Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B064906.6ON66663367e-43
NDAI0I027406.6ON66622066e-23
Sklu_YGOB_Anc_6.66.6ON61611952e-21
NCAS0D022006.6ON85641912e-20
CAGL0A01111g6.6ON69621875e-20
Skud_16.66.6ON62611865e-20
KNAG0E027906.6ON65641857e-20
Smik_6.4796.6ON62611857e-20
TBLA0A072006.6ON65611796e-19
YPL271W (ATP15)6.6ON62611797e-19
Suva_16.346.6ON62611753e-18
ZYRO0F00418g6.6ON62591683e-17
Kthe_YGOB_Anc_6.66.6ON62601674e-17
Kpol_1045.826.6ON62611666e-17
Kwal_56.223336.6ON62611641e-16
TDEL0G046506.6ON62611581e-15
Klac_YGOB_Anc_6.66.6ON61611474e-14
TPHA0J002306.6ON62591414e-13
Ecym_30086.6ON61611362e-12
ACR021W6.6ON62611293e-11
Kwal_47.190933.528ON81935630.82
TBLA0E019307.51ON165940583.1
KLTH0H11396g1.374ON43741583.7
KAFR0K005407.51ON166240566.8
NDAI0B01160singletonON30829557.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06490
         (66 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...   134   7e-43
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    84   6e-23
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    80   2e-21
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    78   2e-20
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    77   5e-20
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       76   5e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    76   7e-20
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    76   7e-20
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    74   6e-19
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    74   7e-19
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    72   3e-18
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    69   3e-17
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    69   4e-17
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    69   6e-17
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    68   1e-16
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    65   1e-15
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    61   4e-14
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    59   4e-13
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    57   2e-12
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    54   3e-11
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...    29   0.82 
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....    27   3.1  
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    27   3.7  
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...    26   6.8  
NDAI0B01160 Chr2 complement(275852..276778) [927 bp, 308 aa] {ON}      26   7.3  

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score =  134 bits (336), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEP 60
          MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEP
Sbjct: 1  MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEP 60

Query: 61 LQKSDS 66
          LQKSDS
Sbjct: 61 LQKSDS 66

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 84.0 bits (206), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 51/62 (82%)

Query: 2  SSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61
          S+VWRKAG+TY++YLSIA++TLR  LK E QTA V +RS T+A+ T YK+G+P S+PE L
Sbjct: 4  SAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63

Query: 62 QK 63
          QK
Sbjct: 64 QK 65

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 79.7 bits (195), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 48/61 (78%), Gaps = 1/61 (1%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAGLTY +YLSIA+KT+R  LKTE+QTA V SRS +EA    ++NG+P SDP PL+
Sbjct: 2  SAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLK 60

Query: 63 K 63
          K
Sbjct: 61 K 61

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 78.2 bits (191), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 48/64 (75%)

Query: 1  MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEP 60
          +S+  RKAG+TYA YL +AS+TLR  LKTE QT  V +RS T+A+ T Y+ GSP++DP P
Sbjct: 20 LSATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAP 79

Query: 61 LQKS 64
          LQ S
Sbjct: 80 LQTS 83

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 76.6 bits (187), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (75%)

Query: 2  SSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61
          S+ WRKAGL+Y+S+L+IA++T+RE LK E QT AV  R  T+A  T Y+ GSP SDP PL
Sbjct: 8  STAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67

Query: 62 QK 63
          Q+
Sbjct: 68 QE 69

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 76.3 bits (186), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (78%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAG++YA+YL++A++T+R  LKTE QTA+V SRS T+A  T YKNG+  S+P P+ 
Sbjct: 2  SAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPIT 61

Query: 63 K 63
          K
Sbjct: 62 K 62

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 75.9 bits (185), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%)

Query: 1  MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEP 60
          MS+ W+KAG+TYA+YL++ +KTLR  LK E QT  V SR  T+A  T Y+ G+P +DP+P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 61 LQKS 64
          LQ++
Sbjct: 61 LQET 64

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAG++YA+YL++A+K +R  LKTE QTA+V SRS T+A  T YKNG+  S+P P+ 
Sbjct: 2  SAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPIT 61

Query: 63 K 63
          K
Sbjct: 62 K 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 73.6 bits (179), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAG+TY +Y++IA+KT+R  LK E QTAAV  RS TEA  T Y  GSP +DP  L+
Sbjct: 2  SAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLK 61

Query: 63 K 63
          +
Sbjct: 62 E 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 73.6 bits (179), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 47/61 (77%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAG++YA+YL++A++ +R  LKTE QTA+V +RS T+A  T YKNG+  S+P P+ 
Sbjct: 2  SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPIT 61

