Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B065006.10ON63659924570.0
NCAS0D021906.10ON64559618100.0
TPHA0M002006.10ON63458917290.0
NDAI0I027506.10ON66361417200.0
Kpol_1045.776.10ON65060316850.0
TBLA0G011106.10ON63860516820.0
TDEL0G046106.10ON63360216650.0
SAKL0E00880g6.10ON63659116480.0
ZYRO0F00484g6.10ON64359416400.0
Kwal_56.223506.10ON65858916180.0
ACR016W6.10ON64059816040.0
KLLA0D00836g6.10ON64059415770.0
KNAG0E027806.10ON65059815510.0
KLTH0C11528g6.10ON64259515120.0
CAGL0A01067g6.10ON64145213920.0
YPL263C (KEL3)6.10ON65161612761e-168
Skud_16.146.10ON65262012701e-167
Suva_16.426.10ON65460812571e-165
Smik_6.4716.10ON65160412301e-161
Suva_15.3575.88ON11722101333e-07
Skud_8.2225.88ON11692081315e-07
Smik_16.685.88ON8941841306e-07
Kpol_1050.695.88ON10842011306e-07
Smik_8.2425.88ON11682081281e-06
YHR158C (KEL1)5.88ON11642081262e-06
SAKL0H02618g5.88ON10852081243e-06
NDAI0D026005.88ON11672101226e-06
Skud_7.5725.88ON8831871216e-06
Suva_7.5305.88ON8941001191e-05
Kpol_1010.625.88ON9731071191e-05
TDEL0G011205.88ON10092081191e-05
TPHA0H010805.88ON8281021172e-05
KLLA0E15511g5.88ON9052101136e-05
ZYRO0B08228g5.88ON12932081128e-05
YGR238C (KEL2)5.88ON8821841111e-04
TPHA0A051705.88ON10161081092e-04
KAFR0B043205.88ON9862101082e-04
KNAG0K005605.88ON11041801083e-04
KLTH0C01474g5.88ON10562091083e-04
CAGL0I02090g5.88ON11362111074e-04
TBLA0C065305.88ON11721851074e-04
NCAS0F005205.88ON10862151065e-04
Kwal_14.10195.88ON9782081020.001
Ecym_20615.88ON13622121010.002
CAGL0F07997g5.88ON936202980.004
ADL149W5.88ON1211207970.005
Kpol_495.28.157ON1511108870.072
KNAG0A011803.15ON676100860.086
NCAS0H03640na 1ON21559810.21
TDEL0A003403.15ON67795800.51
KAFR0I029103.15ON691198790.65
KAFR0C028908.157ON145195780.90
CAGL0K02101g8.157ON163380781.1
ZYRO0C03344g3.15ON658116771.2
Smik_19.4singletonON22175751.2
TBLA0A043207.9ON838179761.7
TBLA0D021208.157ON1479108751.9
YOL141W (PPM2)3.15ON69580752.0
Kwal_55.207568.157ON157551752.4
ADR414C7.9ON78454742.5
TDEL0A012908.235ON122589742.8
NCAS0C043703.15ON688148724.0
NCAS0B054408.157ON1550112734.2
ZYRO0G19426g8.157ON159483724.7
Ecym_61464.183ON29664705.2
KAFR0B021808.157ON1543107717.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06500
         (636 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   951   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   701   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   670   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   667   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   653   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   652   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   645   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   639   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   636   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   627   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   622   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   612   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   602   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   587   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   540   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   496   e-168
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   493   e-167
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   488   e-165
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   478   e-161
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    56   3e-07
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    55   5e-07
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    55   6e-07
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    55   6e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    54   1e-06
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    53   2e-06
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    52   3e-06
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    52   6e-06
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    51   6e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    50   1e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    50   1e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    50   1e-05
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    50   2e-05
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    48   6e-05
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    48   8e-05
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    47   1e-04
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    47   2e-04
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    46   2e-04
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    46   3e-04
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    46   3e-04
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    46   4e-04
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    46   4e-04
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    45   5e-04
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    44   0.001
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    44   0.002
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    42   0.004
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    42   0.005
Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 151...    38   0.072
KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15 Y...    38   0.086
NCAS0H03640 Chr8 (691957..692604) [648 bp, 215 aa] {ON}                36   0.21 
TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15 ...    35   0.51 
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    35   0.65 
KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8....    35   0.90 
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    35   1.1  
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    34   1.2  
Smik_19.4 Chr19 complement(4397..5062) [666 bp, 221 aa] {ON} YNL...    33   1.2  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    34   1.7  
TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8....    33   1.9  
YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}  PPM2AdoMet-...    33   2.0  
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    33   2.4  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    33   2.5  
TDEL0A01290 Chr1 (222024..225701) [3678 bp, 1225 aa] {ON} Anc_8....    33   2.8  
NCAS0C04370 Chr3 (896632..898698) [2067 bp, 688 aa] {ON} Anc_3.1...    32   4.0  
NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON}            33   4.2  
ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa...    32   4.7  
Ecym_6146 Chr6 (269126..270016) [891 bp, 296 aa] {ON} similar to...    32   5.2  
KAFR0B02180 Chr2 complement(425578..430209) [4632 bp, 1543 aa] {...    32   7.1  

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/599 (79%), Positives = 478/599 (79%)

Query: 38  LDSDDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEH 97
           LDSDDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEH
Sbjct: 38  LDSDDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEH 97

Query: 98  TSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPK 157
           TSKELQTTKFYNDLYTFSPDNNQWKRITSQN               GIALLNGGEFSSPK
Sbjct: 98  TSKELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPK 157

Query: 158 QSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY 217
           QSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY
Sbjct: 158 QSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY 217

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXX 277
           NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYC             
Sbjct: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKL 277

Query: 278 XXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 337
              CWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE
Sbjct: 278 LSGCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 337

Query: 338 SIFYNDLFTYNIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNL 397
           SIFYNDLFTYNIESNRWFNVTLKKR                   RELQDLLNQILEKNNL
Sbjct: 338 SIFYNDLFTYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNL 397

Query: 398 KPXXXXXXXXXXXXXXXXXXXXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWE 457
           KP                     QKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWE
Sbjct: 398 KPDDEEEEESSDIFGSDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWE 457

Query: 458 FGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXX 517
           FGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAK                        
Sbjct: 458 FGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEE 517

Query: 518 XXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAI 577
               TKLIA                      RPWLPHPKAFESLRAFYLREGPAFLEWAI
Sbjct: 518 EVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAI 577

Query: 578 SNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636
           SNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR
Sbjct: 578 SNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/596 (57%), Positives = 402/596 (67%), Gaps = 10/596 (1%)

Query: 50  EILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKF 107
           ++L NFK +QE +E +N+ES+ KP+ R N  +I++   +KKELL+FGGE T+ E   T F
Sbjct: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110

Query: 108 YNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDT 167
           YN+L T+SPDN QW++ITSQN               GIALL+GGEFSSPKQ+TFYHYSDT
Sbjct: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170

Query: 168 WILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITT 227
           W+LD  TKEWTK++    P GRSGHRIT WKNYFIL GGFKDLGHST+Y+ND W FDITT
Sbjct: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230

Query: 228 YKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMK 287
           YKWKQ+EFP NH +PDARSGHS IPT EGCI++GGYC                CW LKMK
Sbjct: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290

Query: 288 ADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTY 347
           +D+  +RWERR+KQGFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLESIFYNDLF+Y
Sbjct: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350

Query: 348 NIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXXXX 407
           N+ESNRWF+++L+K                    +ELQDLLNQILEKNNLK         
Sbjct: 351 NVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIS 410

Query: 408 XXXXXXXXXXXXX-------QKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGE 460
                                     +  ++QLPHPRFNA TTV+DD L+IYGG WE GE
Sbjct: 411 TGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470

Query: 461 IDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXX 520
            DY+IDS YSIDLNKLDGV+ YWEDL EIE AK                           
Sbjct: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIED 530

Query: 521 XTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNN 580
             KL+A                      RPWLPHPK FESLRAFY+REG AFLEWAISNN
Sbjct: 531 K-KLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNN 589

Query: 581 RHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636
           +H RGK LK+KSF+LC+DRWWERRDQ+ IEEDKLEE+GVVG+V+E+DTS   SKRR
Sbjct: 590 KHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/589 (57%), Positives = 400/589 (67%), Gaps = 10/589 (1%)

Query: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFY 108
           +L NFKKEQE +E+IN+ESV+KP+ R N  +I++    KKELLLFGGE+TS+E   T FY
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 109 NDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTW 168
           NDLYTF+PDN+ WK+ITSQN               GIALL+GGEFSSPKQ+TFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 169 ILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTY 228
           +LD TT+EWTK+E K  P  RSGHRIT WKNYFIL GGF+DLG +T+Y ND WLFDIT+Y
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKA 288
           KW+Q+EFP NH +PDARSGHSLIPT EG +++GGYC                CW LKMKA
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 289 DVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYN 348
           D  A+RWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+SIFYNDLF+Y 
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 349 IESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXXXXX 408
           IESNRW+ + L+ +                    ELQ++LN+ILEK NLK          
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKSSKEKEL---ELQNILNEILEKANLKDDDEDANELS 408

Query: 409 X--XXXXXXXXXXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSID 466
                         + +K +     QLPH RFNA+TTV+DD L+IYGG WE GE DYSID
Sbjct: 409 NGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSID 468

Query: 467 SFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKLIA 526
           S YSIDLNKLDGV VYWE+L++IE AK                             KL+A
Sbjct: 469 SMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETVDQ-KLVA 527

Query: 527 XXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNNRHTRGK 586
                                 RPWLPHPKAFESLR FY+R G +FLEWAISNN+HTRGK
Sbjct: 528 --EEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGK 585

Query: 587 LLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
            LK KSFELCQDRWWERRDQ+ IEEDKLEE+G VG+V+E+DT+K+  +R
Sbjct: 586 HLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/614 (54%), Positives = 395/614 (64%), Gaps = 25/614 (4%)

Query: 48  IEEILENFKKEQENYEKINIESVEKP-----SIRNNGSIISSTTK-----KELLLFGGEH 97
           IE +L NFK EQE +EKIN+E + +      S R+N S+I++ +      KELL+FGGE+
Sbjct: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109

Query: 98  TSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPK 157
           TS E   T FYNDL +++PD  QW++ITSQN               GIA+L+GGEFSSPK
Sbjct: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169

Query: 158 QSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHS-TTY 216
           Q+TFYHYSDTWILD +TKEWTK++ K  PV RSGHRI  WKNYF+LFGGFKD+G++ T Y
Sbjct: 170 QNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229

Query: 217 YNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXX 276
           +NDVW FDI  YKW QVEFPKNH LPD RSGHS IP  EGCI++GGY             
Sbjct: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQK 289

Query: 277 XX--XXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 334
                 CW LKMK+D+ +IRWERR+K GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE
Sbjct: 290 GKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 349

Query: 335 SLESIFYNDLFTYNIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEK 394
           SLES+FYNDLF+YN+E+NRWF + L+K                    +ELQDLLNQILEK
Sbjct: 350 SLESLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEK 409

Query: 395 NNLKPXXXXXXXXXXXXXXXXXXXXXQKNKID------------IKTVTQLPHPRFNATT 442
           NNLK                           D            +  + QLPHPR+N   
Sbjct: 410 NNLKDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAM 469

Query: 443 TVIDDMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXX 502
           TV+DD+L+IYGG+WE GE DY I+SFYSIDLN++DGV  YWEDL EIE AK         
Sbjct: 470 TVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDE 529

Query: 503 XXXXXXXXXXXXXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLR 562
                                                         RPWLPHPK FESLR
Sbjct: 530 EDDEDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLR 589

Query: 563 AFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGD 622
           AFY+REGPAFLEWAISNN+H RGK LK+KSFELC+DRWWERRDQI IEEDKLEE+GVVGD
Sbjct: 590 AFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGD 649

Query: 623 VVERDTSKAVSKRR 636
           V+E+DTSK  SKRR
Sbjct: 650 VIEKDTSKGASKRR 663

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/603 (54%), Positives = 393/603 (65%), Gaps = 21/603 (3%)

Query: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFY 108
           +L NFKKEQE +E+INIESVE+PS R N  +I +    K EL+LFGGE T+K+  TT+F+
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 109 NDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTW 168
           NDLY+++P+N+QW+R TS+N               G+AL++GGEFSSPKQ+TFYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 169 ILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTY 228
           +LD +TKEWTK+E K  P  RSGHRI+ WKNYF+L GGF+DLG STTY ND WLFDIT Y
Sbjct: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230

Query: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKA 288
           KWKQ+EFP NH +PDARSGHS IPT EG +++GGYC                CW LKMKA
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290

Query: 289 DVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYN 348
           D  AIRWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+S+FYNDLF+Y 
Sbjct: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 349 IESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXXXXX 408
           IE NRWF + L+ +                   +ELQDLLNQILEK NL           
Sbjct: 351 IEINRWFALQLRPQ---RKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDE 407

Query: 409 XXXXXXXXXXXX--------------QKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGG 454
                                      K K + K +TQLPHPRFNAT TV++D L+IYGG
Sbjct: 408 DAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGG 467

Query: 455 AWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXX-XXXXXXXXXXXXXXXXXX 513
            WE GE DY+IDSFYSIDLN+ DGV V WEDL+EIE AK                     
Sbjct: 468 VWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDED 527

Query: 514 XXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXR-PWLPHPKAFESLRAFYLREGPAF 572
                    KL+A                        PWLPHPK FESLR FY+R G  F
Sbjct: 528 DGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATF 587

Query: 573 LEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAV 632
           LEWAISNNR  RGK LK+KSF+LCQDRWW+RRDQ+ IEEDK+EE+G +G+V+E+DTSK+ 
Sbjct: 588 LEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKST 647

Query: 633 SKR 635
            +R
Sbjct: 648 KRR 650

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/605 (54%), Positives = 403/605 (66%), Gaps = 17/605 (2%)

