Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B065106.8ON50850826750.0
KNAG0E027706.8ON50851512881e-174
NDAI0G00860singletonON52352812391e-166
TDEL0G046306.8ON50351911701e-156
Skud_16.56.8ON51552411371e-151
Smik_6.4806.8ON51652911011e-145
YPL272C6.8ON51752610931e-144
CAGL0A01089g6.8ON53553910901e-143
Suva_16.336.8ON51852710581e-139
Kpol_1045.796.8ON50851910511e-138
SAKL0E00792g6.8ON51152310251e-134
TPHA0J002606.8ON5155269871e-128
TPHA0M001806.8ON5035249301e-120
TBLA0A072206.8ON5095259021e-115
NCAS0D021806.8ON5155309011e-115
KLTH0C11572g6.8ON5185237082e-86
Ecym_30116.8ON5095216993e-85
Kwal_56.223416.8ON5195306332e-75
ACR018C6.8ON4784855734e-67
Kpol_1032.1singletonON2462363381e-35
Kpol_191.16.8ON1391361425e-10
CAGL0K00737g5.119ON4571251053e-04
Kwal_27.98985.119ON4603281010.001
TPHA0H009605.119ON476319900.024
KLTH0C02178g5.119ON464132870.053
Skud_9.802.290ON26450760.85
KLTH0C09416g3.86ON92271741.9
TDEL0E051105.119ON469129713.7
Skud_10.1661.302ON882156714.3
Skud_4.2543.205ON751105715.1
KAFR0A010103.266ON46558705.5
NDAI0I016406.108ON25841696.1
Smik_5.3098.188ON805132706.3
KLTH0G16588g3.211ON249878706.9
TPHA0F006604.109ON16652677.6
Skud_7.5485.119ON47582688.4
NDAI0D023605.119ON470470689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06510
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...  1035   0.0  
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   500   e-174
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              481   e-166
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   455   e-156
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   442   e-151
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   428   e-145
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   425   e-144
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   424   e-143
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   412   e-139
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   409   e-138
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   399   e-134
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   384   e-128
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   362   e-120
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   352   e-115
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      351   e-115
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   277   2e-86
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   273   3e-85
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   248   2e-75
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   225   4e-67
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   134   1e-35
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    59   5e-10
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    45   3e-04
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    44   0.001
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    39   0.024
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    38   0.053
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...    34   0.85 
KLTH0C09416g Chr3 (782703..785471) [2769 bp, 922 aa] {ON} simila...    33   1.9  
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    32   3.7  
Skud_10.166 Chr10 (308268..310916) [2649 bp, 882 aa] {ON} YJL070...    32   4.3  
Skud_4.254 Chr4 complement(441927..444182) [2256 bp, 751 aa] {ON...    32   5.1  
KAFR0A01010 Chr1 (191495..192892) [1398 bp, 465 aa] {ON} Anc_3.2...    32   5.5  
NDAI0I01640 Chr9 (387547..388323) [777 bp, 258 aa] {ON}                31   6.1  
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    32   6.3  
KLTH0G16588g Chr7 complement(1437552..1445048) [7497 bp, 2498 aa...    32   6.9  
TPHA0F00660 Chr6 complement(152952..153452) [501 bp, 166 aa] {ON...    30   7.6  
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    31   8.4  
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    31   9.9  

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/508 (100%), Positives = 508/508 (100%)

Query: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA 60
           MTLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA
Sbjct: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA 60

Query: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120
           IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI
Sbjct: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120

Query: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180
           FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS
Sbjct: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180

Query: 181 SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240
           SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP
Sbjct: 181 SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240

Query: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300
           IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT
Sbjct: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300

Query: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360
           NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP
Sbjct: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360

Query: 361 LSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDDD 420
           LSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDDD
Sbjct: 361 LSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDDD 420

Query: 421 IRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRKNDFFSVSYTLCD 480
           IRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRKNDFFSVSYTLCD
Sbjct: 421 IRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRKNDFFSVSYTLCD 480

Query: 481 NSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           NSGLNLCLQFPDDCDMEAFVECFQSFIE
Sbjct: 481 NSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 241/515 (46%), Positives = 361/515 (70%), Gaps = 20/515 (3%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDD-TTLLTLKDSRPTIAILTKA 60
           ++R LSS+E+K+L +++   +NG  F A YS   E W D+  TLLT+KDSR  + +LTKA
Sbjct: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKA 62

Query: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120
           ++ LI +H+ELF TINE +EFE+LK IK  D+++ ++FDS+KDEKINC  G PPYLLRHI
Sbjct: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122

Query: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180
           F+++RFVPGS KPLW L+++D+SL  FHGQD LFD+FS ANFH+LLLKE N++++ P   
Sbjct: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182

Query: 181 SESDIIFSL-ENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKK 239
            + D +F    +S+ ++   +L KSIYDNP++++P  +PDLFNLQTQSFFKS++ +TVKK
Sbjct: 183 KKLDYVFKFGPDSMSEVK--QLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240

Query: 240 PIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLI 299
           PI +L          +D +   + +  KY DI D N+ L   TVFG ++ +R++YLN++I
Sbjct: 241 PIEFL--------TNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTII 292

Query: 300 TNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDV 359
             + +C KSF+VGI MLCLKP ++N  G++ FSI ++LR F+ E   +FGL+YKD+ ++ 
Sbjct: 293 NQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPR-DFGLYYKDIRVEC 351

Query: 360 PLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDD 419
           PLSLIDD+       +  S ++ D  EK++E+QFK +T  V++ +E+R+++FS  GFNDD
Sbjct: 352 PLSLIDDDKSK-DCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDD 410

Query: 420 DIRQMKY------GKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRKNDFFS 473
           DIR+MK+      G  + +   I+++DTS +++        +++   N TKSL   +  S
Sbjct: 411 DIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSEELMS 470

Query: 474 VSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           +SYT C+ +GLN+C+ +P++  ME+FVECFQSF+E
Sbjct: 471 LSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  481 bits (1239), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 251/528 (47%), Positives = 361/528 (68%), Gaps = 26/528 (4%)

Query: 1   MTLRTLSSYERKILDETIRRERNGVIFTASY-----SASSEEWGDDTTLLTLKDSRPTIA 55
           M++R LSS+E+K+L +T+  +RNG+ +TA Y     S+S     D  TLL  KD R  I 
Sbjct: 1   MSIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIG 60

Query: 56  ILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPY 115
           I+T+ ++RLI +H+EL++TINENYEF+IL  IK +D+++++ FD+YKDE+INCH+G PPY
Sbjct: 61  IVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPY 120

Query: 116 LLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN--IV 173
           LLRHIF+  +F     KPLW L+IIDE+++IFHG DMLFDIFSAANFHKL   E N   +
Sbjct: 121 LLRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFL 178

Query: 174 AN--EPLDSSESDIIFSLENSIKKI--NNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFF 229
            N     +S   D++F +  S K    N  +  +SI+DNP++HLPA +PDLFNLQT+SFF
Sbjct: 179 TNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFF 238

Query: 230 KSVFHSTVKKPIH-YLVANVRTK-EVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKI 287
           K+++ +T+KKPI  +  +N  TK ++TS   L    T   Y D+    ++L  TTVFG +
Sbjct: 239 KTIYSNTIKKPIDLFNGSNSHTKNDITSQ--LKEYQT-HNYLDMLGITSSLCGTTVFGTV 295

