Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B064806.5ON75175134890.0
NDAI0I027306.5ON83256119930.0
NCAS0D022106.5ON77362919850.0
Suva_16.356.5ON76770019410.0
KNAG0E028006.5ON74167319320.0
YPL270W (MDL2)6.5ON77366019280.0
Smik_6.4786.5ON77366019230.0
Skud_16.76.5ON77370419130.0
TDEL0G046606.5ON73965018790.0
CAGL0A01133g6.5ON80162718850.0
ZYRO0F00396g6.5ON73270618760.0
TPHA0J002206.5ON74063118510.0
Kpol_1045.836.5ON74858518440.0
TBLA0A071906.5ON79465118060.0
KLLA0D00748g6.5ON78968917720.0
SAKL0E00748g6.5ON77459617510.0
KLTH0C11616g6.5ON74056217040.0
ACR022W6.5ON75456716930.0
Kwal_56.223296.5ON77656016930.0
Ecym_30076.5ON76960716740.0
NDAI0A005601.67ON71459511911e-153
TPHA0B046201.67ON72060511861e-152
Kpol_2000.791.67ON70762811821e-151
KLLA0C01991g1.67ON70660611661e-149
Smik_12.2481.67ON69663111621e-149
YLR188W (MDL1)1.67ON69562811621e-149
Skud_12.2531.67ON69260011611e-148
NCAS0B087001.67ON71559711511e-147
SAKL0C02244g1.67ON71261911471e-146
Suva_10.2841.67ON69360011451e-146
TDEL0C063501.67ON69359211401e-145
Ecym_10721.67ON68356111371e-145
AFR683C1.67ON67760311201e-142
Kwal_33.133081.67ON70661111191e-142
ZYRO0F17050g1.67ON71460711191e-142
KLTH0F02024g1.67ON73462311031e-139
TBLA0A053001.67ON70757810751e-135
CAGL0E00385g1.67ON60855310371e-131
YKL209C (STE6)1.527ON12905294723e-48
TDEL0F003401.527ON12575364474e-45
SAKL0H00968g5.20ON7003724405e-45
Kpol_1018.1851.527ON12765204466e-45
KLTH0B09482g5.20ON6945754388e-45
Kwal_26.94805.20ON7195684327e-44
KAFR0E002301.527ON12705004351e-43
Skud_13.4755.20ON6913454254e-43
Suva_11.111.527ON12905204298e-43
Smik_13.5185.20ON6873454193e-42
Suva_13.4915.20ON6933454183e-42
YMR301C (ATM1)5.20ON6903454158e-42
TPHA0O001601.527ON12535244163e-41
KNAG0G001901.527ON12755094164e-41
NCAS0D024305.20ON7023434104e-41
Skud_11.111.527ON12955324146e-41
KAFR0I025805.20ON7093394071e-40
Kpol_513.235.20ON7083424061e-40
KLLA0A10131g5.20ON7203494052e-40
NDAI0I024405.20ON7303404043e-40
SAKL0A10208g1.527ON13105014083e-40
NCAS0G035101.527ON12885164031e-39
TBLA0B100701.527ON12965194013e-39
KNAG0E013205.20ON6953693944e-39
AGL335W5.20ON6913463945e-39
CAGL0M13739g5.20ON7273393929e-39
TPHA0L022705.20ON7113693901e-38
TDEL0G004305.20ON6963473892e-38
ZYRO0G02244g1.527ON12734993932e-38
Ecym_56495.20ON6963433882e-38
AFR432W1.527ON12845203905e-38
NDAI0D015401.527ON12935173906e-38
ZYRO0D07106g5.20ON7093393803e-37
Smik_11.141.527ON13165293834e-37
TBLA0C070005.20ON7253433761e-36
KLTH0B01100g1.527ON12985033782e-36
CAGL0K00363g1.527ON12274313692e-35
Ecym_36121.527ON13155273612e-34
KLLA0B14256g1.527ON12715193575e-34
Kwal_33.155611.527ON12975103486e-33
YHL035C (VMR1)4.6ON15925093248e-30
KLLA0E00529g4.6ON16505493166e-29
TBLA0G007104.6ON16915173131e-28
CAGL0C03289g4.6ON16485103113e-28
NDAI0B006405.10ON14915513103e-28
CAGL0G00242g5.10ON14775573103e-28
TPHA0C009608.303ON15235403086e-28
TPHA0K023104.6ON16495513042e-27
YGR281W (YOR1)5.10ON14775752971e-26
Skud_7.6145.10ON14775642971e-26
SAKL0H16016g8.303ON14995252952e-26
KNAG0E011204.6ON17175152943e-26
KAFR0L001904.6ON16535112943e-26
CAGL0E03982g4.6ON16595092933e-26
Smik_8.64.6ON15855042925e-26
KNAG0K001705.10ON14425572916e-26
Smik_16.275.10ON14775842908e-26
NCAS0J00160singletonON16545412901e-25
YKR104WsingletonON3062632741e-25
NCAS0E041605.10ON15062502891e-25
TDEL0E056104.52ON15355342891e-25
KAFR0B056308.303ON15155332862e-25
Kpol_1060.75.10ON14605702863e-25
Suva_7.5775.10ON14785452863e-25
Skud_4.3958.303ON15165322863e-25
ZYRO0G07612g4.6ON16955102853e-25
KAFR0C065105.10ON14572342853e-25
KLTH0B00396gsingletonON15072372853e-25
Skud_18.2singletonON15805682835e-25
SAKL0H26026g4.6ON16535082827e-25
Suva_8.164.6ON15995132827e-25
NCAS0B034708.303ON15125312827e-25
KLLA0C14234g5.10ON14545542801e-24
Suva_10.234.6ON16615142801e-24
SAKL0H00704g5.10ON14395512792e-24
TPHA0A056205.10ON14775602782e-24
Ecym_84184.6ON16785282773e-24
KLTH0H16038g4.6ON16495182764e-24
YLL048C (YBT1)4.6ON16615172764e-24
CAGL0E03355g4.52ON15355302764e-24
TDEL0G018504.6ON16425122764e-24
NDAI0J011508.303ON15175122755e-24
Skud_12.224.6ON16615512756e-24
Kwal_34.157704.6ON14365172739e-24
Kpol_311.34.6ON16575122731e-23
TPHA0F001804.6ON16465062702e-23
Smik_4.3808.303ON15165272702e-23
Kpol_1033.288.303ON15315382702e-23
KLTH0B09724g5.10ON14865432693e-23
Smik_12.114.6ON16615082693e-23
KLTH0G12716g8.303ON15005252684e-23
Skud_8.94.6ON15875032674e-23
AGR047W8.303ON14925142675e-23
TDEL0F043008.303ON15145272666e-23
Smik_11.367na 1ON15955742657e-23
Suva_2.2978.303ON15165292658e-23
Zrou_YGOB_Anc_5.105.10ON9925502631e-22
ZYRO0D06160g8.303ON15255262641e-22
Ecym_42658.303ON15054852622e-22
NCAS0C059304.6ON16575512622e-22
TBLA0A06840singletonON10582502602e-22
YDR135C (YCF1)8.303ON15155162603e-22
TDEL0G003305.10ON14652572568e-22
Kwal_56.22747na 2ON15385302561e-21
KNAG0J027304.52ON15375442561e-21
Kwal_56.238448.303ON14945362551e-21
TPHA0F004104.52ON15705432532e-21
CAGL0L06402g8.303ON15355332523e-21
TBLA0C06400singletonON13775512514e-21
KLLA0F20075g8.303ON15164802505e-21
ACL072C4.6ON16275072505e-21
KLTH0C09240gna 2ON15465422496e-21
AGL346W5.10ON14002252471e-20
KNAG0I009908.303ON15355252471e-20
Kwal_26.95325.10ON14715452461e-20
KLLA0D04059g4.52ON15685122462e-20
Smik_12.484.52ON15575342452e-20
KAFR0I013004.52ON15365202381e-19
Suva_10.594.52ON15615352381e-19
Kpol_YGOB_1041.454.52ON15685492372e-19
Kpol_1041.45singletonOFF15965492362e-19
Suva_10.60singletonON9905352334e-19
ZYRO0G22176g4.52ON15705272273e-18
NDAI0H001904.6ON16823632264e-18
TBLA0C071005.10ON14855512255e-18
SAKL0H23958g4.52ON15582852131e-16
Skud_12.524.52ON15615332113e-16
YLL015W (BPT1)4.52ON15595362022e-15
Ecym_56605.10ON15361481737e-12
TBLA0A038008.303ON15464001702e-11
YKR103W (NFT1)na 1ON12184251682e-11
KAFR0G030107.123aON13723241584e-10
AGL142CsingletonON14972221531e-09
Kpol_1049.234.6ON110841372e-09
KAFR0C052205.500ON14992641513e-09
KAFR0C05210na 3ON14932251495e-09
CAGL0F01419g7.123aON13982881495e-09
TBLA0D017805.500ON15952271487e-09
TBLA0D01820singletonON15512251477e-09
CAGL0C02343g3.534ON7203771451e-08
ZYRO0E08800g3.534ON6102441451e-08
KNAG0B038705.500ON15132211461e-08
ZYRO0A04114g3.220ON15182361461e-08
SAKL0F01606g3.534ON6083201441e-08
Smik_9.1817.123aON14092711452e-08
Kpol_1050.263.534ON6103201432e-08
Suva_5.1343.534ON6101751432e-08
TPHA0A058903.534ON6102461432e-08
Ecym_11943.534ON6091891422e-08
ZYRO0B14762gsingletonON15152361432e-08
ZYRO0D11836gna 4ON14622211433e-08
NCAS0F007907.123aON14002371433e-08
KLTH0G01452g3.534ON6073751423e-08
Skud_14.404na 5ON14242311423e-08
ZYRO0D11880g5.500ON14982211414e-08