Query: 41  DDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHT 98
           +++DD  IE+ILENFKK+QE +EKINIE+V KP+ R N  +IS+    K EL+LFGGE+T
Sbjct: 42  EEDDDMAIEDILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT 101

Query: 99  SKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQ 158
           S    TT FYNDL+T++P+N+QWK+ TSQN               GIALL+GGEFSSPKQ
Sbjct: 102 S---TTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQ 158

Query: 159 STFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYN 218
           +TFYHYSDTW+LD  TKEW+K+E K  P  RSGHR+T WKN+ IL GGF+DLG STTY  
Sbjct: 159 NTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLK 218

Query: 219 DVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXX 278
           D+WLFD+T YKW QVEFP NH +PDARSGHSLIPT +G +++GGYC              
Sbjct: 219 DLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKIL 278

Query: 279 XXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 338
             CW LKMK+DV  IRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESL+S
Sbjct: 279 SDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDS 338

Query: 339 IFYNDLFTYNIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLK 398
           +FYNDLFTY IE NRWF+++++ +                   +ELQD+LN IL+KNNL 
Sbjct: 339 LFYNDLFTYQIEINRWFSLSMRSQ---RKKTIKIGPKTTKDKEKELQDILNSILKKNNLT 395

Query: 399 PXXXXXXXXXXXXXXXXXXXXXQKNKIDIKTVT-------QLPHPRFNATTTVIDDMLYI 451
                                  +++     VT       QLPH RFNATT V++D LYI
Sbjct: 396 DDDSEDPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYI 455

Query: 452 YGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXX 511
           +GG+WE GE DYSIDSFYSIDLNKLDGV VYWED+ EIE AK                  
Sbjct: 456 FGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEED 515

Query: 512 XXXXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPA 571
                      KL+A                      RPWLPHPK FE+LRAFY+R G  
Sbjct: 516 EDDGEEEIVDQKLVA-EEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGAT 574

Query: 572 FLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKA 631
           FLEWAISNNR ++GK LK+KSFEL +DRWWERRDQ+ IEEDK+EE+G + ++VERDT++ 
Sbjct: 575 FLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQ- 633

Query: 632 VSKRR 636
           V+KRR
Sbjct: 634 VNKRR 638

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/602 (53%), Positives = 392/602 (65%), Gaps = 11/602 (1%)

Query: 38  LDSDDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGG 95
           L ++++DD +IE++L NFKKEQE +EK+ +E++E+PS R N S+I++    K EL++FGG
Sbjct: 39  LGAEEDDDLDIEQVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGG 98

Query: 96  EHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSS 155
           EHT +   TT F+NDL  FSPDN QWKRI+SQN               G+ALL+GGEFSS
Sbjct: 99  EHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSS 158

Query: 156 PKQSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTT 215
           PKQ+TFYHYSDTW+LD  TKEWTKIE K  P  RSGHR+  WKN+ IL GGF+DLG STT
Sbjct: 159 PKQNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTT 218

Query: 216 YYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXX 275
           Y ND WLFDITTYKWKQVEFP+NH +PDARSGHSLI   EG I++GGYC           
Sbjct: 219 YLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKG 278

Query: 276 XXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEES 335
                CW LKM ++  AIRW+R+++QGFQPSPRVGCSM  HKGRG+LFGGVYDF+ETEES
Sbjct: 279 KILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEES 338

Query: 336 LESIFYNDLFTYNIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKN 395
           LES FYND+FTY I  NRW++++L+ +                   +EL+DLLN+IL   
Sbjct: 339 LESNFYNDVFTYQINMNRWYSLSLRPQ---RKKQVKLNNRSTKDQEKELEDLLNKILRNA 395

Query: 396 NLKPXXXXXXXXXXXXXXXXXXXXXQKNKIDIKTV--TQLPHPRFNATTTVIDDMLYIYG 453
            L                       +   +D + V   +LPHPRFNA T V+DD L+I+G
Sbjct: 396 QLDDQGEEEEIDAAEESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFG 455

Query: 454 GAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXX 513
           G WEFGE DYSIDSFY IDLNK DGV VYWEDL  +E AK                    
Sbjct: 456 GVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEEDS 515

Query: 514 XXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFL 573
                    KL+A                      RPWLPHPKAFESLR+FY+R G  FL
Sbjct: 516 EEEQVDQ--KLVA--EDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFL 571

Query: 574 EWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVS 633
           EWAISNNRH +GK LK KSFE+C+ RWWERRDQ+ +EEDKLEE+G VG+++ERDT+K   
Sbjct: 572 EWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKK 631

Query: 634 KR 635
           +R
Sbjct: 632 RR 633

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/591 (52%), Positives = 391/591 (66%), Gaps = 13/591 (2%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFYN 109
           L NFK+EQE +E++ + +V++P+ R N S++++    K+ELLLFGGE+T+    TT FYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 110 DLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWI 169
           DL+T+S D +QW++I+SQN               G+ L++GGEFSSPKQ+TFYHYSDTW+
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 170 LDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYK 229
           LD  TKEWTKIE K  P  RSGHR+T WKNYFIL GGF+DLG  TTY +D WLFDITTYK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 230 WKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKAD 289
           WKQV+FP NH +PDARSGHSL+PT +G +++GGYC                CW LKMK+D
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 290 VEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNI 349
           + AIRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESLES+FYNDLFT+ I
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 350 ESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNL-----KPXXXXX 404
           E+NRW++ +L+ +                   +EL+D+LNQILEK NL     +      
Sbjct: 352 ETNRWYSASLRPQRKAAKATSKNNRNKD----KELEDILNQILEKANLNDDENEKETIGD 407

Query: 405 XXXXXXXXXXXXXXXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYS 464
                              K +     QLPHPRFNA+T V+DD L+I+GG WE GE DYS
Sbjct: 408 VLKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYS 467

Query: 465 IDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKL 524
           IDSFY+IDLN+LDG+ +YWEDL +IE AK                             KL
Sbjct: 468 IDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKL 527

Query: 525 IAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNNRHTR 584
           +A                      RPWLPHPK FE+LR FY+R G  FLEWAIS+NR  R
Sbjct: 528 VA--EDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDAR 585

Query: 585 GKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
           GK LK+KSF+LCQDRWWERRDQ+ IEEDKLEE+G +G+VVE+DTSK+  +R
Sbjct: 586 GKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/594 (52%), Positives = 389/594 (65%), Gaps = 12/594 (2%)

Query: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFY 108
           +L +FKKEQE +EK+ +ESV+KPS R N  ++S+    KKEL+LFGGE+T++   TT FY
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 109 NDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTW 168
           N+L+TF+PDN+QW++I+SQN               GIALL+GGEFSSPKQ+TFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 169 ILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTY 228
           +LD TTKEWTK++ K  P  RSGHR+T WKN+FI++GGF+DLG STTY ND WLFDITT+
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKA 288
           KW QVEFP+NH +PDARSGHS IP  EG I++GGYC                CW LKM +
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 289 DVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYN 348
              AIRWERR+KQGFQPSPRVGCSM  HKGRG+LFGGVYDF+ETEESL+S FYNDLFT+ 
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 349 IESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNL------KPXXX 402
           I++NRW++++L+ +                   +ELQD LN+IL++  L      K    
Sbjct: 353 IKTNRWYSLSLRPQ---RKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDK 409

Query: 403 XXXXXXXXXXXXXXXXXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEID 462
                             +  K      TQLPHPRFN +  V++D L+IYGG WE G+ D
Sbjct: 410 AIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKD 469

Query: 463 YSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXX-XXXXXXXXXXXXXXXXXXXXXXX 521
           Y+IDSFY IDLNK+DGV VYWE+L EIE AK                             
Sbjct: 470 YNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVR 529

Query: 522 TKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNNR 581
            +++                       RPWLPHPKAFESLRAFY+R GP FLEWAISNNR
Sbjct: 530 DQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNR 589

Query: 582 HTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
             RGK LKQKSF+LCQDRWWERRDQ+ IEEDK+EE+G VGD+VER+ ++   +R
Sbjct: 590 DARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/589 (52%), Positives = 393/589 (66%), Gaps = 9/589 (1%)

Query: 50  EILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKF 107
           E+L NFKKEQE ++++ +  VE+PS R N  ++++    K+ELL+FGGEHT+     T F
Sbjct: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135

Query: 108 YNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDT 167
           YN+L+T+S D++QW++ITS+N               G+AL++GGEFSSPKQ+TFYHYSDT
Sbjct: 136 YNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDT 195

Query: 168 WILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITT 227
           W+LD TTKEWTK+E K  P  RSGHR+T WKN+FIL GGF+DLG STTY ND+W+FDITT
Sbjct: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255

Query: 228 YKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMK 287
           YKWKQVEFP NH +PDARSGHS+IPT +G +++GGYC                CW LKMK
Sbjct: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315

Query: 288 ADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTY 347
           +DV AIRWERR+KQGFQPSPRVGCSM +HKGRG+LFGGVYDF+ETEE L S F+NDLF+Y
Sbjct: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375

Query: 348 NIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXXXX 407
            +E+NRW++V ++ +                    EL+++LN IL++ NL          
Sbjct: 376 QVEANRWYSVKMRPQ----KKKTVAISRNNRNKDEELENILNDILQQANLADDTDDDDNE 431

Query: 408 XXXXXXXXXXXXXQKN-KIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSID 466
                         +N +   + V QLPHPRFNATT V+DD L+I+GG WEFGE D+SID
Sbjct: 432 IKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSID 491

Query: 467 SFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKLIA 526
           SFYSIDLNKLDGV VYWE+L+E+E AK                             KL+A
Sbjct: 492 SFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEETADQ-KLVA 550

Query: 527 XXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNNRHTRGK 586
                                 RPWLPHPK FE+LRAFY+R G  FL+WAISNNR  +GK
Sbjct: 551 -EDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGK 609

Query: 587 LLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
            LK++SF+LCQDRWWERR+QI IEEDKLEE+G V +VVERD ++ + +R
Sbjct: 610 HLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/598 (51%), Positives = 388/598 (64%), Gaps = 15/598 (2%)

Query: 48  IEEILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTT 105
           IEE+L NFK++Q  +E +N+E+VE+P  R++ S++++    K+EL+LFGGE+T++    T
Sbjct: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107

Query: 106 KFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYS 165
            FYNDL+ +S D +QWK+ TSQN               G+ L++GGEFSSPKQ+TFYHYS
Sbjct: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167

Query: 166 DTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDI 225
           DTW+ D  T EWTKIE K  P  RSGHR+T WKNY IL GGF+DLG STTY ND WLFDI
Sbjct: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227

Query: 226 TTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLK 285
           TTYKW+Q++FP NH +PDARSGHSL+PT EG I++GGYC                CW LK
Sbjct: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287

Query: 286 MKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLF 345
           MK+DV AIRWERR+KQGFQPS R GCSM +HKGRGILFGGVYD++ETEE L+S+FYNDLF
Sbjct: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 346 TYNIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXX 405
           TY+IE+NRW++V+L+ +                   +EL+D+LN IL+K NL        
Sbjct: 348 TYHIETNRWYSVSLRAQ---RHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDED 404

Query: 406 XXXXXXXXXXXX----XXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEI 461
                              ++ K     V +LPHPRFNA+T ++DD L+I+GG WE GE 
Sbjct: 405 GKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEK 464

Query: 462 DYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX 521
           DY IDSFYSID+NK+DGV VYWED+  +E AK                            
Sbjct: 465 DYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSD 524

Query: 522 TKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNNR 581
            KL+A                      RPWLPHPKAFESLRAFY+R G +FLEWAI+N  
Sbjct: 525 RKLVA--EEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKH 582

Query: 582 HTR----GKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
           +TR    GK LK+ SF+LCQ+RWWERR+Q+ IEEDKLEE+G VG+V+E+D +K   +R
Sbjct: 583 NTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/594 (51%), Positives = 381/594 (64%), Gaps = 14/594 (2%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFYN 109
           L NFK+EQEN+EKIN+E+V++P  R N  +  +    K+EL++FGGE T++E  TT FYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 110 DLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWI 169
           DL+ +S D + WKR TSQN               G+AL++GGEFSSPKQ+TFYHYSD+W+
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 170 LDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYK 229
            D ++KEWTK+E K  P  RSGHR+  WKN+ IL GGF+DLG STTY ND+W+FDIT YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 230 WKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKAD 289
           WKQVE P NH +PDARSGHSLI T+EG ++YGGY                 CW LKMK+D
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 290 VEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNI 349
           + +IRWERR+KQG QPSPRVGCSM +HKGRG+LFGGVYDF+ETEESL SIFYN+L+TY I
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 350 ESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXXXXXX 409
           E+NRW+ ++L+ +                   +EL+D+LNQIL+K NL+           
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKD---KELEDILNQILDKANLRDAEDDDESKVI 407

Query: 410 XXXXXXXXXXXQKNKI--------DIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEI 461
                        +            +T++ LPH RFNA T V+DD L+I+GG  E GE 
Sbjct: 408 EEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEK 467

Query: 462 DYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX 521
           DY IDSFYSID+NKLDGV VYWE+L E+E A+                            
Sbjct: 468 DYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVD 527

Query: 522 TKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAISNNR 581
           +KL                        RPWLPHPKAFE+LRAFY+R GP FLE AIS+NR
Sbjct: 528 SKL-EAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNR 586

Query: 582 HTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
            ++GK LK KSFELCQDRWWERR+Q+ IEEDKLEE+G V DV+E+DTSK   +R
Sbjct: 587 DSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/598 (51%), Positives = 375/598 (62%), Gaps = 13/598 (2%)

Query: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYND 110
           IL+NFK EQE +EK+ +E V  P+ RNN  ++++ +K ELLLFGGE T+ E   TKFYND
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYND 112

Query: 111 LYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWIL 170
           L+ ++P NNQWK+ TSQN               G+ +L GGEFSSPKQ+TFYHY+DTW+L
Sbjct: 113 LHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL 172