Query: 288 TRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIE 347
           +  RY YL  ++    IC +SF+ GI+M+CLKPSI+N+ G++ FSI INLR ++  +   
Sbjct: 296 SPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAK-N 354

Query: 348 FGLFYKDVLIDVPLSLIDDNAVMLSGYRDFS---DNDPDLTEKILEFQFKRVTSLVKDLI 404
           FGLFYKDV ID PLSLIDD     +GY+D S   +ND +  EK+LE+QFK+VT  ++++I
Sbjct: 355 FGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVI 414

Query: 405 ERRISKFSTMGFNDDDIRQMKYGKP---AEDTKIIRLFDTSEVSLGSGKRDGK-YILHNT 460
             R+  +    FNDDDI++MK+       +++KII++ DT+E+ LG    + K + L N 
Sbjct: 415 LERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTLTNP 474

Query: 461 NFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           NFT++L  N+F SVS+ +C+ +GLN+C+ +PD   ME FVECFQ+FIE
Sbjct: 475 NFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  455 bits (1170), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 233/519 (44%), Positives = 338/519 (65%), Gaps = 29/519 (5%)

Query: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA 60
           M+ R+L  +E+KIL +++   RNGV+F A YS + EEW DD TLLT KDSR  +++L++ 
Sbjct: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDDATLLTYKDSRLNLSLLSRT 60

Query: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120
           + ++IS HVELFTTINE  EF  +K IK ++++N + F SYKDE +NC  G PPYLLRHI
Sbjct: 61  LAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120

Query: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180
           F+   F PGS   LW ++++DE+LV+FHG D+LFDIFSAANFHK+ L+  N ++      
Sbjct: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKS---G 177

Query: 181 SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240
           S+   IF LE ++         KSIYDN ++ LPA + DLFNLQTQSFFKS++ + VKKP
Sbjct: 178 SKLSTIFKLEKAVLP----PFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKP 233

Query: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300
           + Y+ +N           L    T  +Y DI   +  L  TT+FG+I  +R E L+ +  
Sbjct: 234 LDYINSN-------PPQQLKEYRT--RYADILRTDNNLCGTTIFGRILPKRLESLDCIFK 284

Query: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360
            Q IC KSF+ GI MLCLKP ++N+ GS+ F + ++LR  L E++ EFG+FYKD+ ++ P
Sbjct: 285 QQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSL-EASSEFGMFYKDIRVECP 343

Query: 361 LSLIDD----NAVMLSGYRD----FSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFS 412
           LSLIDD    +  + +GY        + DP   E++LE+QFK+VT  V   + +R+  + 
Sbjct: 344 LSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWE 403

Query: 413 TMGFNDDDIRQMKYGK--PAEDTKIIRLFDTSEVSLGSGKR-DGKYILHNTNFTKSLRKN 469
             GFNDDDI++MK+G    A +TK+I++ D S++ + + +   GK+ +   N T+SL+  
Sbjct: 404 KFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPG 463

Query: 470 DFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
              S+SYT  +  GL++C+ +PD  +ME+FVECFQSFIE
Sbjct: 464 QLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  442 bits (1137), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 228/524 (43%), Positives = 340/524 (64%), Gaps = 28/524 (5%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSASS-----EEWGDDTTLL----TLKDSRP 52
           T R LSS+E+K+L +++  +RNG IF+++YS S       +W  D   L    +  DSR 
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62

Query: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112
           T+  +   ++RLI     LF T+NE +EFE LK +K  DI+N++EF++ KD+++NCH G 
Sbjct: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171
           PP YLLRH F+  RFVPGS KPLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231
            ++ E    S+  ++F + +    I+NL   KSIYD+ ++HLPA +P +F+ QTQSFFKS
Sbjct: 183 NISLEA--HSDDRVLFDISDV--NISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238

Query: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291
           +F++T+K+P  YL         TS       T ++KY DI + +++L  TTVFG +  QR
Sbjct: 239 IFYNTLKRPFGYLTNQTSLGPSTS------TTQLKKYNDILNAHSSLCGTTVFGIVNNQR 292

Query: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ FSI I+LR  L       GLF
Sbjct: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGE-SLGLF 351

Query: 352 YKDVLIDVPLSLIDD--NAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409
           +K++ I+ PLSLIDD  +A      R+  ++D +  EK++E+QF +VT  V D I  ++ 
Sbjct: 352 FKELRIECPLSLIDDELSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLK 411

Query: 410 KFSTMGFNDDDIRQMKYGK-----PAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTK 464
            +   GFNDDDIR+MKY           TK+I++ D S++SL     +  + + ++ FT 
Sbjct: 412 SWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTS 471

Query: 465 SLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           S+ +    S+SYT C+  GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 472 SINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  428 bits (1101), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 225/529 (42%), Positives = 339/529 (64%), Gaps = 37/529 (6%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS-----SEEWGDDTTLL----TLKDSRP 52
           T R LSS+E+K+L +++  +RNG IF+++YS S       +W  D   L    +  DSR 
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62

Query: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112
           T+ ++   ++RLI     LF TINE +EFE L+ +K  DI+N++EF++ KD+++NCH G 
Sbjct: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171
           PP YLLRH F+  RF+PGS +PLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231
            +++  +   E  I+F + N    I++L   KSIYD+ ++HLPA +P +F+ QTQSFFKS
Sbjct: 183 NISS--VTHYEDRILFDINNV--SISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238

Query: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291
           +F++T+K+P  YL         TS ++ +  T ++KY DI + +++L  TTVFG ++ QR
Sbjct: 239 IFYNTLKRPFGYLTNQ------TSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQR 292

Query: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ FSI I+LR  L       GLF
Sbjct: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGE-SLGLF 351

Query: 352 YKDVLIDVPLSLIDDNAVMLSGYRDFSDND------PDLTEKILEFQFKRVTSLVKDLIE 405
           +K++ I  PLSLIDD   +     +F  N        +  EK++E+QF  VT  V   I 
Sbjct: 352 FKELRIACPLSLIDDELSV----NEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIM 407

Query: 406 RRISKFSTMGFNDDDIRQMKYGKPAE------DTKIIRLFDTSEVSLGSGKRDGKYILHN 459
            ++  +   GFNDDDIR+MKY    E       TK++++ D S++SL     D  + + +
Sbjct: 408 AKLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVS 467

Query: 460 TNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           + FT S+ +    S+SYT C   GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 468 SGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  425 bits (1093), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 232/526 (44%), Positives = 346/526 (65%), Gaps = 30/526 (5%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS-----SEEWGDDTTLL----TLKDSRP 52
           T R LSS+E+KIL +++  +RNG IF+++YS S       +W  D   L    +  DSR 
Sbjct: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62

Query: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112
           T+ ++   ++RLI     LF T+NE +EFE LK +K  DI+N++EF++ KD+++NCH G 
Sbjct: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171
           PP YLLRH F+  RFVPGS KPLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231
            ++   +  SE  I+F + N I  ++ LK  KSIYD+ ++HLPA +P +F+ QTQSFFKS
Sbjct: 183 EIST--VTHSEDRILFDV-NDI-NLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238