Query: 63 K 63
          K
Sbjct: 62 K 62

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 72.0 bits (175), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 47/61 (77%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAG++YA+YL++A++T+R  LKTE QTA V SRS T+A+ T YKNG+  S+P  + 
Sbjct: 2  SAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSIT 61

Query: 63 K 63
          K
Sbjct: 62 K 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 69.3 bits (168), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61
          S WRKAGLTY +YLS+A+KT+R  LK E QTAAV SR   ++  T ++ G P  +P+PL
Sbjct: 2  SAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 68.9 bits (167), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAGLTY +Y++IA++T+R  LK + QTA V  RS TEA    Y+ G+P+++ +PL+
Sbjct: 2  SAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLK 61

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 68.6 bits (166), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 45/61 (73%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAG+TY  Y++IA++T+R+ LK E +T  V +RS TEA   +++NG+P  +P P+Q
Sbjct: 2  SAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQ 61

Query: 63 K 63
          +
Sbjct: 62 Q 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 44/61 (72%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAGLTY +Y++IA++T+R  LK E QTA V  RS TEA    Y+NG+  ++ +PL+
Sbjct: 2  SAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLK 61

Query: 63 K 63
          +
Sbjct: 62 E 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 65.5 bits (158), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (68%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          + WRKAGLTY +YLS+A++T+R  LK E Q A V +RS T+A    Y+ GS  SD  PLQ
Sbjct: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61

Query: 63 K 63
          +
Sbjct: 62 E 62

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 61.2 bits (147), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 1/61 (1%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAGLT+ +Y+S+A+ T+R  LK E QT +V +RS +EA    ++NG   S+P PL+
Sbjct: 2  STWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLK 60

Query: 63 K 63
          K
Sbjct: 61 K 61

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 58.9 bits (141), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 43/59 (72%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61
          S WRKAGLTY++YL++A+KT+R+ LK + +T +V SRS T+   T ++ G+  S+P  +
Sbjct: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 57.0 bits (136), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (73%), Gaps = 1/61 (1%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAGL+Y +Y+++A++ +R  LK E + AAV SRS TEA V NYK+G+  SD  PL+
Sbjct: 2  SAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPLK 60

Query: 63 K 63
          K
Sbjct: 61 K 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 54.3 bits (129), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%)

Query: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62
          S WRKAGLTY SYL++A++T+R  LK E Q+ AV +RSVTEA V +Y +    ++  PL+
Sbjct: 2  SAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLR 61

Query: 63 K 63
          K
Sbjct: 62 K 62

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score = 28.9 bits (63), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 13  ASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVT 47
           ASYL I ++T+R++L+ E  T  +  R  +  H+T
Sbjct: 208 ASYLEIYNETIRDLLEPETPTKKLVLREDSHRHIT 242

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
           YOR341W
          Length = 1659

 Score = 26.9 bits (58), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 5/40 (12%)

Query: 24  REVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQK 63
           R++LKT   T   A+     A VTN    +P  DPE L++
Sbjct: 846 RDILKTSVDTGRQAA-----AEVTNLSKDTPADDPELLKR 880

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score = 26.9 bits (58), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 17  SIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSD 57
           S+ SK L+  L  +     V + +  +  + NYK+  PLSD
Sbjct: 389 SVGSKHLKSALTQDAFAQIVKAATQNKDRIMNYKDDQPLSD 429

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa]
           {ON} Anc_7.51 YOR341W
          Length = 1662

 Score = 26.2 bits (56), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 5/40 (12%)

Query: 24  REVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQK 63
           +E+LKT   T   A+     A VTN    +P +DPE L++
Sbjct: 844 KEILKTSVDTGREAA-----AEVTNLPKDTPSNDPELLKR 878

>NDAI0B01160 Chr2 complement(275852..276778) [927 bp, 308 aa] {ON} 
          Length = 308

 Score = 25.8 bits (55), Expect = 7.3,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 21  KTLREVLKTEYQTAAVASRSVTEAHVTNY 49
           KTL E L+  Y+T A+  R +   H TNY
Sbjct: 175 KTLNEALEYAYETTAIGERFINGQH-TNY 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.117    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,365,341
Number of extensions: 161532
Number of successful extensions: 569
Number of sequences better than 10.0: 25
Number of HSP's gapped: 569
Number of HSP's successfully gapped: 25
Length of query: 66
Length of database: 53,481,399
Length adjustment: 39
Effective length of query: 27
Effective length of database: 49,009,425
Effective search space: 1323254475
Effective search space used: 1323254475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)