Query: 171 DLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKW 230
           D TT+EW+K++ K  P  RSGHRITTWKNYFILFGGFKDL   T+Y+NDVWLF++  +KW
Sbjct: 173 DNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKW 232

Query: 231 KQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXX--XXXXXXXCWNLKMKA 288
            + E   N   PD RSGHS I ++EG IVYGGYC                  CW LKM  
Sbjct: 233 TKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQ 291

Query: 289 DVEAIRWERRRKQGFQPSPRVGCSMAYHK-GRGILFGGVYDFDETEESLESIFYNDLFTY 347
           +V  I+WERR K+G QPSPRVGCSMA H+  RGILFGGVYD +ETEE L SI+YNDL++Y
Sbjct: 292 NVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSY 351

Query: 348 NIESNRWFNVTLKK--RXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXX 405
           NIESNRW+ + L+K  +                   +ELQDLLN+ILE+N+LK       
Sbjct: 352 NIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNSY 411

Query: 406 XXXXXXXXXXXXXXXQ-------KNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEF 458
                          Q       K + ++  + QLPH RFNA TTV++D  YIYGG WEF
Sbjct: 412 SGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEF 471

Query: 459 GEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXX 518
            + DY+IDSFYSIDLNKLDG+  Y+E+L EIE  K                         
Sbjct: 472 KDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGEAE 531

Query: 519 XXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAFLEWAIS 578
               +L A                      RPWLPHPKAFESLR FY+REGP FLEWAIS
Sbjct: 532 PTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAIS 591

Query: 579 NNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636
           NN+H +GK LKQKSFELCQDRWWERRDQI IEEDKL+E+GV GD++ERD     + RR
Sbjct: 592 NNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/595 (48%), Positives = 377/595 (63%), Gaps = 19/595 (3%)

Query: 54  NFKKEQENYEKINIESVEKPSIRNNGSIIS--STTKKELLLFGGEHTSKELQTTKFYNDL 111
           NF+KEQE ++++ +  V++PS R+N  ++   S  K+ELL+FGGE+T++   TT FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           +T+S D +QWK+ITS+N               G+ L++GGEFSSPKQ+TFYHYSD+W+LD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 172 LTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWK 231
            ++KEWTKI+ K  P  RSGHR+T WKN+F++ GGF+DLG STTY ND WLFDITTYKWK
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 232 QVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVE 291
           QVEFP NH +PDARSGHSLIPT EG IV+GGYC                CW L+MK+D+ 
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 292 AIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIES 351
            IRWERR+KQGFQPSPRVGCSMA+HKGRGILFGGVYD++ETEE L S F+NDL +Y +E+
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 352 NRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXXXXXXXX 411
           NRW+++ ++ +                    EL  +LN IL+K NL              
Sbjct: 354 NRWYSIKMRPQKKKIVAASKSAKSKDD----ELVGILNDILQKANLADEENEENESDSEI 409

Query: 412 XXXXXXXXXQK----NKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSIDS 467
                    ++     +     V QLPH RFNA TTV+DD L+I+GG+WE+GE D+SIDS
Sbjct: 410 EKELHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDS 469

Query: 468 FYSIDLNKLDGVNVYWEDLNEIETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKLIAX 527
           FYSIDLN+ DGV V+WEDL EIE AK                              +   
Sbjct: 470 FYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEM 529

Query: 528 XXXXXXXXXXXXXXXXXXXXXRPWLPHP-------KAFESLRAFYLREGPAFLEWAISNN 580
                                 P +P P       KAFE+LRAFY+R G  FL+WAISNN
Sbjct: 530 EDDKQEEEEQEEEEEEEEAG--PEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNN 587

Query: 581 RHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635
           R  +GK LK++SF+L QDRWWERR+Q+ IEEDKLEE+G V +++ERD+S +  +R
Sbjct: 588 RSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/452 (57%), Positives = 318/452 (70%), Gaps = 9/452 (1%)

Query: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSII----SSTTKKELLLFGGEHTSKELQTTK 106
           +L NFKKEQE +EK+ ++SV+K + R N  ++    +S++KKEL++FGGE T+ +  TT 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 107 FYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSD 166
           FYNDL+TF+P+NNQWKR TSQN               GIALL+GGEFSSPKQ+TFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 167 TWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDIT 226
           TWILD  TKEW K++ KV P  RSGHRIT WKN+FIL GGF+DLG STTY +D WLFDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 227 TYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXX-XXXXXXXXCWNLK 285
           TYKWKQVEFP NH +PDARSGHS IPT+EG I++GGYC                 CW LK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 286 MKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLF 345
           MK+D+  IRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLES F+NDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 346 TYNIESNRWFNVTLKKRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKPXXXXXX 405
           +Y+IESNRW++++++ R                   +EL+ LL+ ILEK NL+       
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 406 XXXXXXXXXXXXXXXQKNKIDIKT----VTQLPHPRFNATTTVIDDMLYIYGGAWEFGEI 461
                           + +  +      +TQLPHPRFNATTTVIDD L+I+GG WE G+ 
Sbjct: 409 DDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 462 DYSIDSFYSIDLNKLDGVNVYWEDLNEIETAK 493
           ++ IDS YSIDLNKLDGV +YWEDL EIE AK
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAK 500

 Score =  147 bits (370), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 549 RPWLPHPKAFESLRAFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQIS 608
           RPWLPHPK FE+LRAFY+REG AFLEWAISNN++ +GK LK+ SF+LCQ+RWWERRDQ+ 
Sbjct: 555 RPWLPHPKPFETLRAFYIREGAAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLR 614

Query: 609 IEEDKLEEIGVVGDVVERDTSKAVSKRR 636
           IEEDKLEEIG VGD++ERD S A SKRR
Sbjct: 615 IEEDKLEEIGGVGDIIERDKS-ASSKRR 641

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  496 bits (1276), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 275/616 (44%), Positives = 350/616 (56%), Gaps = 24/616 (3%)

Query: 39  DSDDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGE 96
           + DDE D +++EIL +F K+Q   E ++I SVEKPS R +  + ++    K EL +FGGE
Sbjct: 42  EEDDESDQDLDEILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGE 101

Query: 97  HTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSP 156
            T  E + T FYNDLY++S  NN WK+  SQN               GIALL+GGEFSSP
Sbjct: 102 FTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSP 161

Query: 157 KQSTFYHYSDTWILDLTTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGH- 212
           KQS FYHYSDTW+ D   +++TK+E  G+   P  RSGHRI  WKNYFILFGGF+DLG+ 
Sbjct: 162 KQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNG 221

Query: 213 STTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCX--XXXXX 270
            T+Y ND+W FDI+TYKW ++E    ++ PDARSGH  IPT    I+ GGYC        
Sbjct: 222 QTSYLNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNK 278

Query: 271 XXXXXXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDF 329
                      W L +  D +  +WE+ +    QPSPRVG S   + + + + FGGVYD 
Sbjct: 279 NLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDL 338

Query: 330 DETEESLESIFYNDLFTYNIESNRWFNVTLK--KRXXXXXXXXXXXXXXXXXXXRELQDL 387
            ETEESLES+FYNDL+ +++E N+W  + +K  ++                   +ELQDL
Sbjct: 339 QETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDL 398

Query: 388 LNQILEKNNLKPXXXXXXXXXXXXXXX------XXXXXXQKNKIDIKTVTQLPHPRFNAT 441
           LN IL K+NL                               N+ DI    QLPHPRFNA 
Sbjct: 399 LNSILAKSNLNDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAA 458

Query: 442 TTVIDDMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXX-XXXXX 500
           T V+ D L+IY G WE GE DY I+SFYSIDLNKLDGV VYWEDL+ IE AK        
Sbjct: 459 TCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSD 518

Query: 501 XXXXXXXXXXXXXXXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFES 560
                                   +                       R WLPHPK FE+
Sbjct: 519 EDEFEYEDDEEDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFET 578

Query: 561 LRAFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVV 620
           LRAFYLREG  FL W+ISNNR+ +GK LK KSFELC+DRWWERRDQ+++EE++LE+    
Sbjct: 579 LRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---T 635

Query: 621 GDVVERDTSKAVSKRR 636
           G ++ERDT+   SKRR
Sbjct: 636 GGIIERDTTTKPSKRR 651

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  493 bits (1270), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 273/620 (44%), Positives = 353/620 (56%), Gaps = 27/620 (4%)

Query: 38  LDSDDED--DGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLF 93
           LD DDED  D +++EIL +F K+Q   E ++I +VE+ S R +  + ++    K+EL +F
Sbjct: 39  LDGDDEDESDQDLDEILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIF 98

Query: 94  GGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEF 153
           GGE T  E + T FYNDLY++S  NN WK+  S+N               GIALL+GGEF
Sbjct: 99  GGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEF 158

Query: 154 SSPKQSTFYHYSDTWILDLTTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDL 210
           SSPKQS FYHYSDTW+ D   +++TK+E  G+   P  RSGHRI  WKNYFILFGGF+DL
Sbjct: 159 SSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDL 218

Query: 211 GH-STTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCX--XX 267
           G+  T+Y ND+W FDI+ YKW ++E    +T P+ARSGH  IPT    I+ GGYC     
Sbjct: 219 GNGQTSYLNDLWCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAK 275

Query: 268 XXXXXXXXXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGV 326
                         W L +  D +  +WE+ +    QPSPRVG S   + + + + FGGV
Sbjct: 276 NNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGV 335

Query: 327 YDFDETEESLESIFYNDLFTYNIESNRWFNVTLK--KRXXXXXXXXXXXXXXXXXXXREL 384
           YD  ETEESLES+FYNDL+ +++E N+W  + +K  ++                   +EL
Sbjct: 336 YDLQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKEL 395

Query: 385 QDLLNQILEKNNLKPXXXXX-----XXXXXXXXXXXXXXXXQKNKIDIKTVTQLPHPRFN 439
           QDLLN IL K+NL                              N  +I    QLPHPRFN
Sbjct: 396 QDLLNSILAKSNLNDDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFN 455

Query: 440 ATTTVIDDMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKX---XX 496
           A T V+DD L+IY G WE GE DY I+SFYSIDLNKLDGVNVYWEDL+ IE AK      
Sbjct: 456 AATCVVDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRD 515

Query: 497 XXXXXXXXXXXXXXXXXXXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPK 556
                                      L+                       R WLPHPK
Sbjct: 516 SDEDDFEYEDDDDDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPK 575

Query: 557 AFESLRAFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEE 616
            FE+LRAFYLREG  FL W+ISNN+  +GK LK KSFE+C+DRWWERRDQ+++EE++LE+
Sbjct: 576 PFETLRAFYLREGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLED 635

Query: 617 IGVVGDVVERDTSKAVSKRR 636
               G ++ERDT+  +SKRR
Sbjct: 636 ---TGGIIERDTTTKISKRR 652

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  488 bits (1257), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 269/608 (44%), Positives = 343/608 (56%), Gaps = 27/608 (4%)

Query: 50  EILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKF 107
           EIL +F K+Q   E ++I +VE+PS R +  + ++    K EL +FGGE T  E + T F
Sbjct: 53  EILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 108 YNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDT 167
           YNDLY++S  NN WK+  SQN               GIALL+GGEFSSPKQS FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 168 WILDLTTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGHS-TTYYNDVWLF 223
           W+ D   K++TK+E  G+   P  RSGHRI  WKNYFILFGGF+DLG   T+Y ND+W F
Sbjct: 173 WLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCF 232

Query: 224 DITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXX--XXC 281
           DI+ YKW ++E    +T PDARSGH  +PT    I+ GGYC                   
Sbjct: 233 DISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS 289

Query: 282 WNLKMKADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLESIF 340
           W L +  D +  +WE+ +    QPSPRVG S   + + + + FGGVYD  ETEESL+SIF
Sbjct: 290 WKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIF 349

Query: 341 YNDLFTYNIESNRWFNVTLK--KRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLK 398
           YNDL+ +++E N+W  + +K  +                    +ELQDLLN IL K+NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 399 --------PXXXXXXXXXXXXXXXXXXXXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLY 450
                                          +N+ +I    QLPHPRFNA T V+DD L+
Sbjct: 410 DEEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLF 469

Query: 451 IYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXX--XXXXXXXXXXXXX 508
           IY G WE GE DY I+SFYSIDLNKLDGV VYWEDL+ +E AK                 
Sbjct: 470 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDE 529

Query: 509 XXXXXXXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLRE 568
                        T+L+                       R WLPHPK FE+LRAFYLRE
Sbjct: 530 DDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLRE 589

Query: 569 GPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDT 628
           G  FL W+ISNNR+ +GK LK KSFELC+DRWWERRDQ+++EE++LE+    G ++ERD 
Sbjct: 590 GANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDA 646

Query: 629 SKAVSKRR 636
           +   SKRR
Sbjct: 647 TAKPSKRR 654

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  478 bits (1230), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 265/604 (43%), Positives = 339/604 (56%), Gaps = 24/604 (3%)

Query: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKFY 108
           IL +F K+Q   E ++I +VE+PS R +  + ++    K EL +FGGE T  E + T FY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 109 NDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTW 168
           NDLY++S  NN WK+  SQN               GIALL+GGEFSSPKQS FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 169 ILDLTTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGHS-TTYYNDVWLFD 224
           + D   +++ K+E  G+   P  RSGHRI  WKNYFILFGGF+DLG+  T+Y ND+W FD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 225 ITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXX--XXCW 282
           I+ YKW ++E    ++ PDARSGH  IPT    I+ GGYC                   W
Sbjct: 234 ISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAW 290

Query: 283 NLKMKADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLESIFY 341
            L +  D +  +WE+ +    QPSPRVG S   + + + + FGGVYD  ETEESLES+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 342 NDLFTYNIESNRWFNVTLK--KRXXXXXXXXXXXXXXXXXXXRELQDLLNQILEKNNLKP 399
           NDL+ +++E N+W  + +K  ++                   +ELQDLLN IL K+NL  
Sbjct: 351 NDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 400 XX------XXXXXXXXXXXXXXXXXXXQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYG 453
                                        N+ DI    QLPHPRFNA T V+ D L+IY 
Sbjct: 411 DDDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYS 470