Query: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291
           ++++T+K+P  YL     T + +  +++S  T ++KY DI + +T+L  TTVFG +  QR
Sbjct: 239 IYYNTLKRPFGYL-----TNQTSLSSSVS-ATQLKKYNDILNAHTSLCGTTVFGIVNNQR 292

Query: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ F+I INLR  L       GLF
Sbjct: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSL-GLF 351

Query: 352 YKDVLIDVPLSLIDDNAV---MLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRI 408
           +K++ ++ PLSLIDD       L+   D  DND +  E+++E+QF +VT  V   I  ++
Sbjct: 352 FKELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKL 411

Query: 409 SKFSTMGFNDDDIRQMKYGKPAE------DTKIIRLFDTSEVSLGSGKRDGKYILHNTNF 462
             +   GFNDDDIR+MKY    +       TK+I++ D S++SL     D  + + +T F
Sbjct: 412 RSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGF 471

Query: 463 TKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           T S+ +    S+SYT C+  GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 472 TSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  424 bits (1090), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 230/539 (42%), Positives = 351/539 (65%), Gaps = 42/539 (7%)

Query: 4   RTLSSYERKILDETIRRERNGVIFTASY----SASSEE--WGDD--TTLLTLKDSRPT-- 53
           R+LSSYERK+L E +   +NG +F ASY    S +++E  W DD  T   T  +SR T  
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 54  ------IAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKIN 107
                 + ++T+A++ LI ++ E++TT+N+  EF  LK I+  D+++++ FD+ KDEK+N
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 108 CHNGCPP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLL 166
           CH+G PP YL+RHI  N+ F PGS KPLW+L++IDES ++FH QD+LFDIFSAANFHKL 
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 167 LKETNIVANEPLDSSESDI--IFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQ 224
           LKE  I    P  S E  +  +F L+ S +  NN  + KSIYDN ++HLPAT P+L NLQ
Sbjct: 183 LKEL-IAVCRPQQSYEKPLEYLFKLQKSFE--NNYSVPKSIYDNLKLHLPATRPELLNLQ 239

Query: 225 TQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQ-----------KYTDIFD 273
           TQSFFKS+F + VKKP+ ++   + +   +S N+ +  T +            +YT+I  
Sbjct: 240 TQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILT 299

Query: 274 YNTTLNNTTVFGKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSI 333
             T+    T+FG ++ +R+ YLNS++ N++IC +SF+  I MLCLKP +++F G++ FS+
Sbjct: 300 SATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSM 359

Query: 334 VINLRPFLKESNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQF 393
            +NLR  + E   +FGL YKD+ ++ PLS+IDD    + G    +++DP+  EK+LE QF
Sbjct: 360 PMNLRDSMNEKR-DFGLVYKDIRVECPLSMIDDKQCSVPG---LNESDPEYNEKLLEIQF 415

Query: 394 KRVTSLVKDLIERRISKFSTMGFNDDDIRQMKYGKP----AEDTKIIRLFDTSEVSLGSG 449
           +++ + V + IE+R+S +   G+ND+D+++MK+ K     A +T++I++ D SEVS    
Sbjct: 416 QQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFDDN 475

Query: 450 KRDGKYILHNTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
                +I  +  FT SL +N   S+SYT C+  GLN+C+ +PD  +ME FV+CF+SF+E
Sbjct: 476 DIRFPHI-KSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  412 bits (1058), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 217/527 (41%), Positives = 344/527 (65%), Gaps = 31/527 (5%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASY------SASSEEWGDDTTLLT---LKDSRP 52
           T R LSS+E+K+L +++  +RNG IF+++Y       A ++   D+ TL T     DSR 
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRL 62

Query: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112
           T+ ++   +++LI     LF T+NE++E+  LK +K  DI+N++EF++ KD+++NCH G 
Sbjct: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122

Query: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171
           PP YLLRH F+  RFVPGS KPLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231
            + +  +  S+  ++F + +       L   KSIYD+ ++ LPA +P + + QTQSFFKS
Sbjct: 183 SITS--VSRSDDRVLFDINDV--NFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKS 238

Query: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291
           +F++T+K+P  YL         TS ++ +  + +++Y DI + N++L  TTVFG +  QR
Sbjct: 239 IFYNTLKRPFGYLTNQ------TSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQR 292

Query: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ FSI I+LR  L       GLF
Sbjct: 293 FSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGE-SLGLF 351

Query: 352 YKDVLIDVPLSLIDD----NAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERR 407
           +K++ I+ PLSLIDD    N  +++   + ++++ +  EK++E+QF +VT  V + I  +
Sbjct: 352 FKELRIECPLSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTK 411

Query: 408 ISKFSTMGFNDDDIRQMKYGKPAE------DTKIIRLFDTSEVSLGSGKRDGKYILHNTN 461
           +  +   GFNDDDIR+MKY    +       TK+I++ D S++SL     D  + + ++ 
Sbjct: 412 LKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSG 471

Query: 462 FTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           FT S+ +    S+SYT C++ GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 472 FTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  409 bits (1051), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/519 (43%), Positives = 333/519 (64%), Gaps = 30/519 (5%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSASSEEW-GDDTTLLTLKDSRPTI--AILT 58
           + R L +YE+K++ + +  + NG+IF+A Y +++++   DD TLLT  +S P +  + L 
Sbjct: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLT--NSEPLLLDSRLV 60

Query: 59  KAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLR 118
            A+Q+++ +H EL TT+NE  EFE +K IK  DI+  ++FDS KDE +NCH G PPYLLR
Sbjct: 61  NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR 120

Query: 119 HIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPL 178
           HIF+ N+F PGS KPLW L +ID+SLV+FHGQD+LFDIF+AANFHKL L+  N + +E +
Sbjct: 121 HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI 180

Query: 179 DSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVK 238
             ++ + I+  + + K   ++   ++IY+NP++ +P  + DL NLQTQSFFKS + + +K
Sbjct: 181 --TDLEYIYRYD-ATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIK 237

Query: 239 KPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSL 298
           KP+  +  N    +    N +          D  +  + L  TTVFG IT  R+EYLNS+
Sbjct: 238 KPLDIITFNSEPMKYIKPNEI----------DFMNEASALCGTTVFGHITTDRFEYLNSI 287

Query: 299 ITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLID 358
             ++ +C +SF+ GI +LCLK  I++F GS+ FSI +NLR  + E   +FGLFYK +L++
Sbjct: 288 ARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESI-EGPSDFGLFYKTILVE 346

Query: 359 VPLSLIDD----NAVMLSGYRD----FSDNDPDLTEKILEFQFKRVTSLVKDLIERRISK 410
            PLSLIDD    N  + +GY +      + DP   EK LE+QFK+++ LV   ++ R+  
Sbjct: 347 CPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRA 406

Query: 411 FSTMGFNDDDIRQMKYGK--PAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRK 468
           +   GFNDDDI++MK+     A +TKII++ D SE  + S K     I    NFT S+  
Sbjct: 407 WRRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFKINSSKSSKVSIKE-LNFTHSISN 465

Query: 469 NDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFI 507
           +DF S+SYT C  +G N+C+ +PD  DME FVE FQSF+
Sbjct: 466 SDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  399 bits (1025), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/523 (41%), Positives = 326/523 (62%), Gaps = 38/523 (7%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS---SEEWGDDTTLLTLKDSRPTIAILT 58
           + R+LSS E+K+  + +  +RNG++F A YS      E W D+ TLLT+KD R + ++++
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65

