Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B065206.13ON49549525620.0
KNAG0E027506.13ON49849420350.0
NCAS0D026206.13ON49346919900.0
CAGL0A01045g6.13ON48349219690.0
SAKL0E00946g6.13ON49348119640.0
Smik_6.4706.13ON48848819570.0
KLLA0D00902g6.13ON49247919580.0
YPL262W (FUM1)6.13ON48848819510.0
Ecym_30166.13ON48946819510.0
KLTH0C11462g6.13ON49247419490.0
TDEL0G045806.13ON48446819440.0
Skud_16.166.13ON48848819380.0
Suva_16.436.13ON48846519240.0
NDAI0I024706.13ON47546419220.0
Kwal_56.223626.13ON49346919210.0
ZYRO0C07964g6.13ON50548419020.0
ACR013C6.13ON48847718880.0
TPHA0J002706.13ON49646618790.0
Kpol_1032.46.13ON46746518730.0
Kpol_1045.766.13ON48546018620.0
TBLA0G010006.13ON46546118000.0
TBLA0A071306.13ON50045917870.0
Ecym_27491.354ON4702891463e-09
KLLA0A08404g1.354ON4612111411e-08
TBLA0F034801.354ON4662851402e-08
KAFR0A009501.354ON4642811393e-08
KNAG0I015601.354ON4622171349e-08
NDAI0G059401.354ON4622391349e-08
CAGL0I08987g1.354ON4612401341e-07
CAGL0B02794g4.197ON4821841331e-07
AEL019W1.354ON4692151322e-07
NCAS0A090101.354ON4622871312e-07
Smik_8.831.354ON4632371312e-07
Suva_15.2011.354ON4632371312e-07
Kpol_1018.1251.354ON4602411285e-07
TPHA0A021901.354ON4632401285e-07
Skud_8.701.354ON4632371285e-07
YLR359W (ADE13)4.197ON4821901286e-07
Suva_10.4594.197ON4821901286e-07
SAKL0D09746g1.354ON4642401276e-07
Smik_12.4464.197ON4821901277e-07
YHR018C (ARG4)1.354ON4632371277e-07
ZYRO0G00748g1.354ON4622371261e-06
TDEL0D022201.354ON4652111251e-06
Ecym_24524.197ON4821921241e-06
KLLA0B13189g4.197ON4821961242e-06
TPHA0B010404.197ON4822041232e-06
Skud_12.4434.197ON4821821223e-06
SAKL0B04972g4.197ON4821861204e-06
TBLA0A083204.197ON4821841188e-06
NDAI0J019504.197ON4821861188e-06
Kwal_47.180664.197ON4821841189e-06
ZYRO0B07964g4.197ON4821841171e-05
NCAS0J012004.197ON4821841171e-05
Kpol_1042.164.197ON4821891162e-05
KNAG0B058404.197ON4821841152e-05
Kwal_27.127821.354ON4652541143e-05
KLTH0A03344g4.197ON4821841133e-05
KLTH0G19338g1.354ON4652561133e-05
TDEL0E017604.197ON4821861116e-05
ABL006C4.197ON4821901099e-05
KAFR0A062304.197ON4821821099e-05
ZYRO0E09460g3.564ON100952780.70
TDEL0C039402.267ON739147742.0
NCAS0D015105.94ON90088732.4
KNAG0G033308.824ON112878698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06520
         (495 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   991   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   788   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   771   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   763   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   761   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   758   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   758   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   756   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   756   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   755   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   753   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   751   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   745   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   744   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   744   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   737   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   731   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   728   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   726   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   721   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   697   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   692   0.0  
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    61   3e-09
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    59   1e-08
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    59   2e-08
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    58   3e-08
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    56   9e-08
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    56   9e-08
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    56   1e-07
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    56   1e-07
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    55   2e-07
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    55   2e-07
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    55   2e-07
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    55   2e-07
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    54   5e-07
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    54   5e-07
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    54   5e-07
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    54   6e-07
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    54   6e-07
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    54   6e-07
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    54   7e-07
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    54   7e-07
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    53   1e-06
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    53   1e-06
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    52   1e-06
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    52   2e-06
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    52   2e-06
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    52   3e-06
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    51   4e-06
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    50   8e-06
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    50   8e-06
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    50   9e-06
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    50   1e-05
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    50   1e-05
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    49   2e-05
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    49   2e-05
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    49   3e-05
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    48   3e-05
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    48   3e-05
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    47   6e-05
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    47   9e-05
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    47   9e-05
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...    35   0.70 
TDEL0C03940 Chr3 (689070..691289) [2220 bp, 739 aa] {ON} Anc_2.2...    33   2.0  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    33   2.4  
KNAG0G03330 Chr7 (717383..720769) [3387 bp, 1128 aa] {ON} Anc_8....    31   8.4  

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/495 (97%), Positives = 482/495 (97%)

Query: 1   MMINISSKGSIVHLVKLTSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSL 60
           MMINISSKGSIVHLVKLTSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSL
Sbjct: 1   MMINISSKGSIVHLVKLTSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSL 60

Query: 61  QNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDH 120
           QNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDH
Sbjct: 61  QNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDH 120

Query: 121 FPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMH 180
           FPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMH
Sbjct: 121 FPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMH 180

Query: 181 IAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMT 240
           IAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMT
Sbjct: 181 IAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMT 240

Query: 241 NGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALA 300
           NGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALA
Sbjct: 241 NGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALA 300

Query: 301 AHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 360
           AHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ
Sbjct: 301 AHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 360

Query: 361 NEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCID 420
           NEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKP             TDASYSFRVHCID
Sbjct: 361 NEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCID 420

Query: 421 GLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQ 480
           GLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQ
Sbjct: 421 GLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQ 480

Query: 481 FSEWVIPEKMIGPKQ 495
           FSEWVIPEKMIGPKQ
Sbjct: 481 FSEWVIPEKMIGPKQ 495

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/494 (76%), Positives = 425/494 (86%), Gaps = 2/494 (0%)

Query: 2   MINISSKGSIVHLVKLTSYTSRFYTMSSIKSS-FRAETDSFGEINVPNDKYWGAQTQRSL 60
           + N S K S V +  L +   R  + S+I +  FR ETDSFGEINVP D+YWGAQTQRS 
Sbjct: 5   VFNSSGKAS-VKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSF 63

Query: 61  QNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDH 120
           QNFKIGG+REKIP P++ AFGILKKSAA VNE LGTLD  +A  I +AADEV++GKL+DH
Sbjct: 64  QNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDH 123

Query: 121 FPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMH 180
           FPLVVFQTGSGTQSNMNANEVISNRAIEL+GG+LGSK VHPNNHVNQSQSSNDTFPTVMH
Sbjct: 124 FPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMH 183

Query: 181 IAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMT 240
           IAA  EI  KL+PEL +LK++L  K  EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ 
Sbjct: 184 IAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVE 243

Query: 241 NGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALA 300
           NGI+R++++LYHL FLAQGGTAVGTGLNTK GFDKL+AE++S+ETG++FETAPNKFEALA
Sbjct: 244 NGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALA 303

Query: 301 AHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 360
           AHDAIVE SGALNTLACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQ
Sbjct: 304 AHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQ 363