Query: 454 GAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKXX-XXXXXXXXXXXXXXXXX 512
           G WE GE DY I+SFYSIDLNKLDGV VYWE+L+ IE AK                    
Sbjct: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDD 530

Query: 513 XXXXXXXXXTKLIAXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRAFYLREGPAF 572
                      L+                       R WLPHPK FE+LRAFYLREG  F
Sbjct: 531 EDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590

Query: 573 LEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAV 632
           L W+ISNNR+ +GK LK KSFELC+DRWWERRDQ+++EE++LE+    G ++ERD +   
Sbjct: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDVTTKP 647

Query: 633 SKRR 636
           SKRR
Sbjct: 648 SKRR 651

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 86/210 (40%), Gaps = 40/210 (19%)

Query: 164 YSDTWIL----DLTTKEWTKIE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWIL    D T    T I+  +  P  R GH      N F++FGG    +       
Sbjct: 152 YGDTWILSAFDDATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMD 211

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXX 272
           +D++L ++ +YKW  V  P     P  R GH  S+I T++      V+GG          
Sbjct: 212 DDIYLLNVNSYKWT-VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQFDDT----- 264

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N     D+ + R     W+  +   F P P    +M  +  +  +FGG  
Sbjct: 265 --------YFNDLAVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG-- 314

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWFNV 357
                 ++L+ +  ND+F Y+   N WF +
Sbjct: 315 ------DTLQGLI-NDVFMYDPAKNDWFTI 337

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 165 SDTWILDLTTKEWTKIE-GKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLF 223
           +D ++ D    +W  IE    KP     H    + +   + GG KD      Y N V+  
Sbjct: 322 NDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGG-KD--EHDAYLNTVYFL 378

Query: 224 DITTYKWKQVEFPKNHTLPDARSGHSL-IPTSEGCIVYGG 262
           ++ T+KW ++       +P  RSGHSL +  ++  ++ GG
Sbjct: 379 NLKTHKWFKLPIFA-AGIPQGRSGHSLTLLKNDKVLIMGG 417

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 61/154 (39%), Gaps = 15/154 (9%)

Query: 73  PSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXX 132
           P    N ++IS  +K  L +FGG+     LQ     ND++ + P  N W  I +      
Sbjct: 294 PPPMTNFTMISYDSK--LWVFGGD----TLQ--GLINDVFMYDPAKNDWFTIETSGEKPP 345

Query: 133 XXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIE--GKVKPVGRS 190
                       +  + GG     K     + +  + L+L T +W K+       P GRS
Sbjct: 346 PVQEHATVVYNDLMCVVGG-----KDEHDAYLNTVYFLNLKTHKWFKLPIFAAGIPQGRS 400

Query: 191 GHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFD 224
           GH +T  KN  +L  G     ++    +D+   D
Sbjct: 401 GHSLTLLKNDKVLIMGGDKFDYARAEESDLHTSD 434

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 87/208 (41%), Gaps = 40/208 (19%)

Query: 164 YSDTWIL---DLTTK-EWTKIE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWIL   D  TK   T I+  +  P  R GH      N F++FGG    +       
Sbjct: 152 YGDTWILTALDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXX 272
           +D++L +I +YKW  V  P     P  R GH  S+I T++      V+GG          
Sbjct: 212 DDIYLLNINSYKW-TVPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQF-------- 261

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N     D+ + R     WE  + + F P P    +M  +  +  +FGG  
Sbjct: 262 -----DDTYFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG-- 314

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWF 355
                 ++L+ +  ND+F Y+   N WF
Sbjct: 315 ------DTLQGLI-NDVFMYDPAINDWF 335

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 67/157 (42%), Gaps = 16/157 (10%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F++   ++E +  ++   P I  N ++IS  +K  L +FGG+     LQ     ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKAFTPPPI-TNFTMISYDSK--LWVFGGD----TLQG--LINDV 324

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + + P  N W  I +                  +  + GG     K     + +  + L+
Sbjct: 325 FMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGG-----KDEHDAYLNSVYFLN 379

Query: 172 LTTKEWTKIEGKVK--PVGRSGHRITTWKNYFILFGG 206
           L + +W K+       P GRSGH +T  K+  IL  G
Sbjct: 380 LKSHKWFKLPVFTAGIPQGRSGHSLTLLKDDKILIMG 416

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 81/184 (44%), Gaps = 13/184 (7%)

Query: 81  IISSTTKKELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXX 140
           I S     EL LFGG+           + DL +F   N+ W+ +   +            
Sbjct: 205 IASKQMHTELYLFGGQIDETYFNDLAVF-DLSSFRRPNSHWEFLEPISALPPPLTNHTMV 263

Query: 141 XXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIEGK-VKPVGRSGHRITTWKN 199
                  + GGE  +PK  +    +DT+  D     W+K+E    KP     H    +K+
Sbjct: 264 TFDNKLWVFGGE--TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKH 317

Query: 200 YFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSL-IPTSEGCI 258
              +FGG KD+ +  TY NDV+  ++ + KW ++   K   +P  RSGHSL +  +E  +
Sbjct: 318 LMCVFGG-KDIHN--TYSNDVYFLNLLSLKWFKLPCVK-EGIPQERSGHSLTLMNNEKLV 373

Query: 259 VYGG 262
           + GG
Sbjct: 374 IMGG 377

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 88/211 (41%), Gaps = 46/211 (21%)

Query: 166 DTWILDLTTKEWTKIEGKV--KPVGRSGHRITTWKNY-----FILFGGFKDLGHSTTYYN 218
           D ++ ++ + +WT I   +  +P+GR GH+I+   +        LFGG  D     TY+N
Sbjct: 173 DLYLFNINSYKWT-IPHPIGSRPLGRYGHKISIIASKQMHTELYLFGGQID----ETYFN 227

Query: 219 DVWLFDITTYKWKQVEFPKNH--------TLPDARSGHSLIPTSEGCIVYGGYCXXXXXX 270
           D+ +FD+++++      P +H         LP   + H+++       V+GG        
Sbjct: 228 DLAVFDLSSFRR-----PNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-------E 275

Query: 271 XXXXXXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFD 330
                     C++    A      W +    G +P P    +   +K    +FGG     
Sbjct: 276 TPKTISNDTYCYDPIQNA------WSKVETTGEKPPPVQEHASVVYKHLMCVFGG----- 324

Query: 331 ETEESLESIFYNDLFTYNIESNRWFNVTLKK 361
              + + + + ND++  N+ S +WF +   K
Sbjct: 325 ---KDIHNTYSNDVYFLNLLSLKWFKLPCVK 352

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 72/192 (37%), Gaps = 35/192 (18%)

Query: 177 WTKIEGKVKPVGRSGHR---ITTWKNYFILFGGFKDLGHSTTYYNDVWLFDI----TTYK 229
           W +I+ K  P  R  H    ITT  N   + GG  D     + Y DVW        T++ 
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRIFVTGGLYD----QSVYGDVWEITANANGTSFT 128

Query: 230 WKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKAD 289
            K+++   +H  P  R GH+        +V+GG                          +
Sbjct: 129 SKRIQI--DHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLF--------N 178

Query: 290 VEAIRWERRRKQGFQPSPRVGCSMAYHKGRGI-----LFGGVYDFDETEESLESIFYNDL 344
           + + +W      G +P  R G  ++    + +     LFGG    DET       ++NDL
Sbjct: 179 INSYKWTIPHPIGSRPLGRYGHKISIIASKQMHTELYLFGG--QIDET-------YFNDL 229

Query: 345 FTYNIESNRWFN 356
             +++ S R  N
Sbjct: 230 AVFDLSSFRRPN 241

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 72/183 (39%), Gaps = 35/183 (19%)

Query: 186 PVGRSGHRITTWKNYFILFGG-FKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDA 244
           P  R GH  T   N +++FGG    L  +    +D++LF+I +YKW  +  P   + P  
Sbjct: 139 PPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKW-TIPHPIG-SRPLG 196

Query: 245 RSGH--SLIPTSEG---CIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVEAIR----- 294
           R GH  S+I + +      ++GG                   +N     D+ + R     
Sbjct: 197 RYGHKISIIASKQMHTELYLFGGQIDETY-------------FNDLAVFDLSSFRRPNSH 243

Query: 295 WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRW 354
           WE        P P    +M     +  +FGG     ET +++     ND + Y+   N W
Sbjct: 244 WEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTIS----NDTYCYDPIQNAW 294

Query: 355 FNV 357
             V
Sbjct: 295 SKV 297

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 88/201 (43%), Gaps = 38/201 (18%)

Query: 166 DTWILDLTTKEWTKIEGKV--KPVGRSGHRI-----TTWKNYFILFGG-FKDLGHSTTYY 217
           D ++ ++ + +WT I   +  +P+GR GH+I     +T K    LFGG F D     TY+
Sbjct: 239 DIYLFNINSYKWT-IPNPIGPRPLGRYGHKICILATSTVKTKLYLFGGQFDD-----TYF 292

Query: 218 NDVWLFDITTYKWKQV--EFPKNHT-LPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXX 274
           ND+ +FD+++++ +    EF K+   +P   + H+++       +YGG            
Sbjct: 293 NDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG------------ 340

Query: 275 XXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 334
                   N   K       W +    G +P P    +   +K    + GG  + D    
Sbjct: 341 -DTQQGLINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGKDEND---- 395

Query: 335 SLESIFYNDLFTYNIESNRWF 355
               ++ N ++ +N +S++W+
Sbjct: 396 ----MYLNSVYLFNFDSSKWY 412

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 86/210 (40%), Gaps = 40/210 (19%)

Query: 164 YSDTWIL----DLTTKEWTKIE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWI+    D T      ++ G+  P  R GH  T   N FI+FGG    +       
Sbjct: 178 YGDTWIISCNPDATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMD 237

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCI-----VYGGYCXXXXXXXX 272
           +D++LF+I +YKW  +  P     P  R GH +   +   +     ++GG          
Sbjct: 238 DDIYLFNINSYKW-TIPNPIG-PRPLGRYGHKICILATSTVKTKLYLFGG---------- 285

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N     D+ + R     WE  + +GF P P    +M  +     ++GG  
Sbjct: 286 ---QFDDTYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-- 340

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWFNV 357
              +T++ L     ND+F ++  +N W  V
Sbjct: 341 ---DTQQGL----INDIFKFSPNTNTWTKV 363

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 66/162 (40%), Gaps = 21/162 (12%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F+++  ++E I  +    P + N+  +   T   +L ++GG+            ND+
Sbjct: 300 LSSFRRQDSHWEFIKSKGFMPPPLTNHTMV---TYGSDLWIYGGD------TQQGLINDI 350

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + FSP+ N W ++ +                  I  + GG     K     + +  ++ +
Sbjct: 351 FKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGG-----KDENDMYLNSVYLFN 405

Query: 172 LTTKEWTKI----EGKVKPVGRSGHRITTWKN-YFILFGGFK 208
             + +W        G ++  GRSGH +T   N   ++ GG K
Sbjct: 406 FDSSKWYTFPDFKSGIIQ--GRSGHSVTLLNNDKLLIMGGDK 445

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 87/208 (41%), Gaps = 40/208 (19%)

Query: 164 YSDTWIL---DLTTK-EWTKIE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWIL   D  TK   T I+  +  P  R GH      N F++FGG    +       
Sbjct: 152 YGDTWILTAFDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXX 272
           +D++L +I +YKW  V  P     P  R GH  S+I T++      V+GG          
Sbjct: 212 DDIYLLNINSYKWT-VPAPVG-PRPLGRYGHKISIIATNQMKTKLYVFGGQFDDTY---- 265

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N     D+ + R     WE  + + F P P    +M  +  +  +FGG  
Sbjct: 266 ---------FNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG-- 314

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWF 355
                 ++L+ +  ND+F Y+   N WF
Sbjct: 315 ------DTLQGLV-NDVFMYDPALNDWF 335

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 75/180 (41%), Gaps = 16/180 (8%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F++   ++E +  ++   P I  N ++IS  +K  L +FGG+     LQ     ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKTFSPPPI-TNFTMISYDSK--LWVFGGD----TLQG--LVNDV 324

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + + P  N W  I +                  +  + GG     K     + +  + L+
Sbjct: 325 FMYDPALNDWFIIETTGEKPPPVQEHATVVYNDLMCVVGG-----KDEHDAYLNSVYFLN 379

Query: 172 LTTKEWTKIEGKVK--PVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYK 229
           L + +W K+       P GRSGH +T  KN  IL  G     ++    +D+   DI   K
Sbjct: 380 LKSNKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEESDLHTSDIDMQK 439

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 86/208 (41%), Gaps = 40/208 (19%)

Query: 164 YSDTWIL----DLTTKEWTKIE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWIL    + T    T I+  +  P  R GH      N F++FGG    +       
Sbjct: 152 YGDTWILTAFDNATRFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXX 272
           +D++L +I +YKW  V  P     P  R GH  S+I T++      V+GG          
Sbjct: 212 DDIYLLNINSYKWT-VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQF-------- 261

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N     D+ + R     WE  + + F P P    +M  +  +  +FGG  
Sbjct: 262 -----DDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG-- 314

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWF 355
                 ++L+ +  ND+F Y+   N WF
Sbjct: 315 ------DTLQGLV-NDVFMYDPAINDWF 335

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 73/176 (41%), Gaps = 16/176 (9%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F++   ++E +   +   P I  N ++IS  +K  L +FGG+     LQ     ND+
Sbjct: 274 LSSFRRPDSHWEFLKPRTFTPPPI-TNFTMISYDSK--LWVFGGD----TLQ--GLVNDV 324

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + + P  N W  I +                  +  + GG     K     + +  + L+
Sbjct: 325 FMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGG-----KDEHDAYLNSVYFLN 379