Query: 59  KAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLR 118
           +A++++I+ +VEL+TTIN+N EF+ +K+I  DD++  +EFDSYKDE +NCH+G PPYLLR
Sbjct: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125

Query: 119 HIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPL 178
           HIFD N+F     KPLW + I+DE++VIFHG D+LFDIF+AANFHKL  +  N +   P 
Sbjct: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL---PK 182

Query: 179 DSSESDIIFSLENSIKKINNLKLS---KSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHS 235
           D    + +F         N+ K S   KSIY+N ++ LPA + DLF LQTQSFFKSV++ 
Sbjct: 183 DGPTLECLFK--------NDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234

Query: 236 TVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYL 295
           T+KKP+ ++  N        ++ L    +   YTDI      L  TTVFG I+ +R   L
Sbjct: 235 TIKKPLDFINTN-------PNSGLKYYQSC--YTDILLGANNLCGTTVFGNISAERVCAL 285

Query: 296 NSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDV 355
             ++  + IC  SF+  I +LCLKP + NF  S+ FSI ++LR  + +++  FGL YK+V
Sbjct: 286 KKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQAS-RFGLCYKNV 344

Query: 356 LIDVPLSLIDDNAVM-LSGYRDF-------SDNDPDLTEKILEFQFKRVTSLVKDLIERR 407
           L++ PL+LIDD     L+ Y  +       ++ DP+  E +LE+QF+   + V + +++R
Sbjct: 345 LVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQR 404

Query: 408 ISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRD--GKYILHNTNFTKS 465
              +   GFNDDDI++MK+GK  E  K  R+ + + V+      D    + + +  FTKS
Sbjct: 405 WRAWERSGFNDDDIKRMKFGK-TEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKS 463

Query: 466 LRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
                F S+S    + SGLN+C+ +PD  +M+ FVECFQSF+E
Sbjct: 464 QNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  384 bits (987), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/526 (41%), Positives = 325/526 (61%), Gaps = 33/526 (6%)

Query: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYS---ASSEEWGDDTTLLTLKDSRPTIAIL 57
           M  R L+SYER +L E+   + NG IF+A Y+    +S    D  TLLT  +     +  
Sbjct: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRF 60

Query: 58  TKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLL 117
             A+  +I+ + EL+TTIN   EFE +  IK DD+++ ++F+S KDE +NC NG PPYLL
Sbjct: 61  INALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLL 120

Query: 118 RHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLK--ETNIVAN 175
           RHIF+ ++FVPGS KPLW+L+I+D+S+VIFHGQD+LFDI+SAA+FH+      E     +
Sbjct: 121 RHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS 180

Query: 176 EPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHS 235
           E L +     IF L +  K        KSIYD+P + LPA + DL +LQT+ F KSV   
Sbjct: 181 EKLTT-----IFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSK 235

Query: 236 TVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYL 295
           T+ KP++ ++ N        D  +   T      DI +  ++L  TTVFG I+ +R++YL
Sbjct: 236 TIVKPLNIIMFN--------DEPMKSFTNSDP-MDILEKTSSLCGTTVFGNISNERFDYL 286

Query: 296 NSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDV 355
            S+   + +C KS + GI MLCLKP I++F  ++ FSI +NLR  ++ES  EFGLFYK+V
Sbjct: 287 QSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEEST-EFGLFYKNV 345

Query: 356 LIDVPLSLIDDNAVML----SGY----RDFSDNDPDLTEKILEFQFKRVTSLVKDLIERR 407
            I+VPLS IDDN   L    +GY     +  + +P+  E+++ +QF ++ + +   +++R
Sbjct: 346 RIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQR 405

Query: 408 ISKFSTMGFNDDDIRQMKYGKPAEDT--KIIRLFDTSEVSLGSGKRDGK---YILHNTNF 462
           +  +   GFNDDDI+ MK+G   ++T  KII++ D S++S     ++G+     L + +F
Sbjct: 406 MRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSF 465

Query: 463 TKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           T SL  + F S+SYT C ++G N+C+ FP+  D+E FVE FQ+FI+
Sbjct: 466 THSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  362 bits (930), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 317/524 (60%), Gaps = 38/524 (7%)

Query: 1   MTLRTLSSYERKILDETIRRERNGVIFTA--SYSASSEEWGDDTTLLTLKDSRPTIA--- 55
           M  R L  YE+K+L +TI   RNGV+F++  +++  S+E+ DD   L    S   ++   
Sbjct: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60

Query: 56  ILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPY 115
           +L  A+Q +I  HVEL+TTIN+   F  +  I+ +D++  + +D  KD+ +   +     
Sbjct: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119

Query: 116 LLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIV-- 173
           LLRHIF+   F P + KPLW   I ++S +IFHG D+LFDIFS ANF K LLKE N V  
Sbjct: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLN 179

Query: 174 ANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVF 233
           +N+ L + ++   F  E S+         +SIY+NP++HLPA + DL NLQTQSFFK+++
Sbjct: 180 SNQKLKTVKTLFKFDAERSLT-----NYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIY 234

Query: 234 HSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYE 293
            +T+KKPI      + +    ++N LS   T  + TDI     +L   TV G+I+ +RY+
Sbjct: 235 QNTLKKPIDL----ITSANSNNNNQLSEYRT--RNTDILSGANSLCGRTVLGEISLERYQ 288

Query: 294 YLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYK 353
           +L  L+  + I  +SF+  I M+CLKP ++NF+GS+ FSI +NLR  + +S+ +FGLFYK
Sbjct: 289 HLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSS-DFGLFYK 347

Query: 354 DVLIDVPLSLIDD-----NAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRI 408
           ++ ++ PL LI+D     N  +L   ++ S         +LE QF+R++  V D+I +R+
Sbjct: 348 NIKVECPLELINDEKYYTNPEVLHSMQNNS---------LLEIQFERISRHVSDVISQRM 398

Query: 409 SKFSTMGFNDDDIRQMKYGKPAED--TKIIRLFDTSEVSLGSGKRDGKY--ILHNTNFTK 464
             +   GFNDDDI++MK+    +     II++ D +E+S   G  +  Y   ++N NFTK
Sbjct: 399 KAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTK 458

Query: 465 SLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           SL  N+F S+ Y+     GLN+C+ +PD  +MEAFVECFQSFIE
Sbjct: 459 SLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  352 bits (902), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/525 (39%), Positives = 315/525 (60%), Gaps = 45/525 (8%)

Query: 2   TLRTLSSYERKILDETIRRE-RNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA 60
            LR LSS E++ L  ++  E R+G + +  + ++S +  DD TLL+ KD   TI+++++A
Sbjct: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDKPLTISLVSRA 70

Query: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120
           ++ LIS H+E+FTTIN+N EF++L  I   D+L+ + F++ KDE +NCH+G PPYL+ +I
Sbjct: 71  LKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYI 130

Query: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180
           F    F P SKKPLW L I++ SLV+F+G D LFDIF+ ANF KLL +   I+ + P ++
Sbjct: 131 FSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFE---IINSLPYEN 187