Query: 361 NEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCID 420
           NEAMTQVC+QVMGN+STITFAGSQGQFELNVYKP             TDAS SFR+HC++
Sbjct: 364 NEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLN 423

Query: 421 GLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQ 480
            LKAN++ I ENLNKSLMLVTALNP IGYD A+K+AKNAHHKNITLKESALELG+LTE++
Sbjct: 424 DLKANKDKIDENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKE 483

Query: 481 FSEWVIPEKMIGPK 494
           F EWVIPE MI PK
Sbjct: 484 FDEWVIPENMISPK 497

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/469 (79%), Positives = 404/469 (86%)

Query: 26  TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85
           T ++ +  +R ETDSFGEI VP DKYWGAQTQRS QNFKIGG RE+IP PII AFGILKK
Sbjct: 24  TTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKK 83

Query: 86  SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145
           SAAIVNE LGTLD ++A  I  AADEV QGKL DHFPLVVFQTGSGTQ+NMN NEVISNR
Sbjct: 84  SAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNR 143

Query: 146 AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205
           AIEL+GGKLGSK +HPNNH NQSQSSNDTFP+VMHIAA+LEIT  L+PEL  LK++LD K
Sbjct: 144 AIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVK 203

Query: 206 SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265
           + EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RIE++LYHLKFLAQGGTAVGT
Sbjct: 204 AKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGT 263

Query: 266 GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325
           GLNTK GFDKLIAE++S+ETGI F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQD
Sbjct: 264 GLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQD 323

Query: 326 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385
           IRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVC+Q+MGN+ TI+ AGSQG
Sbjct: 324 IRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQG 383

Query: 386 QFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445
           QFELNVYKP             TDA  SFR+HCID LKAN++ I ENLNKSLMLVTALNP
Sbjct: 384 QFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNP 443

Query: 446 YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
            IGYD ASKIAKNAH KNITLKESALEL  LT E+F EWV+PE MIGPK
Sbjct: 444 KIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/492 (74%), Positives = 411/492 (83%), Gaps = 11/492 (2%)

Query: 2   MINISSKGSIVHLVKLTSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQ 61
           M+  SS+        L  Y++R          +R ETD+FGEI VP DKYWGAQTQRS Q
Sbjct: 1   MLRASSRAK----TSLIGYSARMM-------HYRVETDTFGEIKVPADKYWGAQTQRSFQ 49

Query: 62  NFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHF 121
           NFKIGG RE++P PI+ AFG+LKKSAAIVNE+LGTLDSE+A  I  AADEV++GKLNDHF
Sbjct: 50  NFKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHF 109

Query: 122 PLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHI 181
           PLVVFQTGSGTQSNMNANEVISNRAIEL+GG+LGSK +HPNNH NQ+QSSNDTFP+VMHI
Sbjct: 110 PLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHI 169

Query: 182 AAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTN 241
           AA+ EIT  LLPE+  LK++L KK+ EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ N
Sbjct: 170 AAVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVN 229

Query: 242 GIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAA 301
           GI RIE  L HLK+LAQGGTAVGTGLNTK GFDKLIAEQIS+ETGI+F+TAPNKFEALAA
Sbjct: 230 GIARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAA 289

Query: 302 HDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 361
           HDAIVE SGALNT+ACSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQN
Sbjct: 290 HDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQN 349

Query: 362 EAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDG 421
           EAMTQVC+QVMGN++ +TFAG+ GQFELNV+KP              DA +SFRVHC++G
Sbjct: 350 EAMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEG 409

Query: 422 LKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQF 481
           ++ANRE I  NL+ SLMLVTALNP IGYD ASKIAKNA  KNITLKESALEL  LT E+F
Sbjct: 410 IEANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEF 469

Query: 482 SEWVIPEKMIGP 493
            EWVIPE M+GP
Sbjct: 470 DEWVIPENMVGP 481

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/481 (75%), Positives = 413/481 (85%), Gaps = 2/481 (0%)

Query: 17  LTSYTSRFYTMSS--IKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPI 74
           L S + R  + SS   +  +R ETD+FGEI VP DKYWGAQTQRS +NFKIGG RE++P 
Sbjct: 13  LPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPE 72

Query: 75  PIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQS 134
            ++ AFG+LKKSAAIVNE LGTLD E++K I  AADEV QGKL DHFPLVVFQTGSGTQS
Sbjct: 73  AVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQS 132

Query: 135 NMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPE 194
           NMNANEVISNRAIE++GG+ GSK VHPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPE
Sbjct: 133 NMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPE 192

Query: 195 LNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLK 254
           L +L++S  KKS+EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L+HLK
Sbjct: 193 LTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLK 252

Query: 255 FLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNT 314
           FLAQGGTAVGTGLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNT
Sbjct: 253 FLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312

Query: 315 LACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
           LACSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN
Sbjct: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372

Query: 375 HSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLN 434
           ++ ITFAG+ GQFELNV+KP              DASYSFRVHC+DG+KAN + I++ L+
Sbjct: 373 NAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLH 432

Query: 435 KSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
           +SLMLVTALNP IGYD ASK+AKNAH K ITLKESAL+LG+L E++F EWVIPEKMIGPK
Sbjct: 433 ESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492

Query: 495 Q 495
           +
Sbjct: 493 E 493

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/488 (74%), Positives = 415/488 (85%), Gaps = 7/488 (1%)

Query: 14  LVKLTSYTSRFYTMSSIK-------SSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIG 66
           +++LT+ + + +  SS K       S+FR ETD+FGEINVP DKYWGAQTQRS QNFKIG
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 67  GEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVF 126
           G RE++P+P++ AFG+LKKSAAIVNE LG LD +++K I  AADEV+ GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVF 120

Query: 127 QTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLE 186
           QTGSGTQSNMNANEVISNRAIE++GGK+GSK VHPNNH NQSQSSNDTFPTVMHIAA L+
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 187 ITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRI 246
           I  +L+PEL +LKN+L+ KS EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 247 ETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIV 306
             +L  L FLAQGGTAVGTGLNTK GFD  IAEQIS+ETG+ F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 307 EVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 366
           E SGALNTLACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 367 VCIQVMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANR 426
           VC+QVMGN++ ITFAGSQGQFELNV+KP             TDA+YSFRVHC++G+KAN 
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 427 ENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVI 486
             I E L KSLMLVTALNP IGYD ASK+AKNAH K ITLKESALELG+LTE++F EWV+
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 487 PEKMIGPK 494
           PE M+GPK
Sbjct: 481 PENMLGPK 488

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/479 (74%), Positives = 415/479 (86%), Gaps = 1/479 (0%)

Query: 18  TSYTSRFYTMSSIKS-SFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPI 76
           T  +++   ++S++  S+R ETD+FGEI VP+DKYWGAQTQRSLQNFKIGG RE++P PI
Sbjct: 14  TRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPI 73

Query: 77  IEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNM 136
           ++AFG+LKKSAA+VNERLGTLD E+AK I  AADEV+QGKL +HFPLVVFQTGSGTQSNM
Sbjct: 74  VKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNM 133

Query: 137 NANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELN 196
           NANEVISNRAIEL+GG+LGSK +HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL 
Sbjct: 134 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELE 193