YER036C (ARB1)3.534ON6102481404e-08
Smik_15.3335.500ON15102251415e-08
TPHA0D04700singletonON15102251405e-08
Kwal_47.191163.534ON6072421396e-08
KAFR0A037908.661ON8762831396e-08
NCAS0E016303.220ON15652711397e-08
Kwal_23.51613.220ON14892341397e-08
YOR153W (PDR5)5.500ON15112251397e-08
Suva_9.1927.123aON14133111398e-08
KAFR0J027003.534ON6082441388e-08
NDAI0G018403.220ON15022591398e-08
ZYRO0D11858gna 3ON15032251398e-08
KAFR0C00820na 6ON15172111398e-08
YIL013C (PDR11)7.123aON14112031388e-08
KLLA0D03432g3.220ON14832421389e-08
Skud_15.1747.123aON13932001389e-08
Smik_5.1593.534ON6101891371e-07
Skud_5.1453.534ON6101891371e-07
TDEL0A036405.500ON15092231381e-07
CAGL0I04862g3.220ON15072341371e-07
TBLA0I033303.534ON6102711361e-07
NCAS0E004803.534ON6102561361e-07
KLTH0A01914g3.220ON14992281371e-07
Kwal_26.87308.661ON8312071361e-07
KAFR0E03460na 4ON15462241362e-07
SAKL0C11616g3.220ON14842521362e-07
YOR328W (PDR10)na 7ON15642361362e-07
AFR232C3.534ON6073751352e-07
CAGL0M01760gsingletonON14992231352e-07
Suva_15.1887.123aON13942001352e-07
NCAS0B053003.133ON12732821352e-07
Smik_15.1857.123aON13932001352e-07
NDAI0A042005.500ON15512241343e-07
Skud_4.6805.500ON14452231343e-07
Skud_4.681na 3ON14452231343e-07
YDR406W (PDR15)5.500ON15292231343e-07
KNAG0C045005.500ON15552241343e-07
NDAI0C012205.500ON15092211343e-07
TDEL0B057601.427ON10362331333e-07
YNR070W (PDR18)na 5ON13332341334e-07
TBLA0D043501.427ON11192491334e-07
Skud_4.2623.220ON15012331334e-07
SAKL0H19294g8.176ON5201991314e-07
Suva_2.5835.500ON15372191334e-07
Ecym_36043.220ON14742721324e-07
NDAI0I030203.534ON6092561314e-07
NDAI0H012807.123aON13922661324e-07
SAKL0H21010gsingletonON14472041325e-07
TPHA0L008107.123aON13732101325e-07
NCAS0E01650singletonON14882061325e-07
Smik_14.399na 5ON14212221325e-07
KAFR0E03450na 3ON15532241325e-07
KNAG0B004603.534ON6603061315e-07
Suva_8.379na 7ON15652231325e-07
NCAS0H024205.500ON15202211325e-07
KLTH0D10890g8.661ON8302101315e-07
TDEL0D040403.220ON15002151316e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06480
         (751 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...  1348   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   772   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      769   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   752   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   748   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   747   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   745   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   741   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   728   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   730   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   727   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   717   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   714   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   700   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   687   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   679   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   660   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   656   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   656   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   649   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   463   e-153
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   461   e-152
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   459   e-151
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   453   e-149
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   452   e-149
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   452   e-149
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   451   e-148
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   447   e-147
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   446   e-146
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   445   e-146
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   443   e-145
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   442   e-145
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   436   e-142
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   435   e-142
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   435   e-142
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   429   e-139
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   418   e-135
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   404   e-131
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   186   3e-48
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   176   4e-45
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   174   5e-45
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   176   6e-45
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   173   8e-45
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   171   7e-44
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   172   1e-43
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   168   4e-43
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   169   8e-43
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   166   3e-42
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   165   3e-42
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   164   8e-42
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   164   3e-41
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   164   4e-41
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     162   4e-41
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   164   6e-41
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   161   1e-40
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   160   1e-40
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   160   2e-40
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   160   3e-40
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   161   3e-40
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   159   1e-39
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   159   3e-39
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   156   4e-39
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   156   5e-39
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   155   9e-39
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   154   1e-38
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   154   2e-38
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   155   2e-38