Query: 181 SE--SDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVK 238
            E   DIIF L N I+ I+ +   KSIYDNP +HLPAT P+LFNLQTQSFFKS++ +T K
Sbjct: 188 KEIQDDIIFKLPN-IRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFK 246

Query: 239 KPIHYLVANVRTKEVTSDNTLSRVTTVQK-YTDIFDYNTTLNNTTVFGKITRQRYEYLNS 297
           K   YL    +T  +     L+R   + K Y +I   N+ + +  V G ++ +RY  L  
Sbjct: 247 KSFDYLNFTQQTPII-----LARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLK 301

Query: 298 LITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFL--------------KE 343
           LI  ++I  KSF   II++CLK  I  F+GS+ F I  NLR                 ++
Sbjct: 302 LIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPED 361

Query: 344 SNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDL 403
           S  E G+ YKD+ ++VPL LI+                    E ++E QFK V + + + 
Sbjct: 362 SANELGIIYKDIYVEVPLKLIEKIG----------------NEDVVEEQFKIVCNYINES 405

Query: 404 IERRISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFT 463
           I++RI  +   GFNDDDI++MK+G   +   II + D + + L   K D  + + + + T
Sbjct: 406 IQKRIKAWEKNGFNDDDIKRMKFGY-EQVGNIIEVNDLTSLDLSCSK-DSLFHIEDLSLT 463

Query: 464 KSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           ++L+KN   S+S+   + +GLNLC+ +  +  M+ F++CFQSF+E
Sbjct: 464 RNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  351 bits (901), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/530 (39%), Positives = 321/530 (60%), Gaps = 38/530 (7%)

Query: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYS----ASSEEWGDDTTLLTLKDSRPTIAI 56
           M  R LS YE K+L++T++ +RNGV F A Y      SS    D++TL++LKD R T+++
Sbjct: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSV 60

Query: 57  LTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYL 116
           +T+ +Q LI +H+EL+T I+E++ + ++  I+  D+++I+ FDS KDE+INCH G PPYL
Sbjct: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120

Query: 117 LRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANE 176
           LRHIF+ + F  G +KPLW L+IIDE+ +IFHG DMLFD FSAA FHK  L E N   + 
Sbjct: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180

Query: 177 PLDSSES---DIIFSLENSIKKINNL-KLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSV 232
            + S +    D +F L +S   I    ++ +SIYD         +  +FN QT+SFFKS+
Sbjct: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240

Query: 233 FHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQK--------YTDIFDYNTTLNNTTVF 284
           + + VKKPI ++            NT S+V T Q+        Y +    + +L   T+F
Sbjct: 241 YLNAVKKPIEFIT-----------NTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIF 289

Query: 285 GKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKES 344
           G I+  R+  L    T ++I  KS + G+IM+ LKP++ +F  +M FSI +NLR  + +S
Sbjct: 290 GTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKS 349

Query: 345 NIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRD---FSDNDPDLTEKILEFQFKRVTSLVK 401
              FGL+Y+D++I+ PLSLIDD A+  SGYRD    +  + +  EK+ E QFK VT+ ++
Sbjct: 350 KT-FGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQ 408

Query: 402 DLIERRISKFSTMGFNDDDIRQMKYGKPAEDTK--IIRLFDTSEVSLGSG-KRDGKYILH 458
           +++  +I  + T    D+DI+ MK       +K  II++ D +E+ +     ++  Y + 
Sbjct: 409 NVMNEKIGYWKT----DNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLSQNDPYCVK 464

Query: 459 NTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           +++   SL K + FSVSYT C+ SGL + +  P    ME+FVE FQ+F++
Sbjct: 465 SSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  277 bits (708), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 166/523 (31%), Positives = 282/523 (53%), Gaps = 38/523 (7%)

Query: 4   RTLSSYERKILDETIRRERNGVIFTASYSAS--SEEWGDDTTLLTLKDSRPTIAILTKAI 61
           R L+  E+ IL ET    +NGV+F+A+Y  +  +++  D+ TL +  + R + +++ KA+
Sbjct: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKAL 68

Query: 62  QRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHIF 121
            ++I  H EL   ++ N EFE +  I  +D++  +EFD Y DE++NC+NG PPYLLRHIF
Sbjct: 69  LKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHIF 128

Query: 122 DNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDSS 181
           D   F  G K+PLW L +ID ++V+FHG D+LFD F+AANFHKL L+  N         S
Sbjct: 129 DKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALN---------S 179

Query: 182 ESDIIFSLENSIKKINNLK-LSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240
            S+   S     K    L  L ++++        ++  D F  Q+Q+  +S+++  +KKP
Sbjct: 180 LSESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKP 239

Query: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300
           + ++ +  R +  T  ++ +         +  +Y   L  T VFG I+  R++ L  ++ 
Sbjct: 240 LRFIESG-RIEHSTEQHSGT--------PEPLNYPNHLCGTVVFGTISTPRFKILKGILN 290

Query: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360
           + +I  K+F++   + CL+P +++ E  + FS+ INLR  +  S+   G+++++VLI+ P
Sbjct: 291 DHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSS-PLGIYHRNVLIECP 349

Query: 361 LSLID-----------DNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409
           L                N  +L G      N  +  +   E  F+R  + V + +++ + 
Sbjct: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409

Query: 410 KFSTMGFNDDDIRQM----KYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKS 465
              T  F D D+ +M    K+   A  +KII + D SE+ L S     +Y++ +   TKS
Sbjct: 410 DLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDL-SNVNPSQYVVEDICATKS 468

Query: 466 LRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
              N F S+SY+     GLNL + + +DC+M  FVE F++F+E
Sbjct: 469 RCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  273 bits (699), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 281/521 (53%), Gaps = 37/521 (7%)

Query: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS---SEEWGDDTTLLTLKDSRPTIAILT 58
           ++R LSS E+    E     RNG++F  +YS++   SE W DD TL  L+DSR     ++
Sbjct: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66

Query: 59  KAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLR 118
            A++ +I  +VEL  TI ++ +F   + I+ DD++  +EF +YKDE I C NG PPY+LR
Sbjct: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126

Query: 119 HIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPL 178
           +I +NN+F  G  +PLW L I+D ++VI H  +++FD+F+AANFH   LK    ++  P 
Sbjct: 127 NILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFH---LKFQKALSQFPK 181

Query: 179 DSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVK 238
           D+   DI+F  E      N L+LSK+ +D     +  +      LQ  S  K  + +TVK
Sbjct: 182 DTHALDILFVYEG-----NELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVK 235

Query: 239 KPIHYLVANVRTKEVTSDNTLSRVTTVQK--YTDIFDYNTTLNNTTVFGKITRQRYEYLN 296
           K +     NV  +   ++N ++   + +   +  +F+ N TL  TTV G +  +R   L 
Sbjct: 236 KSL-----NVIRRNFVANNQITTYESSKSDVFKSMFNPN-TLCGTTVSGSLNAERLASLL 289

Query: 297 SLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVL 356
            L +++ +C  S +  I +L LKP I  F GS+ F + I++R  L+    + G+ Y +++
Sbjct: 290 ELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEI--FDLGVSYTNLM 347

Query: 357 IDVPLSLIDDNAVM-------LSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409
           ++ PLS I+D           +        N PD  E +LE+QFK++TS V + ++ +  
Sbjct: 348 VECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQ 407