Query: 197 SLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFL 256
            LK +L +KS+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +LYHLKFL
Sbjct: 194 GLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFL 253

Query: 257 AQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLA 316
           AQGGTAVGTGLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNTLA
Sbjct: 254 AQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLA 313

Query: 317 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
            SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGNH+
Sbjct: 314 VSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHA 373

Query: 377 TITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKS 436
            ITFAG+ GQFELNV+KP              DAS SFR+HC++G+KAN + I + L++S
Sbjct: 374 AITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHES 433

Query: 437 LMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPKQ 495
           LMLVTALNP IGYD ASK+AKNAH K ITLKESALEL +L+ E+F +WVIPEKMIGPK+
Sbjct: 434 LMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/488 (74%), Positives = 414/488 (84%), Gaps = 7/488 (1%)

Query: 14  LVKLTSYTSRFYTMSSIK-------SSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIG 66
           +++ T+ + + +  SS K       SSFR ETD+FGEI+VP DKYWGAQTQRS QNFKIG
Sbjct: 1   MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG 60

Query: 67  GEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVF 126
           G RE++P+P++ AFG+LKKSAAIVNE LG LD +++K I  AADEV+ GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF 120

Query: 127 QTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLE 186
           QTGSGTQSNMNANEVISNRAIE++GGK+GSK VHPNNH NQSQSSNDTFPTVMHIAA L+
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 187 ITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRI 246
           I  +L+PEL +LKN+L+ KS EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 247 ETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIV 306
             +L  L FLAQGGTAVGTGLNTK GFD  IAEQIS+ETG+ F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 307 EVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 366
           E SGALNTLACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 367 VCIQVMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANR 426
           VC+QVMGN++ ITFAGSQGQFELNV+KP             TDA+YSFRVHC++G+KAN 
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 427 ENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVI 486
             I E L KSLMLVTALNP IGYD ASK+AKNAH K ITLKESALELG+LTE++F EWV+
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 487 PEKMIGPK 494
           PE M+GPK
Sbjct: 481 PEHMLGPK 488

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/468 (76%), Positives = 407/468 (86%)

Query: 26  TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85
           T + +   FR ETD+FGEI VP +KYWGAQTQRSL+NFKIGG RE++P PII+AFGILKK
Sbjct: 20  TTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKK 79

Query: 86  SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145
           SAAIVNE LGTLD +++K I  AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 80  SAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNR 139

Query: 146 AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205
           AIEL+GG+LG+K +HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL +L++S  KK
Sbjct: 140 AIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKK 199

Query: 206 SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265
           + EF+ IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E +L+HLKFLAQGGTAVGT
Sbjct: 200 TEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGT 259

Query: 266 GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325
           GLNTK GF + IAEQ+S+ET I F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIA D
Sbjct: 260 GLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIAND 319

Query: 326 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385
           IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ C+QVMGN+STITFAG+ G
Sbjct: 320 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASG 379

Query: 386 QFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445
           QFELNV+KP              DASYSFRVHC+DG+KAN + I + L++SLMLVTALNP
Sbjct: 380 QFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNP 439

Query: 446 YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493
            IGYD+A K+AKNAH KNITLKESALELG+L+EE+FSEWV+PEKMIGP
Sbjct: 440 KIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/474 (75%), Positives = 404/474 (85%)

Query: 21  TSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAF 80
           T    T S+I    R ETD+FGEINVP DKYWGAQTQRSL+NFKIGG RE++P P++ AF
Sbjct: 19  TRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAF 78

Query: 81  GILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANE 140
           GILKKSAAIVNE LGTLD +++K I  AADEV  GKL DHFPLVVFQTGSGTQSNMNANE
Sbjct: 79  GILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANE 138

Query: 141 VISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKN 200
           VISNRAIE++GGK+G+K++HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL +L++
Sbjct: 139 VISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRD 198

Query: 201 SLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGG 260
           S   KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L HLKFLAQGG
Sbjct: 199 SFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGG 258

Query: 261 TAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLF 320
           TAVGTGLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDAIVE SGALNTLACSLF
Sbjct: 259 TAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLF 318

Query: 321 KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITF 380
           KIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITF
Sbjct: 319 KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITF 378

Query: 381 AGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLV 440
           AG+ GQFELNV+KP              DA YSFRVHC+DG++ANR+ I + L++SLMLV
Sbjct: 379 AGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLV 438

Query: 441 TALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
           TALNP IGYD ASK+AKNAH K ITLKESALEL +LT  +F +WV+PE M+GPK
Sbjct: 439 TALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/468 (75%), Positives = 408/468 (87%)

Query: 27  MSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKS 86
           MS+    FR ETD+FGEI V  D+YWGAQTQRSL+NF+IGG RE++P PI+ AFG+LKKS
Sbjct: 16  MSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKS 75

Query: 87  AAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 146
           AA+VNE LGTLD ++A+ I  AADEV+QGKL  HFPLVVFQTGSGTQSNMNANEVISNRA
Sbjct: 76  AAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRA 135

Query: 147 IELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKS 206
           IEL+GG+LGSK +HPNNH NQ+QSSNDTFP+VMHIAA+ EITR LLPEL  L++SLD KS
Sbjct: 136 IELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKS 195

Query: 207 NEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTG 266
            EF+DIVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI R+E +L+ LK+LAQGGTAVGTG
Sbjct: 196 KEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTG 255

Query: 267 LNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDI 326
           LNTK GF + IAEQ+S+ETG++F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDI
Sbjct: 256 LNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDI 315

Query: 327 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQ 386
           RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVC+QVMGN++ ITFAG+ GQ
Sbjct: 316 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQ 375

Query: 387 FELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPY 446
           FELNV+KP              DASYSFRVHC+DG+ ANR+ I + +++SLMLVTALNP 
Sbjct: 376 FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPK 435

Query: 447 IGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
           IGYD ASK+AKNAH K ITLK+SAL+LG+LTE +F EWV+PE MIGPK
Sbjct: 436 IGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/488 (73%), Positives = 411/488 (84%), Gaps = 7/488 (1%)

Query: 14  LVKLTSYTSRFYTMSSIK-------SSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIG 66
           +++ +++  +    SS K       S+FR ETD+FGEINVP DKYWGAQTQRS QNFKIG
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 67  GEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVF 126
           G RE++P+P++ AFG+LKKSAA+VNE LG LD +++K I  AADEV+ GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120

Query: 127 QTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLE 186
           QTGSGTQSNMNANEVISNRAIE++GGK+GSK VHPNNH NQSQSSNDTFPTVMHIAA L+
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 187 ITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRI 246
           I  +L+PEL +LKN+L+ KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 247 ETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIV 306
             +L  L FLAQGGTAVGTGLNTK GFD  IAEQIS ETG+ F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300

Query: 307 EVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 366
           E SGALNTLACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 367 VCIQVMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANR 426
           VC+QVMGN++ ITFAGSQGQFELNV+KP             TD++YSFRVHC++G+KAN 
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420

