLENLQISMAQAK--FDNSTSD 440
                     C L L S +     +LG +F+ +AY+  DL+  ++++AQAK    +STS 
Sbjct: 384 TMHFAEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAKNTTGDSTSI 443

Query: 441 IDVIRGNSGVPSAIKAPGYSSTWTATPSSISTG 473
           + VI   +G        G S+T   T   IS+G
Sbjct: 444 VTVIPALTG--------GGSTTAVRTVRKISSG 468

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 97/215 (45%), Gaps = 41/215 (19%)

Query: 244 ESISYSLFLNE------------LDAESGSILFGAVDHSKYSGNLY---TLPLVNTYKDR 288
           +S SYSL+L +             +   G ++ GAVD S Y+G+     T+P  +   D 
Sbjct: 218 DSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFDTIPFHDV--DT 275

Query: 289 G---FPNPIEFAVTLQGIGIVSGSKKT-TITQTKLA--AILDSGTSLTVLPGTIIHSIAS 342
           G   F  PI   V L  + + + S +T  +T    A   +LD+    + LP  +I  IA 
Sbjct: 276 GATSFGYPI---VPLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLPLKLIIQIAI 332

Query: 343 SLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGLSSVD 402
             N  Y   +D +LVSCS+ +  N +++F+F G +I   + +F+    D +    L   +
Sbjct: 333 QTNAYYVESLDRWLVSCSVGD-LNASMIFEFNGLSIDVPIKDFLSNSYDSVSNSTLHFSN 391

Query: 403 ENSV--------------ILGDTFLASAYVVYDLE 423
            NS               +LG  F+ +AY+  DLE
Sbjct: 392 GNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 86  KNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWV-TGSNNPYCN 127
           K+    Y ++  +GTPGQ   +++D     LWV +GS    CN
Sbjct: 40  KDTTGLYYVNTTLGTPGQEQMLRVDISQPYLWVLSGSEYAQCN 82

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 132/355 (37%), Gaps = 48/355 (13%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGXXXX 151
           Y  D+ +GTP Q   V +DTGSS+LWV   +   C                C  +     
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPSVD---CGS------------LACFLHNKYDH 135

Query: 152 XXXXXXXXXXXXXXIQYGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIG 211
                         I YG  +   G    D + I  L +    F             G  
Sbjct: 136 SQSSTYIKDGRPLSISYGSGSI-EGYISEDNLQIGDLTIQNQKFGETTSEPGLAFAFGKF 194

Query: 212 LTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFL---NELDAESGS------I 262
              L   Y+    +       F   ++   L ES  +S +L   N+  AE GS       
Sbjct: 195 DGILGLAYD--TIAQDDITPPFYSAIQQHLLDES-KFSFYLKSVNDPAAEGGSASDGGVF 251

Query: 263 LFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAI 322
             G VD SK+ G+L  L +    + + +     + V L  I +  G + T   +   AAI
Sbjct: 252 TLGGVDSSKFKGDLIPLHV----RRQAY-----WEVPLNAIKL--GDQSTGKLENTGAAI 300

Query: 323 LDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTL 382
            D+GTSL  LP  +   I + +  +       Y + CS R     +L F   G     + 
Sbjct: 301 -DTGTSLITLPSDMAEIINAQIGAKKG-WTGQYTLECSTRAKL-PDLTFTLDGHDFVLSP 357

Query: 383 SNFILEIEDDICILGLSSVD-----ENSVILGDTFLASAYVVYDLENLQISMAQA 432
             + LE+    CI  ++ +D         ILGD FL   Y V+DL+   +S+A+A
Sbjct: 358 FEYTLEVSGS-CISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVVSLAEA 411

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 96/228 (42%), Gaps = 32/228 (14%)

Query: 237 LKNAGLTESISYSLFLNE-----------LDAES--GSILFGAVDHSKYSGNLYTLPLVN 283
            K A +T+S SYSL+L E            + E   G +L G +D + Y G+LY   ++ 
Sbjct: 238 FKEANITQSNSYSLWLVEDESSLTTTSTKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIP 297

Query: 284 TYKDRGFPNPIEFAVTLQGIGIV---SGSKKTTITQTKLAAIL-DSGTSLTVLPGTIIHS 339
                   +   + +   G+  V   SG++    ++  L  +L DS      LP   I  
Sbjct: 298 YVDPESLVSSQGYPILPMGVIYVKSESGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQ 357