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   154   2e-38
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   154   5e-38
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   154   6e-38
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   150   3e-37
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   152   4e-37
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   149   1e-36
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   150   2e-36
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   146   2e-35
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   143   2e-34
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   142   5e-34
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   138   6e-33
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   129   8e-30
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   126   6e-29
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   125   1e-28
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   124   3e-28
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    124   3e-28
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   124   3e-28
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   123   6e-28
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   121   2e-27
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   119   1e-26
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   119   1e-26
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   118   2e-26
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   117   3e-26
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   117   3e-26
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   117   3e-26
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   117   5e-26
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   116   6e-26
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   116   8e-26
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   116   1e-25
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   110   1e-25
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    115   1e-25
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   115   1e-25
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   114   2e-25
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   114   3e-25
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   114   3e-25
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   114   3e-25
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   114   3e-25
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   114   3e-25
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   114   3e-25
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   113   5e-25
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   113   7e-25
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   113   7e-25
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   113   7e-25
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   112   1e-24
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   112   1e-24
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   112   2e-24
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   111   2e-24
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   111   3e-24
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   110   4e-24
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   110   4e-24
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   110   4e-24
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   110   4e-24
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   110   5e-24
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   110   6e-24
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   109   9e-24
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   109   1e-23
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   108   2e-23
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   108   2e-23
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   108   2e-23
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   108   3e-23
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   108   3e-23
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   107   4e-23
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   107   4e-23
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   107   5e-23
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   107   6e-23
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   106   7e-23
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   106   8e-23
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   105   1e-22
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   106   1e-22
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   105   2e-22
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   105   2e-22
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   104   2e-22
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   104   3e-22
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   103   8e-22
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   103   1e-21
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   103   1e-21
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   102   1e-21
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   102   2e-21
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   101   3e-21
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   101   4e-21
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   100   5e-21
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   100   5e-21
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   100   6e-21
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   100   1e-20
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   100   1e-20
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...    99   1e-20
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...    99   2e-20
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...    99   2e-20
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...    96   1e-19
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...    96   1e-19
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...    96   2e-19
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...    96   2e-19
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...    94   4e-19
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...    92   3e-18