Query: 427 ENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVI 486
             I E L KSLMLVTALNP IGYD ASK+AKNAH K ITLKESALELG+LTE++F EWV+
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 487 PEKMIGPK 494
           PE M+GPK
Sbjct: 481 PENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/465 (76%), Positives = 399/465 (85%)

Query: 30  IKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAI 89
           + S+FR ETD+FGEINVP DKYWGAQTQRS QNFKIGG RE++P+P++ AFG+LKKSAAI
Sbjct: 24  MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83

Query: 90  VNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 149
           VNE LG LD +++K I  AADEV+ GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 150 MGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEF 209
           +GGK+GSK VHPNN  NQSQSSNDTFPTVMHIAA L+I ++L+PEL +LKN+L+ KS EF
Sbjct: 144 LGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEF 203

Query: 210 NDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNT 269
             IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+   L  L FLAQGGTAVGTGLNT
Sbjct: 204 EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNT 263

Query: 270 KAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYL 329
           K GFD  IAEQIS+ETG+ F+TAPNKFEALAAHDAIVE SGALNTLACSLFKIAQDIRYL
Sbjct: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 330 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFEL 389
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVC+QVMGN++ ITF GSQGQFEL
Sbjct: 324 GSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFEL 383

Query: 390 NVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGY 449
           NV+KP              DAS SFR+HC++G+KAN   I E L KSLMLVTALNP IGY
Sbjct: 384 NVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 450 DNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
           D ASK+AKNAH K ITLKESALELG+LTE++F EWV+PE M+GPK
Sbjct: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/464 (78%), Positives = 408/464 (87%)

Query: 31  KSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIV 90
           +SSFR ETDSFGEI VP++KYWGAQTQRS QNFKIGGEREKIP+PII+AFGILKKSAAIV
Sbjct: 11  ESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIV 70

Query: 91  NERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELM 150
           N+ LGTLD  +A  II A+DEV QGKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA EL+
Sbjct: 71  NQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELI 130

Query: 151 GGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFN 210
           G +LGSK +HPNNHVNQSQSSNDTFP+VMHIAA+LE+   L+P+L  LKNSLD K+ E+ 
Sbjct: 131 GAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYA 190

Query: 211 DIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTK 270
           +IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RI+ +LYHLKFLAQGGTAVGTGLNTK
Sbjct: 191 NIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTK 250

Query: 271 AGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLG 330
            GFDK+IA+++S+ETGI+FETAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLG
Sbjct: 251 VGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLG 310

Query: 331 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELN 390
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGN+ TI  AGSQGQFELN
Sbjct: 311 SGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELN 370

Query: 391 VYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYD 450
           VYKP             +DA +SF++HC+DGLKAN + I ENL+KSLMLVTALNP IGYD
Sbjct: 371 VYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYD 430

Query: 451 NASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
            ASK+AKNAH KNITLKESALELGLLTEE+F +WVIPE MIGPK
Sbjct: 431 AASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/469 (74%), Positives = 407/469 (86%)

Query: 26  TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85
           T SS+   +R ETD+FGEI VP DK WGAQTQRSL+NFKIGG+RE++P PI++AFGILKK
Sbjct: 24  TSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKK 83

Query: 86  SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145
           SAAIVNE LGTLD +++K I  AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 84  SAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNR 143

Query: 146 AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205
           AI+L+GG++GSK++HPNNH NQ+QSSNDTFP+VMHIAA+ E+T  LLPEL +L+++  KK
Sbjct: 144 AIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKK 203

Query: 206 SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265
           + EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L++LKFLAQGGTAVGT
Sbjct: 204 AQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGT 263

Query: 266 GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325
           GLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNTLACSLFKIA D
Sbjct: 264 GLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIAND 323

Query: 326 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385
           IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITFAG+ G
Sbjct: 324 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASG 383

Query: 386 QFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445
           QFELNV+KP              DA YSFRVHC++G++AN + I + L++SLMLVTALNP
Sbjct: 384 QFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNP 443

Query: 446 YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
            IGYD ASK+AKNAH K ITLKESALELG+L+  +F EWV+PE M+GPK
Sbjct: 444 KIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/484 (72%), Positives = 404/484 (83%), Gaps = 5/484 (1%)

Query: 16  KLTSYT-----SRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGERE 70
           +LTS T     S+ +T +      R ETD+FGEI VP DKYWGAQTQRS +NF+IGG+RE
Sbjct: 21  RLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRE 80

Query: 71  KIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGS 130
           ++P  ++ AFGILKK+ A VNE  G LD +LA  I  AADEV+ GKL DHFPLVVFQTGS
Sbjct: 81  RMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGS 140

Query: 131 GTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRK 190
           GTQSNMNANEVISNRAIEL+GGKLGSK+VHPNNH+N SQSSNDTFPTVMHIAA+L IT+ 
Sbjct: 141 GTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKD 200

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           LLP L +LK+SL KKS EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+E+ L
Sbjct: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260

Query: 251 YHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSG 310
             LK LAQGGTAVGTGLNTK G+ + +A ++++ETGI+F+TAPNKFEALAAHDA+VE SG
Sbjct: 261 DSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASG 320

Query: 311 ALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQ 370
           ALNTLA SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVC+Q
Sbjct: 321 ALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQ 380

Query: 371 VMGNHSTITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENIT 430
           V GNHS ITFAG+ GQFELNV+KP             +DASYSFRVHC+DG++ANRENI 
Sbjct: 381 VFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIA 440

Query: 431 ENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKM 490
           + L++SLMLVTALNP IGYD ASK+AKNAH   ITLKESAL+L +LT E+F  WV+PE M
Sbjct: 441 KLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHM 500

Query: 491 IGPK 494
           IGPK
Sbjct: 501 IGPK 504

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/477 (71%), Positives = 397/477 (83%)

Query: 18  TSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPII 77
           +S   R  + +     FR ETD+FGEI VP DKYWGAQTQRSL+NF+IGG RE++P P++
Sbjct: 11  SSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVV 70

Query: 78  EAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMN 137
            AFG+LKKSAA+VNE+LGTL+  +AK I  AADEV+QG+L +HFPLVVFQTGSGTQSNMN
Sbjct: 71  RAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMN 130

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANEVISNRAIEL+GG+LGSK VHPNNH NQ+QSSNDTFP+VMHIAA+ EITR LLPEL +
Sbjct: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L+ S  +K++EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E A   L+FLA
Sbjct: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
           QGGTAVGTGLNT+ GF + IA Q+S ETG+ F TAPNKFEALAAHDA+VE SGALNTLAC
Sbjct: 251 QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLAC 310

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHST 377
           SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ C+QVMGN++ 
Sbjct: 311 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA 370

Query: 378 ITFAGSQGQFELNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSL 437
           ITFAG+ GQFELNV+KP              DA+ SFRVHC+DG++ N + I + L++SL
Sbjct: 371 ITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESL 430

Query: 438 MLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
           MLVTALNP IGYD AS +AKNAH K ITL+ SALELG+LT+ +F EWV+PEKMIGP+
Sbjct: 431 MLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/466 (73%), Positives = 400/466 (85%)

Query: 29  SIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAA 88
           S ++ FR ETD FGEI VP +KYWGAQT+RS +NF+IGG RE++P P+++AFG+LKKSAA
Sbjct: 31  SDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAA 90