Query: 410 KFSTMGFNDDDIRQMKYGKPAEDTKIIR--LFDTSEVSLGSGKRDGKYILHNTNFTKSLR 467
            +    F   D+  +K  K     KIIR    + + V +G  + DG++   N NFT SL 
Sbjct: 408 AWQKRRF---DMSSLKGKKLRRSNKIIRGKFIEINLVDMGEAQ-DGQFHTKNVNFTSSLG 463

Query: 468 KNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
                SVS  +    G+N+ + +P+  DM+AFVECFQ  +E
Sbjct: 464 SKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  248 bits (633), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/530 (30%), Positives = 276/530 (52%), Gaps = 51/530 (9%)

Query: 4   RTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDDT---TLLTLKDSRPTIAILTKA 60
           R L++ E+ I+ ET    +NGV+F+++Y    +   + +   + + +    P  AI+ +A
Sbjct: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLPD-AIMWQA 67

Query: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120
           + ++I  + EL ++IN+  +FE + +I  DD++  +EFD+  DEK++C+NG PPYLLRHI
Sbjct: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127

Query: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180
           FD   F  G +KPLW + +ID+S+V+FHG D+LFD F+AA FHKL L+  N   N  +  
Sbjct: 128 FDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRN--VKG 185

Query: 181 SESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240
            +SD+IF     +     + L +S+     + L ++  D     +Q+  K+++   +KKP
Sbjct: 186 QKSDLIFKTREDL-----IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240

Query: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300
           + ++ +  R +        S +     Y D+  Y   L  T VFG +  +R   L +L+ 
Sbjct: 241 LRFIESG-RLEH-------SGIPASNPY-DLASYAGDLCGTVVFGNVNPERVRGLRALMN 291

Query: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360
             +I F+SF++ + M CL P +E  E  + FS+ INLR  +  ++ + G+F  +VL + P
Sbjct: 292 ESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWAS-DLGVFQNNVLFECP 350

Query: 361 LSLIDDNAVMLSGYRDFS------------------DNDPDLTEKILEFQFKRVTSLVKD 402
           L LI  +    SG   F+                   NDP          F+R+ + V  
Sbjct: 351 LDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTV-------FRRILTHVTT 403

Query: 403 LIERRISKFSTMGFNDDDI----RQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILH 458
            +E    +      + +D+    R+ +Y   +  +KI+ + D  EV L S K   +Y + 
Sbjct: 404 ELELAAMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDL-SSKIHSRYKIG 462

Query: 459 NTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
           +   T S + + F S+SY   + SGLNL + + +  +ME FVE F+ F++
Sbjct: 463 DVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  225 bits (573), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 250/485 (51%), Gaps = 47/485 (9%)

Query: 36  EEWGDDTTLLTLKDSRPTIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNI 95
           E W D +TL++ +        ++ A++ +I  +VE+  T+ +  +F  +  I+ DD++ +
Sbjct: 26  ETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRV 85

Query: 96  LEFDSYKDEKINCHNGCPPYLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFD 155
           +EF +YKDE I CH+G PPY+ RHI + ++F  G  KPLW ++I D S+VIFH  ++LFD
Sbjct: 86  IEFQTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFD 143

Query: 156 IFSAANFH-KLLLKETNIVANEPLDSSESDIIFSLENSIKK--INNLKLSKSIYDNPRIH 212
           +F+A NFH +          NEP     ++ +F  E    +  I+    S    D P   
Sbjct: 144 LFAAGNFHVRFQQALQRCEKNEP----HNETLFVYEGGPLQLPIDPDACSLPGVDVP--- 196

Query: 213 LPATSPDLFNLQTQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIF 272
            PA+SP +      SF K+V    + KP   L +      VT    L+R +  +K   + 
Sbjct: 197 YPASSPFV------SFVKNVCRYAL-KPFGALAS-----AVTPSLRLNRSSLGRKPFLLT 244

Query: 273 DYNTTLNNTTVFGKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFS 332
               +L  TTV G +  ++ + L  LI+ + +C +SF+  I +L LKP I NF+GS+ FS
Sbjct: 245 LDKESLYGTTVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFS 304

Query: 333 IVINLRPFLKESN--IEFGLFYKDVLIDVPLSLIDD-------NAVMLSGYRDFSDNDPD 383
           I ++LR    ES+    FG   K +L+D PL+LIDD       N            N P 
Sbjct: 305 IPLDLR---TESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPK 361

Query: 384 LTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSE 443
            +E +LE+QFKRVT+         + K  T   + D   + KY K     K  ++ + + 
Sbjct: 362 FSEGLLEYQFKRVTT--------HVMKSLTAQTSGDWTGKRKYSKCQLRKK--KIIEINV 411

Query: 444 VSLGSGKRDGKYILHNTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECF 503
           V +G+     ++ + N NFT SL    F S+S  L    G+N+C+ + +   M+ FV+CF
Sbjct: 412 VDMGTSP-SARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCF 470

Query: 504 QSFIE 508
           Q+F++
Sbjct: 471 QTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  134 bits (338), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 138/236 (58%), Gaps = 19/236 (8%)

Query: 280 NTTVFGKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRP 339
           N  +FG I  +R+  L +LI   RIC +S + GI+MLC KP+I+NF+G+++FSI ++++P
Sbjct: 22  NRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKP 81

Query: 340 FLKESNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSL 399
            + +S+ +FG+  K++++D PL LIDD       Y+D +D++      ILE QF++VT  
Sbjct: 82  IVDDSS-QFGILKKNIIVDCPLKLIDDKH-----YKD-TDSESIKNGDILEIQFRKVTDF 134

Query: 400 VKDLIERRIS------KFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRD- 452
           V + +  ++       K +   FN   I          D+K+I++ D +++   + +++ 
Sbjct: 135 VTEELSNKLQSMAKHFKRNNCPFNFSSINSQ-----ISDSKVIQINDLTDIPFTTTEQNP 189

Query: 453 GKYILHNTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508
             Y  H+   T+ L  N+  S+SY    NS +++ + + +   M++FVECF++FIE
Sbjct: 190 NGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 59.3 bits (142), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 1/136 (0%)

Query: 3   LRTLSSYERKILDETIRRERNGVIFTASYSASSEE-WGDDTTLLTLKDSRPTIAILTKAI 61
           LR L+  E+  L +T     NG+IF+   S   E+   DD TL T  +S     +L K++
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLKSL 61

Query: 62  QRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHIF 121
           + LI ++ EL TT++EN  F  L  +K  D++ I+ +   K +     +G    L+  I+
Sbjct: 62  KLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121

Query: 122 DNNRFVPGSKKPLWSL 137
            ++ F PGS KP   L
Sbjct: 122 YHSNFQPGSGKPYGKL 137

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 16/125 (12%)

Query: 49  DSRPTIAILTKAIQRLISRHVELFTTI----NENYEFEILKSIKKDDILNILEFDSYKDE 104
           +S P  +    A++R+++ H +L+       NE     I + IK DD+++ +++D+Y +E
Sbjct: 31  NSLPNRSDFICALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEE 90