Query: 340 IASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI-----------LE 388
           IA  +   Y   +D +LVSC +  S   +++F F G  I   L N +           + 
Sbjct: 358 IAIQIGATYIESMDRWLVSCDMA-SYGASVLFTFDGLEIDVPLENLLTNTFETGSNSSIY 416

Query: 389 IEDDICILGLSSVDENSV---ILGDTFLASAYVVYDLENLQISMAQAK 433
             D      L+  D  ++   +LG  F  + Y+  DLE   +++AQAK
Sbjct: 417 YSDGETACALTIYDNANMGYNLLGSAFFRNTYIAVDLEGNTVAIAQAK 464

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 34/246 (13%)

Query: 217 TTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFL------------NELDAESGSILF 264
           T  + SN  +SY   +F   L    L +S SYSL+L            N + +  G ++ 
Sbjct: 193 TDIDSSNFDNSY---DFLDRLYQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLIL 249

Query: 265 GAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQG-IGIVSGSKKTTITQTK---LA 320
           GAVD + ++G+     ++   +       I + +   G I +VS S +     +K     
Sbjct: 250 GAVDPTLFTGSFLQFEMLPALESDSATETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEP 309

Query: 321 AILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKG 380
             LDS  + T LP  +I  +A  +   Y   ++ +LV C++ N   T L F F   +I+ 
Sbjct: 310 VFLDSTYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPCNIANQHAT-LDFTFQDVSIRV 368

Query: 381 TLSNFI-------------LEIEDDICILGLSSVDENSV-ILGDTFLASAYVVYDLENLQ 426
            L++ +                 D+ C L + S       ILG  FL   Y+  DL+   
Sbjct: 369 PLTDLLGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNN 428

Query: 427 ISMAQA 432
           I++AQA
Sbjct: 429 IAIAQA 434

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 98/235 (41%), Gaps = 44/235 (18%)

Query: 236 VLKNAGLTESISYSLFLN---ELDAE------------SGSILFGAVDHSKYSGNLY--- 277
           +L  +GL +S SYSL+L    E D +            +G +L G+VD S +    Y   
Sbjct: 215 MLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFD 274

Query: 278 TLPLVN-TYKDRGFPNPIEFAVTLQGIGIVSGS-KKTTITQTKL--AAILDSGTSLTVLP 333
            LP V+   +   F  P+   + +  I IVS +   T +T        +L+S      LP
Sbjct: 275 VLPYVDPNTQIESFSFPV---IPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLP 331

Query: 334 GTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIED-- 391
              I  IA  +   Y   +D +L+ CS+ N  N +  F F    IK  L +F+    D  
Sbjct: 332 LNSIIQIAIQVGATYVESLDRWLLPCSIANE-NVHFEFTFDKLNIKAPLIDFLESTFDST 390

Query: 392 -----------DICILGL---SSVDENSVILGDTFLASAYVVYDLENLQISMAQA 432
                      + C L L   + V  N+  LG  FL S Y+  + E   + MAQA
Sbjct: 391 TNTSMHFSDNSEACFLKLYPNTYVGFNA--LGRPFLKSVYLAVEQEGRIVGMAQA 443

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 102/253 (40%), Gaps = 46/253 (18%)

Query: 237 LKNAGLTESISYSLF----------LNELDAESGSILFGAVDHSKYSGNLYT---LPLVN 283
           +++AGL  S SYSL+          L  +  + G+++ GAVD   Y GN Y    +P V+
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 284 ----TYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLA--AILDSGTSLTVLPGTII 337
                +   G+P      V L G    +  ++  +T    A   +L+S    + LP +I+
Sbjct: 256 IASGQHTRGGYPIVPLTRVQLLG----TEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIV 311

Query: 338 HSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE------- 390
             IA   N  ++   +  +V CSL      +  F FG   ++  LS+FI           
Sbjct: 312 QQIARQTNAVFTKSSNRLIVECSLLKE-EASFRFHFGELVVEVPLSDFIGPTNLRAGTSI 370

Query: 391 -----DDICILGL-SSVDENSVILGDTFLASAYVVYDLENLQISMAQA---------KFD 435
                ++ C L L  S      +LG   L   Y+  D E+  + MA A            
Sbjct: 371 LAPDTNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALAVRPVDRNVTSLP 430

Query: 436 NSTSDIDVIRGNS 448
            ST ++  IR  S
Sbjct: 431 RSTGEVAAIRSGS 443

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 69/168 (41%), Gaps = 35/168 (20%)

Query: 92  YSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG-------------------STFS 132
           Y +++ IGTP Q   +++DTGSSD+ V  +++ +C                      T S
Sbjct: 94  YVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKSLADDNNIWTSNYELTATATETLS 153

Query: 133 DTVPS-RELFNCSQYGXXXXXXXXXXXXXXXXXXIQYGDTTF--ASGTWGRDVMSINGLN 189
             +PS   + +CS +G                   +Y +T F    GT+G DV+S+  + 
Sbjct: 154 TPLPSVHHITSCSYWG---------TFNPNISSTFKYNETIFDLTYGTYGTDVVSLGNIT 204

Query: 190 VTGLTFXXXXXXXXXXXXLGIGLTQLETTYNGSNSSHS----YTYANF 233
           ++  TF            LGI L   E T  G ++  S    + Y NF
Sbjct: 205 LSNYTFGVSNDTTMSYGILGISLPSEEITDRGQDALSSNKTPFAYDNF 252

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 70  SELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126
           S ++KR   D     + N    Y + + IGTP Q   +Q+DTGSSD++V  +++PYC
Sbjct: 47  SNVFKR--DDVLNSTLINAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYC 101

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 14/92 (15%)

Query: 49  FDIAKKWQDINLGQHNLN--FKQSELYKRASSDYQELEIKNQQSFYSLDLFIGTPGQNVT 106
           F + K    IN+G  +++  FK++E+            + N    Y + + IGTP Q V 
Sbjct: 30  FPVQKFADIINIGTQDVSTVFKRNEVLNTT--------VINGIGVYVVKMEIGTPPQTVY 81

Query: 107 VQIDTGSSDLWVTGSNNPYC----NGSTFSDT 134
           +Q+DTGSSD+ V  ++  YC    +GS ++ T
Sbjct: 82  LQLDTGSSDMIVNNADIAYCKSMSDGSDYAST 113

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 97/216 (44%), Gaps = 32/216 (14%)

Query: 236 VLKNAGLTESISYSLFLNELDAE-------SGSILFGAVDHSKYSGNLYTLPLV---NTY 285
           VL  +    S  ++L+L+ +++E       SG    G      Y G++Y   LV   N Y
Sbjct: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275

Query: 286 K----DRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIA 341
                DR F N     VT Q     +G++    +++K + I+DSG++  VLP      I 
Sbjct: 276 WLIAIDRIFCNST--LVTFQNPENFTGAQ----SRSKRSGIIDSGSTFLVLPKVDALDIH 329

Query: 342 SSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDD------ICI 395
           S L G  +   + + V C   NST  +L F+ G        S+++ E   +       C+
Sbjct: 330 SYLPGSITDG-NYFAVFC---NST-VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCV 384

Query: 396 LGLS-SVDENSVILGDTFLASAYVVYDLENLQISMA 430
             +      +S ILGD F+ + Y V+D++N Q+  A
Sbjct: 385 SNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 106/244 (43%), Gaps = 43/244 (17%)

Query: 237 LKNAGLTESISYSLFLN--------------ELDAESGSILFGAVDHSKYSGNLYTLPLV 282
           LK AGL E   YSL+L                 ++ +G ++ GAV+ +   G   +  ++
Sbjct: 211 LKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKFVSFNML 270

Query: 283 NTYKDRGFPNPIEFA-----VTLQGIGIVSGSKKT---TITQTKLAAILDSGTSLTVLPG 334
             Y++   P+ +E +     + +  I I+S S  +   T        +LDS  + + LP 
Sbjct: 271 -PYQN---PDTLEMSNGYPILPMGPINIISKSGASLNMTSNNYLQPVLLDSRYTNSRLPI 326

Query: 335 TIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFI-------- 386
             I  IA  ++  Y   ++S++VSCS+   +   L F FG   IK  L  F+        
Sbjct: 327 EAIIQIAIQIDASYVEQLNSWVVSCSILKES-VVLEFSFGPLRIKVPLKQFLKKAIDPDT 385

Query: 387 -----LEIEDDICILGL-SSVDENSVILGDTFLASAYVVYDLENLQISMAQA--KFDNST 438
                L   D  CIL L  + D    ILG  F+ S Y+  D E   I++ Q+  +F +  
Sbjct: 386 GNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGTIALGQSLRRFISEA 445

Query: 439 SDID 442
            +I+
Sbjct: 446 DNIE 449

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 94/220 (42%), Gaps = 40/220 (18%)

Query: 236 VLKNAGLTESISYSLFLNELDAES-------GSILFGAVDHSKYSGNLYTLPLVNTYKDR 288
           +L+ + L    S+S+ L+ + +ES       G I+FG    + Y G L   PLV      
Sbjct: 217 LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLV------ 270

Query: 289 GFPNPI-EFAVTLQGIGIVSGSKKTTITQTK----------LAAILDSGTSLTVLPGTII 337
             PNP   + V ++   I  GS++  +   K           + I+D+G++L VLP    
Sbjct: 271 --PNPQNHWLVAIKAAYI--GSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDA 326

Query: 338 HSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIE------D 391
            ++ S  +   S   D    +    +S   +L      +TI    SNF+ E        +
Sbjct: 327 LALHSYFDDSIS---DGKNFAIYCNSSEPIHLELSKHNWTILP--SNFVGEPYPKDSPYN 381

Query: 392 DICILGLSSVD-ENSVILGDTFLASAYVVYDLENLQISMA 430
             C+  +   D  +S ILG+ FL   Y V+D+E  Q+  A
Sbjct: 382 GYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 168 YGDTTFASGTWGRDVMSINGLNVTGLTFXXXXXXXXXXXXLGIGLTQLETTYN--GSNSS 225
           YGD T+  GT+G DV+S+  + +   +F            LGI L   E T++  G+ ++
Sbjct: 55  YGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGGAYNT 114

Query: 226 HSYTYANFP 234
             + Y NFP
Sbjct: 115 TPFEYENFP 123

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 19/191 (9%)

Query: 252 LNELDAESGSILFGAVDHSKYSGNLY---TLPLVNTYKDRGFPNPI--EFAVTLQGIGIV 306
           + +L +  G    G      Y G +Y    +P  N+Y      N    ++ V        
Sbjct: 247 VQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENF 306

Query: 307 SGSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTN 366
           +GSK    +    ++I+DSGT+L +LP      I +      +   + + + C   NST 
Sbjct: 307 TGSK----SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMC---NSTQ 358

Query: 367 T-NLVFDFGGFTIKGTLSNFILEIEDDI----CILGLSSVD-ENSVILGDTFLASAYVVY 420
           T  L FD   +TI           +D      C+  +  +D +++ ILGD FL   Y V+
Sbjct: 359 TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418

Query: 421 DLENLQISMAQ 431
           D+EN ++  A+
Sbjct: 419 DVENQRLGFAE 429

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 9/95 (9%)

Query: 391 DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQ---------AKFDNSTSDI 441
           D + ILG   V    V+    +  S  +V D+++ ++ MA+         +  +++ + I
Sbjct: 209 DSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEMGATHTINSGKEDAVAKI 268

Query: 442 DVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNI 476
             I    GV  A++A G   TW      I  GG++
Sbjct: 269 LEITNGRGVDCAMEAVGAQPTWDICQQIIKEGGHL 303

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 11/96 (11%)

Query: 391 DDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQ----------AKFDNSTSD 440
           D + I+G   V    V+    +  S  +V D+++ +++MA+          AK D  +  
Sbjct: 209 DTVAIVGAGPVGMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAKEDAVSKI 268

Query: 441 IDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNI 476
           ++   G  GV   ++A G  +TW      I  GG++
Sbjct: 269 LEYTNGR-GVDCVMEAVGAQATWDICQRVIKEGGHL 303

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326
           +D  KY   ++   L +T KDR         +T   +G  S S KT    ++L  + D+ 
Sbjct: 110 IDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNC 169

Query: 327 TSLTVL-PGTIIHSIASSLNGRYSP 350
            S+    PG +  S    +   Y+P
Sbjct: 170 DSIIAFPPGHVYDSETDQITRYYTP 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,722,998
Number of extensions: 2381522
Number of successful extensions: 7603
Number of sequences better than 10.0: 161
Number of HSP's gapped: 7300
Number of HSP's successfully gapped: 217
Length of query: 538
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 424
Effective length of database: 40,409,475
Effective search space: 17133617400
Effective search space used: 17133617400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)