Query: 89  IVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 148
           IVNE  GTLD +++K I  AADEV QGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE
Sbjct: 91  IVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 150

Query: 149 LMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNE 208
           L+GG LGSK VHPNNHVNQ+QSSND+FPTVMHIAA+ EIT  L+PE+ +L+++L+ KS +
Sbjct: 151 LLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKD 210

Query: 209 FNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLN 268
           F  IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RIE +L +LKFLAQGGTAVGTGLN
Sbjct: 211 FAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLN 270

Query: 269 TKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRY 328
           T+ GF + IAEQIS+ETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRY
Sbjct: 271 TRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRY 330

Query: 329 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFE 388
           LGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GN+ TI FAG+QGQFE
Sbjct: 331 LGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFE 390

Query: 389 LNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIG 448
           LNV+KP              D S SFR+HC++G+KAN E I + +NKSLMLVTALNP IG
Sbjct: 391 LNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIG 450

Query: 449 YDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494
           YD A+K+AKNAH K ITLKESA++LG LTE +F EWV+PEKMIGPK
Sbjct: 451 YDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/465 (73%), Positives = 397/465 (85%)

Query: 29  SIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAA 88
           S  + FR ETD FGEI VP DKYWGAQTQRS +NFKIGG RE++P P+++AFG+LKKSAA
Sbjct: 2   SFPNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAA 61

Query: 89  IVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 148
           IVNE  G LD+ ++K I  AADEV +GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIE
Sbjct: 62  IVNEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIE 121

Query: 149 LMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNE 208
           L GG +GSK +HPNNH N +QSSNDTFPTVMHIAA+ EIT  L+P++  LK++L  KS E
Sbjct: 122 LKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKE 181

Query: 209 FNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLN 268
           F  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RIE +L +LKFLAQGGTAVGTGLN
Sbjct: 182 FEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLN 241

Query: 269 TKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRY 328
           TK GF + IAEQ+S+ETGI F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRY
Sbjct: 242 TKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRY 301

Query: 329 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFE 388
           LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITFAG+ GQFE
Sbjct: 302 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFE 361

Query: 389 LNVYKPXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIG 448
           LNV+KP              DA +SF +HC++G++AN + I + L++SLMLVTALNP IG
Sbjct: 362 LNVFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIG 421

Query: 449 YDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493
           YD+A+K+AKNAH K ITLKESALELG+LTE++F EWV+PEKM+GP
Sbjct: 422 YDSATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/460 (74%), Positives = 390/460 (84%)

Query: 34  FRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNER 93
           FR ETD FGEI VP +KYWGAQT+RS +NFKIGG RE++P  ++ AFG+LKK AAIVN  
Sbjct: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 94  LGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGK 153
           LG LD   +K I  AADEV+ GKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 154 LGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIV 213
           LGSK +HPNNH N +QSSNDTFPTVMHIAA+ +I++ LLPEL  L+++L  KS EF  IV
Sbjct: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 214 KIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGF 273
           KIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RIE A  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 274 DKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGP 333
            + IA +IS+ETG+ F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 334 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYK 393
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ +TFAG+ GQFELNV+K
Sbjct: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 394 PXXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNAS 453
           P              DAS SFRVHC++G+KAN   I+E L++SLMLVTALNP IGYD A+
Sbjct: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 454 KIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493
           K+AKNAH K ITLKESALELG+LTE++F EWV+PEKM+GP
Sbjct: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/461 (71%), Positives = 386/461 (83%)

Query: 35  RAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERL 94
           R E D FGE+ VP +KYWGAQTQR+L NF IGGERE++P P+I A+GILKKS AIVNE L
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 95  GTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKL 154
           GTLD +++K I  AADEV++G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE++GG+L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 155 GSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVK 214
           GSKTVHPNNHVNQSQS+ND+FPT MHI+A+ E+  KLLPEL  L+++L  KS EFN IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 215 IGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFD 274
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +L +LKF+AQGGTAVGTG+NTK  FD
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 275 KLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPR 334
            L+A+QIS ETGI F+TAPNKFEALA+HDAIVE SGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 335 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKP 394
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q CIQVMGN+S ITFAG+ GQFELN YKP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 395 XXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASK 454
                        TD+  SFR+HCI G++AN + I + LN+SLMLVTALNP IGYD A+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 455 IAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPKQ 495
           IAK+AH   +TLKE+AL+  LLT EQF EW++PE M+ P +
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/459 (71%), Positives = 377/459 (82%)

Query: 35  RAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERL 94
           R ETDSFGEI VP +KYWGAQTQRS  NFKIGGERE++P PII AFG  KK+AAIVN  L
Sbjct: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100

Query: 95  GTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKL 154
           GTLD  L   I+ AA+EVSQG LN+HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG L
Sbjct: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160

Query: 155 GSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVK 214
           GSK VHPNNHVNQSQSSNDTFPTVMHIAA+ EIT  LLP L  L+ +LD K+ EF  I+K
Sbjct: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220

Query: 215 IGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFD 274
           IGRTHLQDATPLTLGQEFSGY QQ+TN I+RIE  L  L+++AQGGTAVGTGLNTK GF 
Sbjct: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280

Query: 275 KLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPR 334
           +  A Q+S +T ++F T+PNKFE+LAAHDAIV V  +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340

Query: 335 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKP 394
           CGYGELS+PENEPGSSIMPGKVNPTQNEAM Q C+QVMGN+STI+FAG+ GQFELN YKP
Sbjct: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400

Query: 395 XXXXXXXXXXXXXTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASK 454
                        +DA +SF +HC  G++AN++ I   L++SLMLVT+LNP IGYD ASK
Sbjct: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460

Query: 455 IAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493
           +AKNAHHK ITLK+SALEL +L+ +QF EWV PE M+GP
Sbjct: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 116/289 (40%), Gaps = 34/289 (11%)

Query: 93  RLGTLDSE----LAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 148
           ++G LD E    + K ++    E S GK  +H            +    ANE    R  E
Sbjct: 51  KIGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGE 98

Query: 149 LMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNE 208
           L+G  +  K       V+  +S ND   T M I     +  K+LP ++S    L  ++ E
Sbjct: 99  LIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRARE 151

Query: 209 FNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLN 268
             D++  G THLQ A P+      S Y    T    R+   +  L    Q     G    
Sbjct: 152 EVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAG 208

Query: 269 TKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRY 328
              G D+   + ++E+ G N     N   A++  D ++E+    +     + + A+D+  
Sbjct: 209 HPYGIDR---KYLAEQLGFN-GIIGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLII 264

Query: 329 LGSGPRCGYGELSLPEN-EPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
             +     +G ++L +    GSS+MP K NP   E +     +V G  S
Sbjct: 265 YSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLS 310

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 89/211 (42%), Gaps = 11/211 (5%)

Query: 165 VNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDAT 224
           V+  +S ND   T M I     +   +LP L+SL   + +++ E  D++  G THLQ A 
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQ 166

Query: 225 PLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEE 284
           P+      S Y    T   +R++  +  L     G  A+        G D+         
Sbjct: 167 PIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA---GHPYGIDREFL-----A 218