Query: 105 KINCHNGCPPYLLRHIFDNNRFVPGSKKPLWSLHIIDES-LVIFHGQDMLFDIFSAANFH 163
           +IN            +F    F  G  KPLW + ++ ++  +IF    + FD  +   F 
Sbjct: 91  EINS-----------VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFW 139

Query: 164 KLLLK 168
             LLK
Sbjct: 140 TELLK 144

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 134/328 (40%), Gaps = 65/328 (19%)

Query: 49  DSRPTIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDIL-NILEFDSYK--DEK 105
           +  P+ + +  AI+  +     L++ +    E   L+ I +  +L  +LE+  Y   DE 
Sbjct: 30  NQSPSRSEICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYTDYGLLDED 89

Query: 106 INCHNGCPPYLLRHIFDNNRFVPGSKKPLWSLHII-DESLVIFHGQDMLFDIFSAANFHK 164
           I C+          IF    F  GS KPLW + ++ D   ++     ++ D  S   F K
Sbjct: 90  I-CNK---------IFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWK 139

Query: 165 LLLKETNIVANEPLDSSESDIIF--SLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFN 222
             L   N  A+  L    S+++F  S+ NS+           +  +P   +P T      
Sbjct: 140 KFLGSLNATASTSL---VSEVVFEPSVHNSV-----------VPQHPYDRIPVT------ 179

Query: 223 LQTQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTT 282
                FF+++  + V+  +   +A ++   +T   TL      ++Y    +Y  T +   
Sbjct: 180 -----FFETMARALVQ--VLVFLAFLKIDLIT---TLFVPPLQKQYLKFKNYQFTRDYLA 229

Query: 283 VFGK-----------ITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKP-SIENFEGS-M 329
             G            I  Q+ + L +L     +   S ++ I+   LK      F+G+  
Sbjct: 230 ADGSVRNDNRLLKIVIPPQKLQNLLALCKGHNVSLSSLILAIMANSLKHVDSSQFDGTRA 289

Query: 330 KFSIVINLRPFLKES------NIEFGLF 351
           K SI +N RPF++++      +IEFG F
Sbjct: 290 KISIPMNTRPFIEKTLLAEPKSIEFGNF 317

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 130/319 (40%), Gaps = 65/319 (20%)

Query: 52  PTIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDD----ILNILEFDSYKDEKIN 107
           PT   L  +++++I+++  L   IN+N +   +  I ++D    + +++E+  +   + +
Sbjct: 35  PTENELCSSLRKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIEYRDWNKFEED 94

Query: 108 CHNGCPPYLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQD-MLFDIFSAANFHKLL 166
             N         +F    F  G  KPLW L I  +   I    D   FD  SA  F K L
Sbjct: 95  EQNS--------VFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSATLFWKAL 146

Query: 167 LKETNIVANEPLDSSESDIIFSL----ENSIKKI----NNL----------KLSKSIYDN 208
           L E + +  + L+  ++D++FS     +N I  +    NNL          K+ + I   
Sbjct: 147 LLELSSIDRDQLE--DTDVVFSKANIDDNYITALDISSNNLLDDCPISFASKIKRFIASK 204

Query: 209 PRIHLP----ATSPDLFNLQTQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTT 264
              + P    A + +L      SF  S+F     KP  Y + N   + + +    ++++ 
Sbjct: 205 IFQYFPYTIIAPNSELLQFDDYSFPSSIFEDGCDKPASYKLKNNSRRAIINIKP-AQISN 263

Query: 265 VQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIEN 324
           V KY      N  L +             YL++LI        S+ V I     K    N
Sbjct: 264 VLKYCR--SKNIALTS-------------YLSALI--------SYYVNI----YKDKSVN 296

Query: 325 FEGSMKFSIVINLRPFLKE 343
              ++K  I INLR  LKE
Sbjct: 297 HGSAIKVEIPINLRGILKE 315

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 17/132 (12%)

Query: 45  LTLKDSRPTIAILTKAIQRLISRHVELFT---TINENYEFEILKS-IKKDDILNILEFDS 100
           +TL  S PT + + +A++ ++  + +L++   T N +   E L+S +   D++   E +S
Sbjct: 27  ITLNKS-PTRSEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMES 85

Query: 101 YKDEKINCHNGCPPYLLRHIFDNNRFVPGSKKPLWSLHII-DESLVIFHGQDMLFDIFSA 159
             +E  N            IF    FV G++KPLW + I+ D+   +     ++ D  SA
Sbjct: 86  LDEEHSN-----------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSA 134

Query: 160 ANFHKLLLKETN 171
             F    ++  N
Sbjct: 135 TVFWGSFMRSLN 146

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 6   LSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIA 55
           L  +E+K+++ET        +  A  S  +  W DDTTL T +D  PT A
Sbjct: 217 LDVWEKKVIEET-------ELMAAKSSNPAGSWKDDTTLDTAQDEEPTTA 259

>KLTH0C09416g Chr3 (782703..785471) [2769 bp, 922 aa] {ON} similar
           to uniprot|P23643 Saccharomyces cerevisiae YDR495C VPS3
           Vacuolar sorting protein
          Length = 922

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 35/71 (49%)

Query: 326 EGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLT 385
           EG     +V+N +  + +  I F  F  D++ID+P  ++D     +  Y+   + +P L 
Sbjct: 258 EGESAMGLVVNTQGDITQGTIVFERFPLDLMIDLPFVIVDYGVTGVYVYQVEVNKEPTLV 317

Query: 386 EKILEFQFKRV 396
           + I   + KR+
Sbjct: 318 QTITSNRQKRI 328

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 17/129 (13%)

Query: 57  LTKAIQRLISRHVELFTTINENYEFEI-----LKSIKKDDILNILEFDSYKDEKINCHNG 111
           +  A++  I+ H +L   +  + E  I     + +IK DD++  + +D + D  I     
Sbjct: 41  IAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTI----- 95

Query: 112 CPPYLLRHIFDNNRFVPGSKKPLWSLHI-IDESLVIFHGQDMLFDIFSAANFHKLLLKET 170
           C      HIF    F    +KPLW + +   E+ ++      LFD  SA  F K  +   
Sbjct: 96  C------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFMSSL 149

Query: 171 NIVANEPLD 179
           +  A +  D
Sbjct: 150 SSDARDDFD 158

>Skud_10.166 Chr10 (308268..310916) [2649 bp, 882 aa] {ON} YJL070C
           (REAL)
          Length = 882

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 63/156 (40%), Gaps = 31/156 (19%)

Query: 259 LSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR----------YEYLNS---LITNQRIC 305
           L+ V T Q++ D F Y   L  +  F +I+R+R          ++YLNS   ++ N+ + 
Sbjct: 264 LTDVPTFQEFRDDFTYTIELIQSHKFNEISRKRLSYLLDKFELFQYLNSKKEILANKNVP 323

Query: 306 FKSFMVGIIM---LCLKPSIENFEGSMKFSIVINLRP-------------FLKESNIEFG 349
           ++ F     +   L L   I   + S      INL P             F  +   +FG
Sbjct: 324 YRDFYNSRKVDRDLSLSGCISQRQLSEYIWGKINLEPDRIVYQDPETSRDFTLKDIFQFG 383

Query: 350 LFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLT 385
               D  I + L LIDD    L  YR+    D  LT
Sbjct: 384 CSSDDQPIAIGLKLIDDE--FLDWYRNIYLTDYHLT 417