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...    92   4e-18
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}            91   5e-18
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...    87   1e-16
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...    86   3e-16
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...    82   2e-15
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    71   7e-12
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...    70   2e-11
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    69   2e-11
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     65   4e-10
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   1e-09
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    57   2e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    63   3e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            62   5e-09
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    62   5e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    62   7e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              61   7e-09
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    60   1e-08
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    60   1e-08
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    61   1e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    61   1e-08
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    60   1e-08
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    60   2e-08
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    60   2e-08
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    60   2e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    60   2e-08
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    59   2e-08
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    60   2e-08
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    60   3e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    60   3e-08
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    59   3e-08
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    59   3e-08
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    59   4e-08
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    59   4e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    59   5e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            59   5e-08
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    58   6e-08
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    58   6e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    58   7e-08
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    58   7e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    58   7e-08
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    58   8e-08
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    58   8e-08
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    58   8e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    58   8e-08
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              58   8e-08
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    58   8e-08
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    58   9e-08
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    58   9e-08
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    57   1e-07
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    57   1e-07
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    58   1e-07
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    57   1e-07
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    57   1e-07
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 57   1e-07
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    57   1e-07
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    57   1e-07
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    57   2e-07
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    57   2e-07
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    57   2e-07
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    57   2e-07
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    57   2e-07
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    57   2e-07
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    57   2e-07
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    57   2e-07
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    56   3e-07
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    56   3e-07
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    56   3e-07
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    56   3e-07
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    56   3e-07
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    56   3e-07
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    56   3e-07
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    56   4e-07
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    56   4e-07
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    56   4e-07
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    55   4e-07
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    56   4e-07
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    55   4e-07
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    55   4e-07
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    55   4e-07
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    55   5e-07
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             55   5e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    55   5e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    55   5e-07
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    55   5e-07
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    55   5e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    55   5e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    55   5e-07
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    55   5e-07
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    55   6e-07
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    55   6e-07
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                55   6e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    55   7e-07
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    55   7e-07
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    55   8e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    55   8e-07