Query: 285 TGINFE-TAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP 343
            G+NF     N   A+A  D +VE+    +     + + A+D+  + S    G+ +LS  
Sbjct: 219 AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-D 276

Query: 344 ENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
               GSS+MP K NP   E +     +V G 
Sbjct: 277 AYSTGSSLMPQKKNPDSLELLRGKSGRVFGQ 307

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 115/285 (40%), Gaps = 24/285 (8%)

Query: 92  ERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMG 151
           ++LG L SE  + I     E+ +   N       F+     +    ANE    R  E++G
Sbjct: 50  QKLGLLTSEELEKIHYGLGEIKKEWDNG-----TFKRHPNDEDIHTANE---RRLGEIIG 101

Query: 152 GKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFND 211
             +  K       V+  +S ND   T + I     +  KLLP +  L   + K++    D
Sbjct: 102 THIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEID 154

Query: 212 IVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKA 271
           I+  G THLQ A P+      S Y    T   +R++  L  L     G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA---GHPY 211

Query: 272 GFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGS 331
           G D+   + +S+E G N     N   A++  D IV++          + + ++D+  + S
Sbjct: 212 GIDR---QYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYS 266

Query: 332 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
               G+ +LS      GSS+MP K N    E +     +V G  S
Sbjct: 267 TAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGQLS 310

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 119/281 (42%), Gaps = 24/281 (8%)

Query: 99  SELAKNIIIAADEVSQ-----GKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGK 153
           S L K  ++  DE+S+     GK+ + +    F      +    ANE    R  E++G  
Sbjct: 48  SGLQKLGLLTEDELSEIHYGLGKIKEEWENNTFIRLPSDEDIHTANE---RRLGEIIGTG 104

Query: 154 LGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIV 213
           +  K       V+  +S ND   T M I     +T  LL  L  L + + +++NE  DI+
Sbjct: 105 IAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDIL 157

Query: 214 KIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGF 273
             G THLQ A P+      S Y    T   +R++  L  L     G  A+        G 
Sbjct: 158 MPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSPLGAGALA---GHPYGI 214

Query: 274 DKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGP 333
           D+   E ++++ G +     N   A++  D +VE+    +     + + ++D+  + S  
Sbjct: 215 DR---EFLAQDLGFS-GVIGNSLVAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTA 269

Query: 334 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
             G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 270 EFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 309

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 89/217 (41%), Gaps = 13/217 (5%)

Query: 160 HPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTH 219
           H    V+  +S ND   T M I     +  KLLP +  L   L K++    D +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 220 LQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDK-LIA 278
           LQ A P+      S Y    T   +R++  L  L     G  A+        G D+  +A
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA---GHPYGIDREFLA 219

Query: 279 EQISEETGINF-ETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGY 337
           E      G+NF     N   A++  D +VE+          + + A+D+  + S    G+
Sbjct: 220 E------GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGF 272

Query: 338 GELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
            +LS      GSS+MP K N    E +     +V G+
Sbjct: 273 VKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 100/239 (41%), Gaps = 23/239 (9%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  E++G  +  K       V+  +S ND   T + I     +  KL P + S
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMTS 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L   L K++ E  DI+  G THLQ A P+      S Y    T  ++R++  L       
Sbjct: 141 LIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKSP 200

Query: 258 QGGTAVGTGLNTKAGFDK-LIAEQISEETGINFE-TAPNKFEALAAHDAIVEVSGALNTL 315
            G  A+        G D+  +AE      G+ F+    N   A++  D +VE+       
Sbjct: 201 LGAGALA---GHPYGIDREFLAE------GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 316 ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
              + + A+D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 100/240 (41%), Gaps = 21/240 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  EL+G  +  K       V+  +S ND   T M I     +  K+ P + S
Sbjct: 92  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKS 141

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L N L  ++ +  DI+  G THLQ A P+      S Y    T  ++R+E     L    
Sbjct: 142 LINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLN--- 198

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFE-TAPNKFEALAAHDAIVEVSGALNTLA 316
              + +G+G    AG    I  Q   E G+ F     N   A++  D +VE+        
Sbjct: 199 --KSPLGSG--ALAGHPYGIDRQFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFM 253

Query: 317 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
             + + ++D+  + S    G+ +LS      GSS+MP K N    E +     +V G  S
Sbjct: 254 NHVSRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGELS 311

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 89/184 (48%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKL--IAEQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+  + E+++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 89/215 (41%), Gaps = 9/215 (4%)

Query: 160 HPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTH 219
           H +  V+  +S ND   T M +     +  K+ P L  L   L  ++ E  D++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 220 LQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAE 279
           LQ A P+      S Y        +R++  +  L    Q     G       G D+   E
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGIDR---E 216

Query: 280 QISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGE 339
            ++ E G +     N   A++  D +VE+    +     + ++A+D+  + S    G+ +
Sbjct: 217 YLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFVK 274

Query: 340 LSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
           L+      GSS+MP K NP   E +     +V G 
Sbjct: 275 LA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 113/287 (39%), Gaps = 28/287 (9%)

Query: 92  ERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMG 151
           +++G L  E    I +  D++ +    D F           +    ANE    R  E++G
Sbjct: 50  QKIGLLTEEELAKIHVGLDQIKKEWDEDKFV-----RHPNDEDIHTANE---RRLGEIIG 101

Query: 152 GKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFND 211
             +  K       V+  +S ND   T + I     +  KL P L SL   L K+  E  D
Sbjct: 102 RDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEID 154

Query: 212 IVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKA 271
           I+  G THLQ A P+      S Y    T  + R++  L        G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSPLGAGALA---GHPY 211

Query: 272 GFDK-LIAEQISEETGINFE-TAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYL 329
           G D+  +AE      G+ F     N   A++  D +VE+          + + A+D+  +
Sbjct: 212 GIDREFLAE------GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-II 264

Query: 330 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
            S    G+ +L+      GSS+MP K N    E +     +V G+ S
Sbjct: 265 YSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLS 310

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 95/237 (40%), Gaps = 19/237 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  EL+G  +  K       V+  +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L + L K++    DI+  G THLQ A P+      S Y    T   +R+   L+ L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN--- 197

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
           Q     G       G D+   E ++E  G N     N   A++  D IVE+         
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAEGLGFN-SVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
            + + A+D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 254 HISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 95/237 (40%), Gaps = 19/237 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  EL+G  +  K       V+  +S ND   T + I     +   L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L + L K++    DI+  G THLQ A P+      S Y    T   +R+   L+ L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLN--- 197

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
           Q     G       G D+   E ++E  G N     N   A++  D IVE+         
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAEGLGFN-SVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
            + + A+D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 254 HISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 97/241 (40%), Gaps = 19/241 (7%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  EL+G  +  K       V+  +S ND   T + I     I  KLLP L S
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L   L K+      I+  G THLQ A P+      S Y    T   +R++  L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
            G  A+        G D+   E ++   G N     N   A++  D +VE+         
Sbjct: 199 LGAGALA---GHPYGIDR---EFLANGLGFN-GVIGNSLVAVSDRDFVVELLFWGTLFMN 251

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHST 377
            + + A+D+  + S    G+  LS      GSS+MP K N    E +     +V GN S 
Sbjct: 252 HISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLSG 309