>Skud_4.254 Chr4 complement(441927..444182) [2256 bp, 751 aa] {ON}
           YDR001C (REAL)
          Length = 751

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 14/105 (13%)

Query: 163 HKLLLKETNIVANEPLDSSESDIIFSLENSIKK---INNL-------KLSKSIYDNPRIH 212
           H++ L E  I  N P++     I     NS+ +   +NN+       K+      NPRI+
Sbjct: 168 HQIFLDEARINEN-PVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAKNPRIY 226

Query: 213 LPATSPDLFNLQTQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDN 257
           +P   PD +    Q+   S  H ++K  + YL   +    V S N
Sbjct: 227 VPYDCPDQYEFYVQA---SQMHPSLKLEVEYLPKEITASYVKSVN 268

>KAFR0A01010 Chr1 (191495..192892) [1398 bp, 465 aa] {ON} Anc_3.266
           YBR056W
          Length = 465

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%)

Query: 50  SRPTIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKIN 107
           S+ T+ I + A+  LI +H + +  I  +YEF          + +I +F SY + +I 
Sbjct: 368 SKTTVNIDSNAVNNLIKQHQDYWNKIGGSYEFWRYSDALNGVVDDIKKFSSYNNSRIG 425

>NDAI0I01640 Chr9 (387547..388323) [777 bp, 258 aa] {ON}
          Length = 258

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 28/41 (68%), Gaps = 2/41 (4%)

Query: 388 ILEFQFKRVTSLVKDLIERRISKFSTMGFNDDDI--RQMKY 426
           +LE +F+ ++ + KD+IE  ISK +T+G+N   I  +Q+ Y
Sbjct: 122 LLESKFENISQIDKDVIELAISKEATIGWNQWPIYLKQLDY 162

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 58/132 (43%), Gaps = 35/132 (26%)

Query: 134 LWSLHIID----ESLVIFHGQDMLF-DIFSAANFHKLLLKETNIVANEPLD--------- 179
           L  LH ID     S++ FHG  +L  D+   ++F K  +K  NI+  EP+          
Sbjct: 141 LLHLHTIDAGKLSSMLHFHGDTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQ 200

Query: 180 --------SSESDI-IFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFK 230
                   SS+SDI +FS  N  K I        +Y + ++H      D +  QT++  K
Sbjct: 201 LENVSLITSSQSDIDLFSNRNMFKYI-------VLYTDAQLH-----GDFWQRQTRTLAK 248

Query: 231 SVFHSTVKKPIH 242
            +   ++  P++
Sbjct: 249 ILSQQSILNPLN 260

>KLTH0G16588g Chr7 complement(1437552..1445048) [7497 bp, 2498 aa]
            {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
            YBL004W UTP20 Possible snoRNA-binding protein based on
            computational analysis of large-scale protein- protein
            interaction data
          Length = 2498

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 10/78 (12%)

Query: 190  ENSIKKINNLKLSKSI----YDNPRIHLPATSPDLFNLQTQ--SFFKSVFH--STVKKPI 241
            ++S++KI+ L L   I    YDN  +  P++   LF L      F+K ++H   +V K +
Sbjct: 1085 DSSVQKIHKLVLQPRISNFEYDN--LQHPSSLMSLFCLWATDTCFYKFLYHDECSVAKAL 1142

Query: 242  HYLVANVRTKEVTSDNTL 259
              L+ N   KE+  +NTL
Sbjct: 1143 MKLLGNSNAKEIVIENTL 1160

>TPHA0F00660 Chr6 complement(152952..153452) [501 bp, 166 aa] {ON}
           Anc_4.109 YGL010W
          Length = 166

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 219 DLFNLQTQ-SFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYT 269
           DLFNL+TQ  F+K+  H+TV   IH +   V T  VTS   L R+     ++
Sbjct: 4   DLFNLRTQLGFYKAYHHNTVNVMIHSVF--VPTIFVTSCMILDRIPVFNNWS 53

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 9/82 (10%)

Query: 117 LRHIFDNNRFVPGSKKPLWSLHII-DESLVIFHGQDMLFDIFSAAN----FHKLLLKETN 171
           + HIF  + F     KPLW + II  ++ ++     +L D  SA +    F + L K+  
Sbjct: 103 INHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDHVLMDGMSAVHVWETFMEGLQKQGP 162

Query: 172 IVANE----PLDSSESDIIFSL 189
           +  +E    PL  S +D I S+
Sbjct: 163 VGVDETIYSPLSGSSADQIISI 184

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 96/470 (20%), Positives = 180/470 (38%), Gaps = 70/470 (14%)

Query: 57  LTKAIQRLISRHVELFTTINENYEFEIL--KSIKK-----DDILNILEFDSYKDEKINCH 109
           L KA+Q  I+ + +L   I +N E E L  + IKK     +D++  + ++ +++++IN  
Sbjct: 41  LYKALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS- 99

Query: 110 NGCPPYLLRHIFDNNRFVPGSKKPLWSLHIIDE-SLVIFHGQDMLFDIFSAANFHKLLLK 168
                     IF    F   + +PLW + ++   +  I      LFD  SA    +  ++
Sbjct: 100 ----------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDHALFDGISAVKIWETFME 149

Query: 169 ETNIVANEPLDSSE-SDIIFSLENSIKKINN---LKLSKSIYDNPRIHLPATSPDLFNLQ 224
           + N        SSE  +I  ++   I + N+   L  S+  YD          P     +
Sbjct: 150 KLN-------KSSEIENIDVTVPLYIPEENHEGTLVASQHPYD--------IWPVPIAWK 194

Query: 225 TQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVF 284
            +SF  +   +   + I  +  N    E           +      +  +    +NT   
Sbjct: 195 VKSFIATKLFNWYPQAI--ISPNSNLFEFKGYKFPEGFLSQYPKDGVTSFKVRNDNTQKL 252

Query: 285 GKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLK-PSIENFEGSM-KFSIVINLRPFLK 342
            K+   + E +        +   S++V II++ L+  + E++ G++ K SI IN R    
Sbjct: 253 IKMAPGKLETILKNCKTNAVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPINTRNICA 312

Query: 343 ------ESNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRV 396
                 E  ++ G F   +  + P++   D+ +             D+   + +F  K  
Sbjct: 313 NQVNTPEEMLQLGNFVGSMDFEHPIN--SDSGIW------------DIARDVQQFITKNT 358

Query: 397 TSLVKDLIE--RRISKFSTMGFNDDDIRQMKYGKPAEDTKIIRL-FDTSEVSLGSGKRDG 453
           T  + D+I   + +   +   F    I     G PA   ++  L F + +   GS     
Sbjct: 359 TVGISDIINNIKLLDGINCEEFVKKKIEFSSNG-PASTFEVTNLGFQSFK---GSCMESS 414

Query: 454 KYILHNTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECF 503
            Y + +  F +    +D F+ S       GL   L +P D   E F  C+
Sbjct: 415 SYFIKDAVFNEPQGMSDIFTCSVISTPIGGLRCSLSYPKDIAQE-FEPCW 463

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,156,253
Number of extensions: 2812466
Number of successful extensions: 9561
Number of sequences better than 10.0: 100
Number of HSP's gapped: 9829
Number of HSP's successfully gapped: 100
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)