Query: 172 LTTKEWTKIEGKVK--PVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDI 225
           L +++W K+       P GRSGH +T  KN  IL  G     ++     D+   DI
Sbjct: 380 LKSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEEYDLHTSDI 435

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 84/208 (40%), Gaps = 42/208 (20%)

Query: 164 YSDTWILDLTTKEWTKIEGKV------KPVGRSGHRITTWKNYFILFGG-FKDLGHSTTY 216
           Y DTWIL       T+   K        P  R GH  T   N F++FGG    + +    
Sbjct: 112 YGDTWILTAHANN-TRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLM 170

Query: 217 YNDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXX 271
            +DV+LF+I +YKW  +  P     P  R GH  S+I TS+      V+GG         
Sbjct: 171 DDDVYLFNINSYKWT-IPHPVG-PRPLGRYGHKISVIATSQMKTKLYVFGG--------- 219

Query: 272 XXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGV 326
                     +N     D+ + R     WE  + Q F P P    +M  +  +  +FGG 
Sbjct: 220 ----QFDDTYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG- 274

Query: 327 YDFDETEESLESIFYNDLFTYNIESNRW 354
               +T + L     N++F Y+   N W
Sbjct: 275 ----DTAQGL----INEVFMYDPTVNDW 294

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 166 DTWILDLTTKEWTKIEGK-VKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFD 224
           + ++ D T  +WT +E    KP     H    +K+   + GG KD     +Y NDV+  +
Sbjct: 283 EVFMYDPTVNDWTVVETTGSKPPAIQEHAAVVYKDLMCVTGG-KD--EQDSYSNDVYFLN 339

Query: 225 ITTYKWKQVEFPKNHTLPDARSGH 248
           + ++KW ++ F KN  +P  RSGH
Sbjct: 340 LKSFKWFKLPFFKN-GVPQGRSGH 362

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 85/210 (40%), Gaps = 44/210 (20%)

Query: 164 YSDTWILDLTTKEW-TKIEGKV------KPVGRSGHRITTWKNYFILFGG-FKDLGHSTT 215
           Y DTWIL        T I  K        P  R GH  T   N F++FGG    +    +
Sbjct: 199 YGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGS 258

Query: 216 YYNDVWLFDITTYKWKQVEFPKN-HTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXX 269
             +D++LF+I +YKW     PK     P  R GH  S+I TS+      ++GG       
Sbjct: 259 MDDDIYLFNINSYKWT---IPKPVGQRPLGRYGHKISIIATSQMKTKLYLFGG------- 308

Query: 270 XXXXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFG 324
                       +N  +  D+ + R     WE  R + F P P    +M  +  +  +FG
Sbjct: 309 ------QFDDTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFG 362

Query: 325 GVYDFDETEESLESIFYNDLFTYNIESNRW 354
           G        ++L+ +  N +F Y+   N W
Sbjct: 363 G--------DTLQGL-TNQVFMYDPVDNDW 383

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 192 HRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSL- 250
           H    +K+   + GG KD   S  Y NDV+  ++ T KW ++ F K   +P  RSGHS+ 
Sbjct: 405 HAAVLYKDLMCVIGG-KD--ESDNYLNDVYFLNLKTLKWFKLPFYK-EGVPQGRSGHSVT 460

Query: 251 IPTSEGCIVYGG 262
           +  ++  ++ GG
Sbjct: 461 LLKNDKILIMGG 472

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 86/187 (45%), Gaps = 16/187 (8%)

Query: 80  SIIS-STTKKELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXX 138
           SII+ +  + +L LFGG+           + DL +F   N+ W+ +              
Sbjct: 201 SIIAYNPMQTKLYLFGGQLDKTYFNDLAMF-DLSSFRRRNSHWEFLEPATTVPPPLANHT 259

Query: 139 XXXXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIE--GKVKPVGRSGHRITT 196
                    + GGE  +PK  +    ++T+  D    +W+KIE  G++ P  +  H    
Sbjct: 260 MVTYGNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQE-HASVV 312

Query: 197 WKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSL-IPTSE 255
           +K+   +FGG     H+  Y NDV+  D+ ++KW ++   K   +P  RSGHSL +  +E
Sbjct: 313 YKHIMCVFGG--KYTHNA-YSNDVYFLDLLSFKWYKLPHIK-EGIPRERSGHSLTLMKNE 368

Query: 256 GCIVYGG 262
             ++ GG
Sbjct: 369 KILIMGG 375

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 8/83 (9%)

Query: 186 PVGRSGHRITTWKNYFILFGG-FKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDA 244
           P  R GH  T   N +++FGG    L       +D++LF++ +YKW  +  P   + P  
Sbjct: 137 PPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWT-IPQPIG-SRPLG 194

Query: 245 RSGH--SLI---PTSEGCIVYGG 262
           R GH  S+I   P      ++GG
Sbjct: 195 RYGHKISIIAYNPMQTKLYLFGG 217

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 61/150 (40%), Gaps = 25/150 (16%)

Query: 211 GHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCI-VYGGYCXXXXX 269
           G STT  + +   +   Y W +++  K+   P  R   S I +SE  I V GG       
Sbjct: 52  GASTTLPSPIERENAKKYVWNRIKL-KDSPFPRYRHSSSPIVSSENRIFVTGGL------ 104

Query: 270 XXXXXXXXXXXCWNLKMKAD-----VEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFG 324
                       W +   AD      +AI+ +R       P PRVG +        ++FG
Sbjct: 105 ---YNQSVYGDVWQITANADGTSFTPKAIQIDRN-----TPPPRVGHASTLCGNAYVVFG 156

Query: 325 GVYDFDETEESLESIFYNDLFTYNIESNRW 354
           G    D  + + + +  +D++ +N+ S +W
Sbjct: 157 G----DTHKLNEDKLLDDDIYLFNVNSYKW 182

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 6/100 (6%)

Query: 165 SDTWILDLTTKEWTKIEGK-VKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLF 223
           ++T+  D    +W+KI+    +P     H    +K+   +FGG KD+ ++  Y NDV+  
Sbjct: 282 NETFCYDPVQNDWSKIQTTGERPPAVQEHASVVYKHLMCIFGG-KDIQNA--YSNDVYFL 338

Query: 224 DITTYKWKQVEFPKNHTLPDARSGHSL-IPTSEGCIVYGG 262
           ++ T+KW ++   K   LP  RSGHSL +  ++  ++ GG
Sbjct: 339 NLITFKWYKLPRIK-EGLPKERSGHSLTLIKNDKLVIMGG 377

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 86/206 (41%), Gaps = 44/206 (21%)

Query: 166 DTWILDLTTKEWTKIEG-KVKPVGRSGHRITTWKN-----YFILFGGFKDLGHSTTYYND 219
           D ++ ++ + +WT  +    +P+GR GH+I+   N        LFGG  D     TY+ND
Sbjct: 173 DLYLFNINSYKWTIPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGGQID----ETYFND 228

Query: 220 VWLFDITTYKWKQVEFPKNH--------TLPDARSGHSLIPTSEGCIVYGGYCXXXXXXX 271
           + +FD+++++      P +H         +P   + H+++       V+GG         
Sbjct: 229 LAMFDLSSFRR-----PNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-------KT 276

Query: 272 XXXXXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDE 331
                    C+      D     W + +  G +P      +   +K    +FGG      
Sbjct: 277 PNTLSNETFCY------DPVQNDWSKIQTTGERPPAVQEHASVVYKHLMCIFGG------ 324

Query: 332 TEESLESIFYNDLFTYNIESNRWFNV 357
             + +++ + ND++  N+ + +W+ +
Sbjct: 325 --KDIQNAYSNDVYFLNLITFKWYKL 348

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 13/110 (11%)

Query: 164 YSDTWI----LDLTTKEWTKIE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTW     LD T+     I+ G+  P  R GH  T   N +++FGG    L  +    
Sbjct: 112 YGDTWQITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLD 171

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLI---PTSEGCIVYGG 262
           +D++LF+I +YKW  +  P   T P  R GH  S+I   P      ++GG
Sbjct: 172 DDLYLFNINSYKWT-IPQPVG-TRPLGRYGHKISIIANNPMQTKLFLFGG 219

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 15/107 (14%)

Query: 166 DTWILDLTTKEWTKIEG-KVKPVGRSGHRITTW-----KNYFILFGG-FKDLGHSTTYYN 218
           D ++ +L + +WT  E   ++P+GR GH+I+       K    LFGG F D     TY+N
Sbjct: 136 DLYLFNLNSYKWTIPEPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQFDD-----TYFN 190

Query: 219 DVWLFDITTYKW--KQVEFPKNHT-LPDARSGHSLIPTSEGCIVYGG 262
           D+ +FD++T++    Q EF K  +  P   S H++I       V+GG
Sbjct: 191 DLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG 237

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 74/176 (42%), Gaps = 27/176 (15%)

Query: 186 PVGRSGHRITTWKNYFILFGG-FKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTL-PD 243
           P  R GH  T   N  ILFGG    +       +D++LF++ +YKW     P+   L P 
Sbjct: 102 PPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWT---IPEPIGLRPL 158

Query: 244 ARSGH--SLI---PTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVEAIRWERR 298
            R GH  S+I   PT     ++GG                   ++L      +A +WE  
Sbjct: 159 GRYGHKISIIATQPTKTKLFLFGGQF-------DDTYFNDLSMFDLSTFRKPDA-QWEFI 210

Query: 299 RKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRW 354
           + + F P P    +M  +  +  +FGG        E+L+ +  N++F Y+   N W
Sbjct: 211 KPKSFFPPPVSNHTMISYDNKLWVFGG--------ETLQGLI-NEVFVYDPIVNDW 257

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 70/181 (38%), Gaps = 14/181 (7%)

Query: 81  IISSTTKKELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXX 140
           I +  TK +L LFGG+           + DL TF   + QW+ I  ++            
Sbjct: 168 IATQPTKTKLFLFGGQFDDTYFNDLSMF-DLSTFRKPDAQWEFIKPKSFFPPPVSNHTMI 226

Query: 141 XXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIEGK-VKPVGRSGHRITTWKN 199
                  + GGE      +     ++ ++ D    +W+ IE     P     H    +KN
Sbjct: 227 SYDNKLWVFGGE------TLQGLINEVFVYDPIVNDWSVIETTGSSPPPIQEHAAVVYKN 280

Query: 200 YFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPK-NHTLPDARSGHSLIPTSEGCI 258
              + GG KD      Y N V+  ++ T KW   + P  N  +   RSGH+    ++  I
Sbjct: 281 LMCVVGG-KD--SKDNYMNSVYFLNLNTLKW--FKLPHINPGIMQGRSGHTATLLNDDSI 335

Query: 259 V 259
           +
Sbjct: 336 L 336

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 88/208 (42%), Gaps = 42/208 (20%)

Query: 164 YSDTWILDLTTKEWTKIEGKV------KPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY 217
           Y DTWI+++     T+   K        P  R GH  T   N F++FGG     +S    
Sbjct: 133 YGDTWIINVD-DSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLM 191

Query: 218 -NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXX 271
            +D++LF+I ++KW  +  P     P  R GH  S+I T++      ++GG         
Sbjct: 192 DDDLYLFNINSFKWT-IPHPVG-PRPLGRYGHKISIIATNQMKTKLYLFGG--------- 240

Query: 272 XXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGV 326
                     +N     D+ + R     WE  + + F P P    +M  +  +  +FGG 
Sbjct: 241 ----QFDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG- 295

Query: 327 YDFDETEESLESIFYNDLFTYNIESNRW 354
                  ++++ +  N +F Y+I SN W
Sbjct: 296 -------DTMQGLI-NKVFVYDIMSNDW 315

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (50%), Gaps = 10/102 (9%)

Query: 166 DTWILDLTTKEWTKIEGK-VKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFD 224
           D + L+L T +WT    K ++P+GR GH+I+   +   LFGG  D     TY+ND+  FD
Sbjct: 130 DLYFLNLDTTKWTIPSPKGIRPLGRYGHKISVINSNLYLFGGQFD----ETYFNDLVKFD 185

Query: 225 ITTYK--WKQVEF--PKNHTLPDARSGHSLIPTSEGCIVYGG 262
           +  +K    Q EF  PK   +P   S  S+        V+GG
Sbjct: 186 LLNFKDANSQWEFIKPKGF-IPPPLSNFSMCTFENKLYVFGG 226

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 82/225 (36%), Gaps = 47/225 (20%)

Query: 148 LNGGEFSSPKQSTFYHYSDTWILDLT-------TKEW------TKIEGKVKPVGRSGHRI 194
           +NGG F S        Y DTW L++         + W        I G   P  R GH  
Sbjct: 51  INGGLFESDV------YGDTWKLNIKENYNENDLERWHYSCNIIDIMGTTPP-PRVGHAA 103

Query: 195 TTWKNYFILFGGFKDLGHSTTYYN-----DVWLFDITTYKWKQVEFPKNHTLPDARSGHS 249
           T   N  I+FGG     H     N     D++  ++ T KW  +  PK    P  R GH 
Sbjct: 104 TLCGNALIVFGGDT---HKVNVSNGLMDDDLYFLNLDTTKWT-IPSPKG-IRPLGRYGHK 158

Query: 250 LIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRV 309
           +   +    ++GG                   ++L    D  + +WE  + +GF P P  
Sbjct: 159 ISVINSNLYLFGGQFDETYFNDLVK-------FDLLNFKDANS-QWEFIKPKGFIPPPLS 210

Query: 310 GCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRW 354
             SM   + +  +FGG             +  N+ F Y+ E N W
Sbjct: 211 NFSMCTFENKLYVFGG---------DTYQVLTNETFVYDPELNEW 246

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 86/210 (40%), Gaps = 40/210 (19%)

Query: 164 YSDTWI---LDLTT--KEWTKIEGKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWI   LD  T  K  T       P  R GH  T   N F++FGG    +  +    
Sbjct: 132 YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMD 191