Query: 378 I 378
           +
Sbjct: 310 L 310

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 100/240 (41%), Gaps = 21/240 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  E++G K+  K       V+  +S ND   T + I     ++ KLL  L +
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLK-FL 256
           L N L  ++ E  + +  G THLQ A P+      S Y        +R    L  LK  L
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKR----LVQLKERL 196

Query: 257 AQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLA 316
            +     G       G D+   E ++E+ G +     N   A++  D +VE+        
Sbjct: 197 NKSPLGAGALAGHPYGIDR---EYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFM 252

Query: 317 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
             + + A+D+  + S    G+ +LS      GSS+MP K N    E +     +V GN S
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGNLS 310

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 96/237 (40%), Gaps = 19/237 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  E++G  +  K       V+  +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L + L K++    +I+  G THLQ A P+      S Y    T   +R++  L+ L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLN--- 197

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
           Q     G       G D+   E ++E  G N     N   A++  D IVE+         
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAEGLGFN-SVIGNSMVAVSDRDFIVELMFWGTLFMN 253

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
            + + A+D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 254 HISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 90/190 (47%), Gaps = 27/190 (14%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETG------INFETAPNKFEA 298
             +      GT  GT  +  A F    DK+ A  E+++E  G      +  +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID- 245

Query: 299 LAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 358
                  ++V   L++ A +  K+A DIR L +       E    +++ GSS M  K NP
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNP 295

Query: 359 TQNEAMTQVC 368
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 90/190 (47%), Gaps = 27/190 (14%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETG------INFETAPNKFEA 298
             +      GT  GT  +  A F    DK+ A  E+++E  G      +  +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID- 245

Query: 299 LAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 358
                  ++V   L++ A +  K+A DIR L +       E    +++ GSS M  K NP
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNP 295

Query: 359 TQNEAMTQVC 368
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 97/240 (40%), Gaps = 21/240 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  E++G ++  K       V+  +S ND   T M I     +   LLP L +
Sbjct: 92  ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
               L  ++ E  D++  G THLQ A P+      S Y    T    R++  +  L    
Sbjct: 142 FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFE-TAPNKFEALAAHDAIVEVSGALNTLA 316
            G  A+        G D+    +     G+ F+    N   A++  D +VE+        
Sbjct: 202 LGAGALA---GHPYGIDREFLAR-----GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFM 253

Query: 317 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376
             + + ++D+  + S    G+ +LS      GSS+MP K NP   E +     +V G  S
Sbjct: 254 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFGELS 311

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 27/190 (14%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETG------INFETAPNKFEA 298
             +      GT  GT  +  A F    DK+ A  E+++E  G      +  +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID- 245

Query: 299 LAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 358
                  ++V   L++ A +  K+A DIR L +       E    + + GSS M  K NP
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNP 295

Query: 359 TQNEAMTQVC 368
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 94/237 (39%), Gaps = 19/237 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  EL+G  +  K       V+  +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L   L K++    D++  G THLQ A P+      S Y    T   +R+   L+ L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN--- 197

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
           Q     G       G D+   E ++E  G N     N   A++  D IVE+         
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAEGLGFN-SVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
            + + A+D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 254 HISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 96/237 (40%), Gaps = 19/237 (8%)

Query: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197
           ANE    R  E++G  +  K       V+  +S ND   T M I     +  KLLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257
           L + + K++ +    +  G THLQ A P+      S Y    T  ++R+   L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN--- 197

Query: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317
           Q     G       G D+   E ++EE G       N   A++  D +VE+         
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAEELGFQ-GVIGNSLVAVSDRDFVVELMFWGTLFMN 253

Query: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
            + + A+D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 86/211 (40%), Gaps = 11/211 (5%)

Query: 165 VNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDAT 224
           V+  +S ND   T + I     +  KL P+L +L + + K+  E  D++  G THLQ A 
Sbjct: 108 VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGYTHLQRAQ 167

Query: 225 PLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEE 284
           P+      S Y    T   +R+   +  +    Q     G       G D+         
Sbjct: 168 PIRWSHWLSSYATYFTEDFKRLRQIMDRIN---QSPLGAGALAGHPYGIDREFL-----A 219

Query: 285 TGINFE-TAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP 343
            G+ F+    N   A++  D IVE+          + + A+D+  + S    G+ +L+  
Sbjct: 220 AGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-D 277

Query: 344 ENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374
               GSS+MP K N    E +     +V G+
Sbjct: 278 AYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 92/192 (47%), Gaps = 31/192 (16%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           L+P+L ++ N L   + ++ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINF------ETAPNKFEA 298
             + F    GT  GT  +  A F    DK+ A  ++++E +G +       +T   K + 
Sbjct: 188 NDIGFRGVKGTT-GTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTYSRKVD- 245

Query: 299 LAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKV 356
                  ++V G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K 
Sbjct: 246 -------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKR 293

Query: 357 NPTQNEAMTQVC 368
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 89/196 (45%), Gaps = 39/196 (19%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           L+P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF--------------DKLIAEQISEET--GINFETAPN 294
             +      GT   TG  T+A F              DK +AE +   T   +  +T   
Sbjct: 188 NDIGLRGVKGT---TG--TQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSR 242

Query: 295 KFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIM 352
           K +        ++V   L++ A +  K+A DIR L +       EL  P  +++ GSS M
Sbjct: 243 KID--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAM 289

Query: 353 PGKVNPTQNEAMTQVC 368
             K NP + E   +VC
Sbjct: 290 AYKRNPMRCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 92/204 (45%), Gaps = 12/204 (5%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKL--IAEQISEETGINFETAPNKFEALAAHDA 304
             L      GT  GT  +  A F    DK+  + E+++E  G  F+T         +   
Sbjct: 188 NDLGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L + A +  K+A DIR L +       E    +++ GSS M  K NP + E +
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCERV 301

Query: 365 TQVCIQVMGNHSTITFAGSQGQFE 388
             +   +   +S      S   FE
Sbjct: 302 CSLARHLGSLYSDAVQTASVQWFE 325

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIAEQISEETGINFETAPNKFEALAAHDAIV 306
             +      GT  GT  +  A F    DK+ A        + F+          +    +
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTYSRKIDI 246

Query: 307 EVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 366
           +V   L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +
Sbjct: 247 DVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---R 300

Query: 367 VC 368
           VC
Sbjct: 301 VC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 90/186 (48%), Gaps = 19/186 (10%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           L+P+L ++ N L + + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 362
            ++V   L++ A +  K+A DIR L +       E+  P  +++ GSS M  K NP + E
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 363 AMTQVC 368
              +VC
Sbjct: 300 ---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 86/184 (46%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L   + E+ D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKL--IAEQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+  + E++ E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVVELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L + A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 90/186 (48%), Gaps = 19/186 (10%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 362
            ++V   L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 363 AMTQVC 368
              +VC
Sbjct: 300 ---RVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           L+P+L ++ + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQGSFLALFHSDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ + L K +  + D+  +G TH Q A   TLG+  + ++Q +   +R  + A 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKL--IAEQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+  + ++++E  G  FET         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEELDQRVTELLG--FETVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L + A +  K+A DIR L +       E    + + GSS M  K NP + E  
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 87/184 (47%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ + L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L + A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ + L K ++E+ D+  +G TH Q A   T+G+  + ++Q++   +R    A 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGT--------AVGTGLNTKA-GFDKLIAEQISEET--GINFETAPNKFEAL 299
             +      GT        A+  G + K    DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 300 AAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 359
                 ++V   L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 360 QNEAMTQVC 368
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (47%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ + L K + ++ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 103/254 (40%), Gaps = 30/254 (11%)