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXX 272
           +D++LF+I ++KW  +  P+    P  R GH  S+I  ++      V+GG          
Sbjct: 192 DDIYLFNINSHKWT-IPTPQG-PRPLGRYGHKISIIAANQMKTKLYVFGGQFDDTY---- 245

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N   + D+ + R     WE  +   F P P    +M     +  +FGG  
Sbjct: 246 ---------FNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-- 294

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWFNV 357
              +T + L     N++F ++  +N W  V
Sbjct: 295 ---DTPQGLT----NEVFMFDPAANDWCVV 317

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 166 DTWILDLTTKEWTKIE--GKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLF 223
           + ++ D    +W  ++  G + P  +  H    +++   +FGG KD   +  Y N V+  
Sbjct: 303 EVFMFDPAANDWCVVQTTGNIPPPLQE-HAAIIYRDLMCVFGG-KDAQDN--YSNAVYFL 358

Query: 224 DITTYKWKQVEFPK-NHTLPDARSGHSL-IPTSEGCIVYGG 262
           +  + KW   + P  N+ +P ARSGHSL + ++   ++ GG
Sbjct: 359 NFRSLKW--FKLPTFNNMIPRARSGHSLTLLSNNKLLIMGG 397

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 83/208 (39%), Gaps = 42/208 (20%)

Query: 164 YSDTWILDLTTKEWTKIEGKV------KPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY 217
           Y DTWI+  T    T+ + K        P  R GH  T   N F+LFGG     +S    
Sbjct: 180 YGDTWIIS-TNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLM 238

Query: 218 -NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCI-----VYGGYCXXXXXXX 271
            +D++LF++ +YKW  +  P     P  R GH +   +   +     ++GG         
Sbjct: 239 DDDLYLFNVNSYKWT-IPHPIG-PRPLGRYGHKISIMAANQMKTKLYLFGGQF------- 289

Query: 272 XXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGV 326
                     +N     D+ + R     WE  +   F P P    +M  +     +FGG 
Sbjct: 290 ------DDTYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG- 342

Query: 327 YDFDETEESLESIFYNDLFTYNIESNRW 354
                  ++L+ +  N +F Y++ +N W
Sbjct: 343 -------DTLQGLI-NQVFKYDVANNDW 362

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 38/203 (18%)

Query: 166 DTWILDLTTKEWTKIEGKV--KPVGRSGHRIT-----TWKNYFILFGG-FKDLGHSTTYY 217
           D ++ ++ + +WT I   +  +P+GR GH+I+       K    LFGG F D     TY+
Sbjct: 241 DLYLFNVNSYKWT-IPHPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQFDD-----TYF 294

Query: 218 NDVWLFDITTYKWKQV--EFPKNHTL-PDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXX 274
           ND+ +FD+++++      EF K  T  P   + H++I       V+GG            
Sbjct: 295 NDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG------------ 342

Query: 275 XXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 334
                   N   K DV    W      G +P P    +   +K   ++ GG  + D    
Sbjct: 343 -DTLQGLINQVFKYDVANNDWSIAETTGTKPPPMQEHAAVVYKHVMVVVGGKDEHD---- 397

Query: 335 SLESIFYNDLFTYNIESNRWFNV 357
                + N ++  N++++ WF +
Sbjct: 398 ----TYLNSVYFLNLKTHEWFKL 416

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 81/184 (44%), Gaps = 13/184 (7%)

Query: 81  IISSTTKKELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXX 140
           I S+  + +L LFGG+           + DL +F   N+ W+ +                
Sbjct: 205 IASNPMQTKLYLFGGQVDETYFNDLVVF-DLSSFRRPNSHWEFLEPVGDLPPPLTNHTMV 263

Query: 141 XXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIEGK-VKPVGRSGHRITTWKN 199
                  + GGE  +PK  +    +DT+  D    EW+K++    KP     H    +K+
Sbjct: 264 AYDNKLWVFGGE--TPKTIS----NDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKH 317

Query: 200 YFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSL-IPTSEGCI 258
              + GG KD  ++  Y NDV+  ++ + KW ++   K   +P  RSGHSL +  +E  +
Sbjct: 318 LMCVLGG-KDTHNA--YSNDVYFLNLLSLKWYKLPRMK-EGIPQERSGHSLTLMKNEKLL 373

Query: 259 VYGG 262
           + GG
Sbjct: 374 IMGG 377

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 73/183 (39%), Gaps = 35/183 (19%)

Query: 186 PVGRSGHRITTWKNYFILFGG-FKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDA 244
           P  R GH  T   N +++FGG    L  +    +D++LF+I +YKW  +  P     P  
Sbjct: 139 PPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKW-TIPQPIGRR-PLG 196

Query: 245 RSGH--SLI---PTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVEAIR----- 294
           R GH  S+I   P      ++GG                   +N  +  D+ + R     
Sbjct: 197 RYGHKISIIASNPMQTKLYLFGGQVDETY-------------FNDLVVFDLSSFRRPNSH 243

Query: 295 WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRW 354
           WE     G  P P    +M  +  +  +FGG     ET +++     ND + Y+   + W
Sbjct: 244 WEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS----NDTYRYDPAQSEW 294

Query: 355 FNV 357
             V
Sbjct: 295 SKV 297

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 52/133 (39%), Gaps = 25/133 (18%)

Query: 228 YKWKQVEFPKNHTLPDARSGHSLIPTSEGCI-VYGGYCXXXXXXXXXXXXXXXXCWNLKM 286
           Y W +V+  KN   P  R   S I T++  I V GG                   W +  
Sbjct: 71  YIWNRVKL-KNSPFPRYRHSSSFIVTNDNRIFVTGGL---------HDQSVYGDVWQIAA 120

Query: 287 KADVEAIRWERRRKQGFQPSPRVG-----CSMAYHKGRGILFGGVYDFDETEESLESIFY 341
            AD  +   +R       P PRVG     C  AY     ++FGG    D  + +   +  
Sbjct: 121 NADGTSFTSKRIDIDQNTPPPRVGHASTICGNAY-----VVFGG----DTHKLNKNGLLD 171

Query: 342 NDLFTYNIESNRW 354
           +DL+ +NI S +W
Sbjct: 172 DDLYLFNINSYKW 184

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 17/108 (15%)

Query: 166 DTWILDLTTKEWTKIEGKV--KPVGRSGHRIT-----TWKNYFILFGG-FKDLGHSTTYY 217
           D ++ ++ + +WT I   V  +P+GR GH+I+     + K    LFGG F D     TY+
Sbjct: 242 DIYLFNINSHKWT-IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQFDD-----TYF 295

Query: 218 NDVWLFDITTYKWKQV--EFPKNHTL-PDARSGHSLIPTSEGCIVYGG 262
           ND+ +FD+++++      EF K   L P   + H+++       V+GG
Sbjct: 296 NDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG 343

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 77/196 (39%), Gaps = 42/196 (21%)

Query: 164 YSDTWILDLTTKEWTKIEGK------VKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTY 216
           Y DTW +  +T   T+   K      + P  R GH  T   N F++FGG    +      
Sbjct: 181 YGDTWSI-TSTNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLM 239

Query: 217 YNDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSEG---CIVYGGYCXXXXXXX 271
            +D++LF+I ++KW  +  P     P  R GH  S+I TS       ++GG         
Sbjct: 240 DDDIYLFNINSHKWT-IPSPVG-PRPLGRYGHKISIIATSSSKTKLYLFGG--------- 288

Query: 272 XXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGG- 325
                     +N     D+ + R     WE  + +G  P P    +M  +  +  +FGG 
Sbjct: 289 ----QFDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGGD 344

Query: 326 --------VYDFDETE 333
                   +Y FD  +
Sbjct: 345 TKDGLINDIYAFDPAD 360

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 83/210 (39%), Gaps = 40/210 (19%)

Query: 164 YSDTWILDLTTKEWTKIEGKV-----KPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWIL         I   V      P  R GH  T   N FI+FGG    +       
Sbjct: 173 YGDTWILTSENNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMD 232

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSEG---CIVYGGYCXXXXXXXX 272
           +D++LF+I ++KW  +  P     P  R GH  S+I T+       ++GG          
Sbjct: 233 DDLYLFNINSHKWT-IPNPVG-PRPLGRYGHKISIIATANSKTRLYLFGGQF-------- 282

Query: 273 XXXXXXXXCWNLKMKADVEAI-----RWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N  +  D+ +      RWE  + + F P P    +M  +  +  +FGG  
Sbjct: 283 -----DDAYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG-- 335

Query: 328 DFDETEESLESIFYNDLFTYNIESNRWFNV 357
                 ++L+ +  N +F Y+   N W  +
Sbjct: 336 ------DTLQGL-TNRVFMYDPMINDWTTI 358

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 78/191 (40%), Gaps = 23/191 (12%)

Query: 81  IISSTTKKELLLFGGEHTSKELQTTKFYNDLYTFS------PDNNQWKRITSQNXXXXXX 134
           I ++ +K  L LFGG+          ++NDL  F       PD+ +W+ +  ++      
Sbjct: 266 IATANSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDS-RWEFVKPKSFVPPPL 318

Query: 135 XXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRI 194
                        + GG+      +  + Y D  I D TT E +             H  
Sbjct: 319 TNHTMVSYDNKLWVFGGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQEHAA 377

Query: 195 TTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEF--PKNHTLPDARSGHSL-I 251
             +K+   +FGG KD     TY N V+  ++ T KW ++    P    +P  RSGHS+ +
Sbjct: 378 IVYKDLMCIFGG-KD--EQDTYLNGVYFLNLRTLKWYKLPIFAPG---IPQGRSGHSITL 431

Query: 252 PTSEGCIVYGG 262
             ++  ++ GG
Sbjct: 432 LKNDKLLIMGG 442

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 71/164 (43%), Gaps = 21/164 (12%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F++    +E +  +S   P + N+ +++S   K  L +FGG+     LQ     N +
Sbjct: 295 LSSFRRPDSRWEFVKPKSFVPPPLTNH-TMVSYDNK--LWVFGGD----TLQ--GLTNRV 345

Query: 112 YTFSPDNNQWKRITSQ----NXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDT 167
           + + P  N W  I +     N                +  + GG+    +Q T+ +    
Sbjct: 346 FMYDPMINDWTTIETSSDNPNNIAPPMQEHAAIVYKDLMCIFGGK---DEQDTYLN--GV 400

Query: 168 WILDLTTKEWTKIE--GKVKPVGRSGHRITTWKN-YFILFGGFK 208
           + L+L T +W K+       P GRSGH IT  KN   ++ GG K
Sbjct: 401 YFLNLRTLKWYKLPIFAPGIPQGRSGHSITLLKNDKLLIMGGDK 444

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 71/180 (39%), Gaps = 35/180 (19%)

Query: 186 PVGRSGHRITTWKNYFILFGG-FKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDA 244
           P  R GH  T   N F++FGG    +       +D++LF+I +YKW  +  P     P  
Sbjct: 263 PPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSYKWT-IPNPIG-PRPLG 320

Query: 245 RSGHSL-----IPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVEAIR----- 294
           R GH +      P      ++GG                   +N     D+   R     
Sbjct: 321 RYGHKVSIIATTPMKTKLYLFGGQF-------------DDTYFNNLAVFDLSQFRRPDSH 367

Query: 295 WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRW 354
           WE  + + F P P    +M  ++ +  +FGG        ++L+ +  N +F Y+ E N W
Sbjct: 368 WEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG--------DTLQGLI-NKIFMYDPEVNDW 418

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 68/166 (40%), Gaps = 23/166 (13%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L  F++   ++E +  +S   P + N+  +   + + +L +FGG+     LQ     N +
Sbjct: 358 LSQFRRPDSHWEFLKPKSFMPPPLTNHTMV---SYQNKLWIFGGD----TLQ--GLINKI 408

Query: 112 YTFSPDNNQWKRITS------QNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYS 165
           + + P+ N W  + +      Q                 + ++ GG     K     + +
Sbjct: 409 FMYDPEVNDWTVVETFPANNDQENFPPPMQEHASVMYGDLMVVMGG-----KDEQDNYLN 463

Query: 166 DTWILDLTTKEWTKIE--GKVKPVGRSGHRITTWK-NYFILFGGFK 208
             + L + T EW K+       P GRSGH IT  K N  ++ GG K
Sbjct: 464 TVYFLKINTLEWYKLPFLSVGIPQGRSGHSITLLKGNKLLIMGGDK 509

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 186 PVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDAR 245
           P     H    + +  ++ GG KD      Y N V+   I T +W ++ F  +  +P  R
Sbjct: 434 PPPMQEHASVMYGDLMVVMGG-KD--EQDNYLNTVYFLKINTLEWYKLPF-LSVGIPQGR 489

Query: 246 SGHSL 250
           SGHS+
Sbjct: 490 SGHSI 494

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 84/209 (40%), Gaps = 44/209 (21%)

Query: 164 YSDTWILDLTTKEWTKIEGKV------KPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY 217
           Y DTWI+       +K   K        P  R GH  T   N F++FGG     +S    
Sbjct: 117 YGDTWIIS-AHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLM 175

Query: 218 ND-VWLFDITTYKWKQVEFPKN-HTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXX 270
           +D V+LF+I +YKW     P+     P  R GH  S+I TS+      V+GG        
Sbjct: 176 DDDVYLFNINSYKWT---IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQFDDTY-- 230

Query: 271 XXXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGG 325
                      +N     D+ + R     W+  +   F P P    +M  +  +  +FGG
Sbjct: 231 -----------FNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG 279

Query: 326 VYDFDETEESLESIFYNDLFTYNIESNRW 354
                +T + L     ND+F ++ + N W
Sbjct: 280 -----DTPQGL----INDVFMFDPQINDW 299

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 71/176 (40%), Gaps = 16/176 (9%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F++   +++ I   +   P + N+ ++IS   K  L +FGG+            ND+
Sbjct: 239 LSSFRRPDSHWQFIKPNTFTPPPLTNH-TMISYDYK--LWVFGGD------TPQGLINDV 289

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + F P  N WK + +                  +  + GG     K     + +  + L+
Sbjct: 290 FMFDPQINDWKVMQTTGDKPPPLQEHAAVLYGDLMCVVGG-----KDEQDVYSNSVFFLN 344

Query: 172 LTTKEWTKIEGKVK--PVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDI 225
           L + +W K+       P GRSGH +T   N+ +L  G     ++     DV   D+
Sbjct: 345 LISLKWFKLPSYRSGIPQGRSGHSLTLLPNHKLLIMGGDKFDYARGGEGDVHTSDV 400

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 79/211 (37%), Gaps = 44/211 (20%)

Query: 164 YSDTWILDLTTKEWTKIEGKVK----------PVGRSGHRITTWKNYFILFGGFKDLGHS 213
           Y DTWIL  +  + T      K          P  R GH  T   N F++FGG     +S
Sbjct: 186 YGDTWILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNS 245

Query: 214 TTYY-NDVWLFDITTYKWKQVEFPKN-HTLPDARSGHSLIPTSE---GCIVYGGYCXXXX 268
                +D++L +I +YKW     PK     P  R GH ++  S       ++GG      
Sbjct: 246 DGLMDDDLYLLNINSYKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQFDDTY 302

Query: 269 XXXXXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILF 323
                               D+ + R     W   +  GF P P    +M  ++ +  +F
Sbjct: 303 FGDLAVF-------------DLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVF 349

Query: 324 GGVYDFDETEESLESIFYNDLFTYNIESNRW 354
           GG        ++LE    N ++ Y+  +N W
Sbjct: 350 GG--------DTLEEGLINRVYLYSPTNNSW 372

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 8/98 (8%)

Query: 168 WILDLTTKEWTKIE--GKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDI 225
           ++   T   W  +E  G + P  +  H    +K+   + GG KD      Y N ++  ++
Sbjct: 363 YLYSPTNNSWEIVETTGDIPPPMQE-HAAIVYKDLMCVVGG-KDA--EDNYLNTLYFLNL 418

Query: 226 TTYKWKQVEFPKNHTLPDARSGHSL-IPTSEGCIVYGG 262
            + KW ++ F KN+ +P  RSGHS+ +  ++  ++ GG
Sbjct: 419 QSLKWFKLPFYKNN-IPQGRSGHSVTLLKNDQILIMGG 455

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 12/129 (9%)

Query: 92  LFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGG 151
           +FGG+   + L      N +Y +SP NN W+ + +                  +  + GG
Sbjct: 348 VFGGDTLEEGL-----INRVYLYSPTNNSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG 402

Query: 152 EFSSPKQSTFYHYSDTWILDLTTKEWTKIE--GKVKPVGRSGHRITTWKNYFILFGGFKD 209
                K +   + +  + L+L + +W K+       P GRSGH +T  KN  IL  G   
Sbjct: 403 -----KDAEDNYLNTLYFLNLQSLKWFKLPFYKNNIPQGRSGHSVTLLKNDQILIMGGDK 457

Query: 210 LGHSTTYYN 218
             +S++  N
Sbjct: 458 YDYSSSTEN 466

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 76/185 (41%), Gaps = 45/185 (24%)

Query: 186 PVGRSGHRITTWKNYFILFGGFKDLGHSTT----YYNDVWLFDITTYKW--KQVEFPKNH 239
           P  R GH  T   N F++FGG     H T       +D++LF+I +YKW   Q   P+  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDT---HKTNKDGLMDDDIYLFNINSYKWTIPQPVGPR-- 194

Query: 240 TLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXXXXXXXXXXCWNLKMKADVEAIR 294
             P  R GH  S+I TS+      V+GG                   +N     D+ + R
Sbjct: 195 --PLGRYGHKISIIATSQMKTKLYVFGGQFDDSY-------------FNDLCVYDLSSFR 239

Query: 295 -----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNI 349
                WE  + + F P P    +M  +  +  +FGG     +T++ L     N LF ++ 
Sbjct: 240 KPESHWEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDP 290

Query: 350 ESNRW 354
             N W
Sbjct: 291 VINDW 295

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 70/157 (44%), Gaps = 16/157 (10%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F+K + ++E +  +S   P + N+ +++S   K  L +FGG+ T + L      N L
Sbjct: 235 LSSFRKPESHWEFLKPKSFIPPPLTNH-TMVSYDYK--LWVFGGD-TQQGL-----INQL 285

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + F P  N W+ + +                  +  + GG     K     + +  + L+
Sbjct: 286 FMFDPVINDWRVVETTGEKPPPVQEHAAVMFNDLMCIMGG-----KDEQDVYLNSVYFLN 340

Query: 172 LTTKEWTKIEG-KVK-PVGRSGHRITTWKNYFILFGG 206
           L + +W K    K+  P GRSGH IT  KN  +L  G
Sbjct: 341 LKSLKWFKFNDYKLNIPQGRSGHSITLLKNNRLLIMG 377

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 86/215 (40%), Gaps = 48/215 (22%)

Query: 164 YSDTWILDLTTKEWTKIEG-------KVKPVGRSGHRITTWKNYFILFGG----FKDLGH 212
           Y DTW+L     + + +         +  P  R GH  T   N F++FGG      ++G 
Sbjct: 170 YGDTWVLTCEDPQTSTMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGE 229

Query: 213 STTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXX 267
                +D++LF+I +YKW  +  P     P  R GH  S+I   +      ++GG     
Sbjct: 230 MD---DDIYLFNINSYKWT-IPHPIG-PRPKGRYGHKISIIARKQMQTKLYLFGG----- 279

Query: 268 XXXXXXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGIL 322
                         +N  +  D+ + R     WE  + + F P P    +M  +  +  +
Sbjct: 280 --------QFDDNYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWV 331

Query: 323 FGGVYDFDETEESLESIFYNDLFTYNIESNRWFNV 357
           FGG        ++LE +  N +F Y+   N W  V
Sbjct: 332 FGG--------DTLEGLL-NQVFMYDPAVNDWCVV 357

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 14/104 (13%)

Query: 168 WILDLTTKEWTKIEGKVK-------PVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDV 220
           ++ D    +W  +E   +       P     H    +K    + GG  +  H   Y NDV
Sbjct: 345 FMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGGKDEQDH---YLNDV 401

Query: 221 WLFDITTYKWKQVEFPK-NHTLPDARSGHSL-IPTSEGCIVYGG 262
           +  ++ + KW     P+    +P  RSGHS+ +  ++  ++ GG
Sbjct: 402 YFLNLKSLKW--FRLPRFMDGIPQGRSGHSVTLLKNDKLLIMGG 443

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 23/166 (13%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F+++  ++E I   S   P I N+ +++S   K  L +FGG+     L      N +
Sbjct: 294 LSSFRRDDSHWEFIKPRSFIPPPITNH-TMVSYDFK--LWVFGGDTLEGLL------NQV 344

Query: 112 YTFSPDNNQWKRI--TSQNXXXXXXXXXXXXXXX----GIALLNGGEFSSPKQSTFYHYS 165
           + + P  N W  +  T Q+                   G+  + GG     K    ++ +
Sbjct: 345 FMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGG-----KDEQDHYLN 399

Query: 166 DTWILDLTTKEWTKIEGKVK--PVGRSGHRITTWKN-YFILFGGFK 208
           D + L+L + +W ++   +   P GRSGH +T  KN   ++ GG K
Sbjct: 400 DVYFLNLKSLKWFRLPRFMDGIPQGRSGHSVTLLKNDKLLIMGGDK 445

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 81/208 (38%), Gaps = 42/208 (20%)

Query: 164 YSDTWILDLTTKEWTKIEGK------VKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYY 217
           Y DTWI+  + +   +   K        P  R GH  T   N F++FGG     +S    
Sbjct: 115 YGDTWIV-TSHENGARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLM 173

Query: 218 ND-VWLFDITTYKWKQVEFPKNHTLPDARSGH-----SLIPTSEGCIVYGGYCXXXXXXX 271
           +D V+LF+I +YKW  +  P     P  R GH     ++ P      V+GG         
Sbjct: 174 DDDVYLFNINSYKWT-IPNPVG-PRPLGRYGHKISIIAMSPMKTKLYVFGG--------- 222

Query: 272 XXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGV 326
                     +N     D+ + R     W+      F P P    +M  +  +  +FGG 
Sbjct: 223 ----QFDDTYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG- 277

Query: 327 YDFDETEESLESIFYNDLFTYNIESNRW 354
               +T + L     +D+F ++ + N W
Sbjct: 278 ----DTPQGL----IDDVFVFDPQVNDW 297

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 62/157 (39%), Gaps = 16/157 (10%)

Query: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDL 111
           L +F++   +++ I   S   P + N+  I   +   +L +FGG+            +D+
Sbjct: 237 LSSFRRPDSSWQFITPNSFTPPPLTNHAMI---SYDYKLWVFGGD------TPQGLIDDV 287

Query: 112 YTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILD 171
           + F P  N WK I +                  +  + GG     K     + +  + L+
Sbjct: 288 FVFDPQVNDWKFIQTTGQKPPPLQEHASVLYGDLMCIVGG-----KDEQDVYSNGVYFLN 342

Query: 172 LTTKEWTKIE--GKVKPVGRSGHRITTWKNYFILFGG 206
           L + +W K        P GRSGH +T   N+ +L  G
Sbjct: 343 LISLKWFKFPFFRAGIPQGRSGHSLTLLPNHKLLIMG 379

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 84/212 (39%), Gaps = 50/212 (23%)

Query: 164 YSDTWILD-------LTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTY 216
           Y DTWI+         T+K     E    P  R GH  T   N F++FGG     H T  
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITE--TTPPPRVGHASTLCGNAFVIFGGDT---HKTNA 251

Query: 217 Y----NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXX 267
                +DV+L +I ++KW  +  P     P  R GH  S+I TS+      V+GG     
Sbjct: 252 EGLMDDDVYLLNINSHKWT-IPRPVG-PRPLGRYGHKISIIATSQMKTKLYVFGGQF--- 306

Query: 268 XXXXXXXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGIL 322
                         +N     D+ + R     W+  +   F P P    +M  +  +  +
Sbjct: 307 ----------DDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWV 356

Query: 323 FGGVYDFDETEESLESIFYNDLFTYNIESNRW 354
           FGG     +T + L     N+LF Y+  +N W
Sbjct: 357 FGG-----DTPQGL----INELFMYDPTTNDW 379

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 77/202 (38%), Gaps = 30/202 (14%)

Query: 164 YSDTWIL----DLTTKEWTKIEGKVK-PVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTW+L    D T      I+  V  P  R GH  T   N  ++FGG    L       
Sbjct: 201 YGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLD 260

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSL-----IPTSEGCIVYGGYCXXXXXXXX 272
           +D++LF++ +++W  +  P   T P  R GH +      P      ++GG          
Sbjct: 261 DDLYLFNVDSHRW-TIPTPIG-TRPLGRYGHQVSVIATTPKKAKLYLFGGQL-------D 311

Query: 273 XXXXXXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDET 332
                    ++L    +  + RW+  + + F P P    +M  +  +  +FGG       
Sbjct: 312 DNYFNDLAMYDLSDFRNPHS-RWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG------- 363

Query: 333 EESLESIFYNDLFTYNIESNRW 354
             S      N L+ Y  + N W
Sbjct: 364 --SSRGELQNQLYVYIPDLNEW 383

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 15/121 (12%)

Query: 89  ELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNXXXXXXXXXXXXXXXGIALL 148
           +L +FGG  +  ELQ     N LY + PD N+W+ + ++                 +  +
Sbjct: 357 KLWVFGGS-SRGELQ-----NQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCV 410

Query: 149 NGGEFSSPK-QSTFYHYSDTWILDLTTKEWTKIEGK--VKPVGRSGHRITTWKNYFILFG 205
            GG+    + Q+T Y       L+L T +W +++     +P+ RSG  ++  +N  IL  
Sbjct: 411 FGGKNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQNDKILIM 464

Query: 206 G 206
           G
Sbjct: 465 G 465

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 84/207 (40%), Gaps = 40/207 (19%)

Query: 164 YSDTWILDL--TTKEWTK--IE-GKVKPVGRSGHRITTWKNYFILFGG-FKDLGHSTTYY 217
           Y DTWIL      K+++   IE  +  P  R GH  T   N F++FGG      +     
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGH--SLIPTSE---GCIVYGGYCXXXXXXXX 272
           +DV+L ++ ++KW  +  P     P  R GH  S+I TS+      V+GG          
Sbjct: 151 DDVYLLNVNSHKWT-IPHPVG-PRPLGRYGHKISIIATSQMKTKLYVFGGQF-------- 200

Query: 273 XXXXXXXXCWNLKMKADVEAIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVY 327
                    +N     D+ + R     W   +   F P P    +M  +  +  +FGG  
Sbjct: 201 -----DDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG-- 253

Query: 328 DFDETEESLESIFYNDLFTYNIESNRW 354
              +T + L     N+LF Y+   N W
Sbjct: 254 ---DTPQGL----INELFVYDPVVNDW 273

>Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 1511
           aa] {ON} complement(6278..9313,9316..10815) [4536 nt,
           1512 aa]
          Length = 1511

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 46/108 (42%), Gaps = 22/108 (20%)

Query: 170 LDLTTKEWTKIEGKVK------PVGRSGHRITTWKNYFILFGGFKDLGHSTTY----YND 219
           LDL +++W+KI+  +        + R  H I    +   LFGG      +  Y     ND
Sbjct: 146 LDLISRKWSKIDTIIPNDNTDFALSRLFHSIVYLDSAIYLFGGLILCPRAENYKLVPTND 205

Query: 220 VWLFDITTYKW-------KQVEFPKNHT----LPDARSGHSLIPTSEG 256
           +W  D+TT KW       + +    NHT    LP   SG +  PTS  
Sbjct: 206 LWKLDLTTKKWYCLSKNNQNIIQRYNHTMHIQLPSLNSGQT-TPTSSA 252

>KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15
           YOL141W
          Length = 676

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 13/100 (13%)

Query: 169 ILDLTTKEWTKIEGKVK-----PVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLF 223
           IL++T ++      K +     P  R+ H  T   N  +L  G ++  H    YND+W++
Sbjct: 396 ILEMTVQDLDSFVTKRQKPNDLPDARTCHTWTKLGNGKVLLVGGRNAPHRP--YNDIWIY 453

Query: 224 DITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCI-VYGG 262
           D     W+Q       +LP  R  H      E C+ +YGG
Sbjct: 454 DTEHNLWEQ-----KTSLPYPRFRHCTAQVDENCVLIYGG 488

>NCAS0H03640 Chr8 (691957..692604) [648 bp, 215 aa] {ON} 
          Length = 215

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 10/59 (16%)

Query: 66  NIESVEKPSIRN--NGSIISSTTKKELLLF------GGEHTSKEL--QTTKFYNDLYTF 114
           +I+ +E+ ++ N  N ++I   TKKEL L       GGE T+  L  Q T F++DLYTF
Sbjct: 19  HIDFLERAALENCYNVTVIPVRTKKELHLCDSLVIPGGESTTMSLIAQRTNFFDDLYTF 77

>TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15
           YOL141W
          Length = 677

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 10/95 (10%)

Query: 170 LDLTTKEWTKIEGKVKPVGRSGHRITTWKNY--FILFGGFKDLGHSTTYYNDVWLFDITT 227
           +D+ T  +  ++    P  R  H +T+  +   F++ GG +        Y D W+F++ +
Sbjct: 405 VDVDTGNYIPLDTGEAPPVRMCHTLTSLGSSQEFMMIGGRQS---PKDGYTDTWVFNMGS 461

Query: 228 YKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGG 262
             W+Q       +LP++R  H+        +V+GG
Sbjct: 462 NLWRQ-----GPSLPESRYRHAACLIENQILVFGG 491

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 80/198 (40%), Gaps = 52/198 (26%)

Query: 165 SDTWILDLTTKEWTKIEG-KVKPVGRSGHRITTWKN--YFILFGGFKDLGHSTTYYNDVW 221
           SDT  +D     + +++   V P  R+ H  T   +    ++ GG ++  H     ND W
Sbjct: 417 SDTLKIDTQKNTFIQLQNHSVLPPARACHTFTRLGDGETAMVIGG-RNAPHRAV--NDCW 473

Query: 222 LFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEG-CIVYGGYCXXXXXXXXXXXXXXXX 280
            +++ T +W+     K   LP+ R  HS + T +   +V GG                  
Sbjct: 474 FYNLNTNEWQ-----KGPELPEPRFRHSCVATDKNTLLVCGG------------------ 510

Query: 281 CWNLKMKADVEAIRWERRRKQGFQPS---------PRVGCSMAYHK--GRGILFGGVYDF 329
                 K D +A        + F+P          P +  ++A+ +   RGI+ GG Y+ 
Sbjct: 511 ------KTDGQAFLLYDNISETFKPCPVDHPSLKIPLISAAVAFDEKNNRGIIMGG-YN- 562

Query: 330 DETEESLESIFYNDLFTY 347
            ET    +S+F   +FTY
Sbjct: 563 SETGMISDSLF---VFTY 577

>KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8.157
           YGL197W
          Length = 1451

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 11/95 (11%)

Query: 150 GGEFSSPKQS-TFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHR-------ITTWKNYF 201
           GG   SP  +      ++ W LDLTTKEW+ +    K  GR  HR       +       
Sbjct: 157 GGLVVSPTSAYELVPTNELWRLDLTTKEWSLLSKNPKIKGRFNHRVHVKNENVNIRDTKL 216

Query: 202 ILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFP 236
           ++ GG  D  +   Y  DV+  ++T   W+    P
Sbjct: 217 VIVGGLDD-SNRPIYKVDVY--NLTQNCWQDDAVP 248

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 14/80 (17%)

Query: 165 SDTWILDLTTKEWTKIE-----------GKVKPVGRSGHRITTWKNYFILFGGFKDLGHS 213
           S+T+ LDL ++ W ++E             +K  GR  H +   + +  +FGG     H+
Sbjct: 125 SETFFLDLISRSWRRLETTIDESSTTDDTNIKTNGRLFHAMCFNEGFLYIFGGLMISPHN 184

Query: 214 TTYY---NDVWLFDITTYKW 230
              +   ND+W  D+   KW
Sbjct: 185 EYEFVATNDLWQLDLRGNKW 204

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 65  INIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDLYTFSPDNN-QWKR 123
           + +E  E  ++R  G+ +    KK+LL FGG    +        N++ +  PD + +   
Sbjct: 350 LPVEYFEIANVRKFGASVLDPNKKQLLYFGGSCPQRT-------NEIISIGPDGDCEAVP 402

Query: 124 ITSQNXXXXXXXXXXXXXXXGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTK 179
                                 A++ GG     +++ +   SDTW+ +L++ EWT+
Sbjct: 403 FDKTTAPVARACHTFTLVNNDTAMVVGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>Smik_19.4 Chr19 complement(4397..5062) [666 bp, 221 aa] {ON}
           YNL334C (REAL)
          Length = 221

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 48  IEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKEL--QTT 105
           IE I    K   EN ++ N E +   ++R+N  +   +    L++ GGE T+  L  Q T
Sbjct: 15  IEHIRHVEKCIDENKDQYNAE-LSVIAVRDNNQL---SKCDALIIPGGESTAMSLIAQRT 70

Query: 106 KFYNDLYTFSPDNNQ 120
            FYNDL+TF  + N+
Sbjct: 71  GFYNDLHTFVHNPNK 85

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 68/179 (37%), Gaps = 36/179 (20%)

Query: 169 ILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTY 228
           +  + + + TK  G   PV +     T+  +  ++ GG     ++T  Y+D+W FD  T 
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 229 KWKQVEFPKNH------TLPDARSGHSLIPTSEGCIVYGGYCXXXXXXXXXXXXXXXXCW 282
            W Q+E            +  A +GHS+       I  GG                    
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG-------------------- 722

Query: 283 NLKMKADVEAIRWERRRKQGFQPSPRVGCSM--AYHKGRGILFGGVYDFDETEESLESI 339
              M++DV+ + + R+      P+   GC+M   +      L G   ++DE   S  S+
Sbjct: 723 --MMQSDVDKL-YLRKHSMPLPPN-APGCTMLNMFDLSTQCLKGYTVNYDEENPSNTSL 777

>TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8.157
           YGL197W
          Length = 1479

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 46/108 (42%), Gaps = 27/108 (25%)

Query: 162 YHYSDTWILDLTTKEWTKIEGKV-----------KPVGRSGHRITTWKNYFILFGGF--- 207
           Y  S+T+ LDL  + W ++   V           KP  R  H I     Y  LFGG    
Sbjct: 127 YISSETFNLDLVERTWVRVSTTVVNNSENTGPFFKP--RILHTICYTNAYLYLFGGLTIS 184

Query: 208 ----KDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLI 251
               K L  S    N++W  ++ T KW  V   K+  +P AR  H+++
Sbjct: 185 DGDPKILVPS----NELWKLNLQTKKWSLVA--KDSNIP-ARFSHTMV 225

>YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}
           PPM2AdoMet-dependent tRNA methyltransferase also
           involved in methoxycarbonylation; required for the
           synthesis of wybutosine (yW), a modified guanosine found
           at the 3'-position adjacent to the anticodon of
           phe-tRNA; similarity to Ppm1p
          Length = 695

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 11/80 (13%)

Query: 186 PVGRSGHRITTWK--NYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPD 243
           PV R  H  TT    N  +L GG K      +   D W+FD+ T +W  ++     +L  
Sbjct: 437 PVARMCHTFTTISRNNQLLLIGGRKAPHQGLS---DNWIFDMKTREWSMIK-----SLSH 488

Query: 244 ARSGHSLIPTSEG-CIVYGG 262
            R  HS     +G  ++ GG
Sbjct: 489 TRFRHSACSLPDGNVLILGG 508

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 308 RVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRWFNVT 358
           RV  SM +H GR  LFGG+    +++  L  I  N+L++ ++E+  W  ++
Sbjct: 138 RVFHSMCFHDGRLYLFGGLVVSPQSDYEL--IASNELWSLDLETKTWLQLS 186

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 10/54 (18%)

Query: 164 YSDTWILDLTTKEWTKI--------EGKVKPVG--RSGHRITTWKNYFILFGGF 207
           Y D W  DL  + W++I         G+ +P+G    GH I   ++ F+L+GG 
Sbjct: 623 YGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIFHSRDEFLLYGGL 676

>TDEL0A01290 Chr1 (222024..225701) [3678 bp, 1225 aa] {ON} Anc_8.235
           YDR097C
          Length = 1225

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 41  DDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGS--IISSTTKKELLLFGGEHT 98
           DD++   ++ I+     ++   EK N+ S+    I+ N +   I +  K +   +G + T
Sbjct: 469 DDDECTKLDTIMSQVNPKEVIMEKDNLSSLAHKIIKFNAAPQAIYNYIKPDTEFYGYDKT 528

Query: 99  SKELQTTKFYNDLYTFSPDNNQWKRITSQ 127
           SKEL  +K++       PD +QW  I  Q
Sbjct: 529 SKELDDSKYF-------PDKSQWPAILKQ 550

>NCAS0C04370 Chr3 (896632..898698) [2067 bp, 688 aa] {ON} Anc_3.15
           YOL141W
          Length = 688

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 57/148 (38%), Gaps = 29/148 (19%)

Query: 218 NDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEG-CIVYGGYCXXXXXXXXXXXX 276
           NDVW  D  T +W+Q       +LP+ R  H  +  S    +++GG              
Sbjct: 464 NDVWRLDEKTLQWEQ-----KTSLPEGRFRHCSVSVSTNETLIFGG-----------KSS 507

Query: 277 XXXXCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHK--GRGILFGGVYDFDETEE 334
                 N  +K D+ A  +        +     G +M Y++  G G + GG        E
Sbjct: 508 VTLSSANKFLKYDISADTYNSMSVANGEVPSLSGAAMDYNEDTGVGAIVGG-------HE 560

Query: 335 SLESIFYNDLFTYNIESNRWFNVTLKKR 362
            +   F + LF ++ +     NV +KK+
Sbjct: 561 IVTDTFSDGLFVFSCDKT---NVIIKKK 585

>NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON} 
          Length = 1550

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 16/112 (14%)

Query: 150 GGEFSSPKQS-TFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRI-------TTWKNYF 201
           GG   SP+        ++ W L+L TK WT I    +   R  H +        T     
Sbjct: 196 GGLIVSPQSGYELIATNELWRLNLKTKVWTLISKDPRITRRFNHNMHIKNENNDTRDTKL 255

Query: 202 ILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARS---GHSL 250
           I+ GG  +L    ++   + ++++T   WK    PK+    DAR+   GH +
Sbjct: 256 IIIGGLNNLDQPVSH---IDVYNLTQNCWKADSIPKDPL--DARTNVDGHEI 302

>ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa]
           {ON} weakly similar to uniprot|P53094 Saccharomyces
           cerevisiae YGL197W MDS3 Protein with an N-terminal
           kelch- like domain putative negative regulator of early
           meiotic gene expression required with Pmd1p for growth
           under alkaline conditions
          Length = 1594

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 15/83 (18%)

Query: 166 DTWILDLTTKEWTKIEGKV------------KPVGRSGHRITTWKNYFILFGGF---KDL 210
           + + LDL ++ W ++E ++            K   R  H I+   +   +FGG       
Sbjct: 99  EVFFLDLISRSWKRLETEMDTQYIGEHDEVPKLSERFFHSISFCSSCLYIFGGLMVSPQN 158

Query: 211 GHSTTYYNDVWLFDITTYKWKQV 233
           G+     N++W  D+TT KW  +
Sbjct: 159 GYELIASNELWKLDLTTRKWSLI 181

>Ecym_6146 Chr6 (269126..270016) [891 bp, 296 aa] {ON} similar to
           Ashbya gossypii ACL190W
          Length = 296

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 57  KEQENYEKINIESVEKPSIRNNGSIISSTTKK-ELLLFGGEHTSKELQTTKFYNDLYTFS 115
           K +E  E + +E V  PS+R    ++S   +K ++ L GG     + QT+K YN    F 
Sbjct: 64  KFREYAEVVTLEGVGSPSVR----MLSYLARKWKVTLVGGSIPELDPQTSKVYNSSLVFG 119

Query: 116 PDNN 119
           P  +
Sbjct: 120 PQGD 123

>KAFR0B02180 Chr2 complement(425578..430209) [4632 bp, 1543 aa] {ON}
           Anc_8.157 YGL197W
          Length = 1543

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 23/107 (21%)

Query: 157 KQSTFYHYSDTWI------LDLTTKEWTKIEGKVKP-------VGRSGHRITTWKNYFIL 203
           K S F + +D WI      LDL T++W +I   ++         GR  H I  ++    +
Sbjct: 89  KSSIFKNLND-WISPEIFRLDLITRKWGRISTSLQDETNLTVMQGRLFHSICKFEQDLYV 147

Query: 204 FGGF---KDLGHSTTYYNDVWLFDITTYKWK------QVEFPKNHTL 241
           FGG        +     N++W  D+ T KW       Q+    NHT+
Sbjct: 148 FGGLLVSPKNDYELVATNELWKLDMVTRKWSLLSSDPQITRRFNHTI 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,964,913
Number of extensions: 2333235
Number of successful extensions: 9954
Number of sequences better than 10.0: 82
Number of HSP's gapped: 9781
Number of HSP's successfully gapped: 149
Length of query: 636
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 520
Effective length of database: 40,180,143
Effective search space: 20893674360
Effective search space used: 20893674360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)