Query: 126 FQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAML 185
           F    G +    ANE    R  E++G  +  K       V+  +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCR- 129

Query: 186 EITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRR 245
           E    L   L  L  ++ ++S +  D +  G THLQ A P+      + Y    T   +R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 246 IETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAI 305
           ++     L     G  A+        G D+   E ++E  G + +   N  +A++  D +
Sbjct: 190 LKQIRERLNVSPLGCGALA---GHPYGIDR---EFLAERLGFS-DVIGNSLQAVSDRDFV 242

Query: 306 VEVSGALNTLACSLF-----KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 360
           VE+        CSLF     + ++D+  + S     + +LS      GSS+MP K NP  
Sbjct: 243 VEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDS 295

Query: 361 NEAMTQVCIQVMGN 374
            E +     +V G+
Sbjct: 296 LELLRGKSGRVFGS 309

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 87/184 (47%), Gaps = 15/184 (8%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           L+P+L ++ N L + + ++ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 364
            ++V   L + A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 365 TQVC 368
            +VC
Sbjct: 300 -RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 103/256 (40%), Gaps = 30/256 (11%)

Query: 126 FQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAML 185
           F    G +    ANE    R  E++G  +  K       V+  +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCR- 129

Query: 186 EITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRR 245
           E    +   L  L  ++ +++ +  D +  G THLQ A P+      + Y    T   +R
Sbjct: 130 EALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 246 IETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAI 305
           ++     L     G  A+        G D+   E I+E  G +     N  +A++  D +
Sbjct: 190 LKQIRERLNVSPLGCGALA---GHPYGIDR---EHIAERLGFD-GVIGNSLQAVSDRDFV 242

Query: 306 VEVSGALNTLACSLF-----KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 360
           VE+        CSLF     + ++D+  + S     + +LS      GSS+MP K NP  
Sbjct: 243 VEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDS 295

Query: 361 NEAMTQVCIQVMGNHS 376
            E +     +V G+ S
Sbjct: 296 LELLRGKSGRVFGSLS 311

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 89/186 (47%), Gaps = 19/186 (10%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L   + ++ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINFETAPNKFEALAAHDA 304
             +      GT  GT  +  A F    DK+ A  ++++E  G  F+T         +   
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKI 244

Query: 305 IVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 362
            ++V   L++ A +  K+A DIR L +       E+  P  +++ GSS M  K NP + E
Sbjct: 245 DIDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 363 AMTQVC 368
              +VC
Sbjct: 300 ---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 27/190 (14%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           ++P+L ++ N L K + E+ D+  +G TH Q A   TLG+  + ++Q++   +R    A 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF----DKLIA--EQISEETGINF------ETAPNKFEA 298
             +      GT  GT  +  A F    D++ A  ++++E  G +       +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID- 245

Query: 299 LAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 358
                  +++ G+ ++   +  K+A DIR L +       E    + + GSS M  K NP
Sbjct: 246 -------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNP 295

Query: 359 TQNEAMTQVC 368
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 11/182 (6%)

Query: 191 LLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETAL 250
           L+P+L ++ N L K +    D+  +G TH Q A   TLG+  + ++Q++   +R  E A 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 251 YHLKFLAQGGTAVGTGLNTKAGF--DKLIAEQISEETG--INFETAPNKFEALAAHDAIV 306
             +      GT  GT  +  A F  D    E++ E     + F+T         +    +
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTYSRKIDI 246

Query: 307 EVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 366
           +    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +
Sbjct: 247 DAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---R 300

Query: 367 VC 368
           VC
Sbjct: 301 VC 302

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa]
           {ON} similar to uniprot|P53067 Saccharomyces cerevisiae
           YGL241W
          Length = 1009

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 273 FDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVS-GALNTLACSLFKIA 323
           +D +I+E++  E GI FET    F  + ++DA  E    ALN L C + +++
Sbjct: 155 YDDVISEEMFFEEGIGFETLKIVFHVMNSYDANWEAKVAALNLLHCCILQMS 206

>TDEL0C03940 Chr3 (689070..691289) [2220 bp, 739 aa] {ON} Anc_2.267
           YNL047C
          Length = 739

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 60/147 (40%), Gaps = 25/147 (17%)

Query: 183 AMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNG 242
           A  E+T +++P L  L+  L  K  E           LQ     +  +E     Q M N 
Sbjct: 320 ASKELTNEVIPRLEDLRRDLLVKMKEIKS--------LQSDFKNSCSKELQQTKQDMRNF 371

Query: 243 IRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGI-----NFETAPNKFE 297
           +  IE + Y        G+A      TK   D+ I +Q++EE  +     N E +  + E
Sbjct: 372 LESIEESRY--------GSAKQDPYLTKTILDRQIKKQLTEENFVHEAFDNLENSGAELE 423

Query: 298 ALAAHDAIVEVSGALNTLACSLFKIAQ 324
            +     ++E+  ALN  A  L + AQ
Sbjct: 424 KV----VVMEIQNALNIYARLLGEEAQ 446

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 145 RAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHI--AAMLEITRKLLPELNSLKNSL 202
           R +EL+GG   ++    N H+    +    F T M    ++++ +    L E   L   L
Sbjct: 370 RLVELLGGVSTTEFSKRNTHLISRSNVGKKFKTAMKWGESSVIVVNHLWLEECYKLNKKL 429

Query: 203 DKKSNEFNDIVKIGRTHLQDATPLTLGQ 230
           D K+NEF D   I R  +     LT+GQ
Sbjct: 430 DPKTNEFRDF-NIDREDIL----LTIGQ 452

>KNAG0G03330 Chr7 (717383..720769) [3387 bp, 1128 aa] {ON} Anc_8.824
           YML104C
          Length = 1128

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 12/78 (15%)

Query: 174 TFPTVMHIAAMLEITRKLLPE---LNSLKNSLDK-------KSNEFNDIVKIGRTHLQ-D 222
           T P V + AA++ + RK+L E   +  ++N L +       K N++ND+  I    +  D
Sbjct: 254 TDPDVWN-AAIIRLGRKILKERTQIQQVRNILTRELTESTNKLNDYNDVSNIDPCSITFD 312

Query: 223 ATPLTLGQEFSGYVQQMT 240
            T    G+EF  Y++Q+T
Sbjct: 313 LTVSCTGREFESYLRQLT 330

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,368,475
Number of extensions: 2088416
Number of successful extensions: 5214
Number of sequences better than 10.0: 86
Number of HSP's gapped: 5387
Number of HSP's successfully gapped: 86
Length of query: 495
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 381
Effective length of database: 40,409,475
Effective search space: 15396009975
Effective search space used: 15396009975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)