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    55   8e-07
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    55   8e-07
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    54   9e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    55   1e-06
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    54   1e-06
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    54   1e-06
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    54   1e-06
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    54   1e-06
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    54   1e-06
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    54   1e-06
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    54   1e-06
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    54   1e-06
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    54   1e-06
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    54   2e-06
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              54   2e-06
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    54   2e-06
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    54   2e-06
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    54   2e-06
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    53   2e-06
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    53   2e-06
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    53   2e-06
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    53   2e-06
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    53   2e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    53   2e-06
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    53   2e-06
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    53   3e-06
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    53   3e-06
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    53   3e-06
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    53   3e-06
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    53   3e-06
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    53   3e-06
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    53   3e-06
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             53   3e-06
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    53   3e-06
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    51   3e-06
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    52   4e-06
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    52   4e-06
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    52   4e-06
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    52   4e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    52   4e-06
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    52   5e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    52   5e-06
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    52   5e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    52   5e-06
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    52   5e-06
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    52   6e-06
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    50   6e-06
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    52   7e-06
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    52   7e-06
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    52   7e-06
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    52   7e-06
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    52   7e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    52   8e-06
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     51   8e-06
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    51   9e-06
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     51   9e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    51   1e-05
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    51   1e-05
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    51   1e-05
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    51   1e-05
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    51   1e-05
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    51   1e-05
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    51   1e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    50   1e-05
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    50   1e-05
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    49   1e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    50   2e-05
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    50   2e-05
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    50   2e-05
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    50   2e-05
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    50   2e-05
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    50   2e-05
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    50   2e-05
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    50   2e-05
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    50   2e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    50   3e-05
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    49   3e-05
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    49   4e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              49   4e-05
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    49   4e-05
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    49   4e-05
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    49   4e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    49   4e-05
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    49   4e-05
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    49   4e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    49   5e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    49   5e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    49   6e-05
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    49   6e-05
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    49   6e-05
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    49   7e-05
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    48   7e-05
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    48   7e-05
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    48   7e-05
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    48   7e-05
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    48   7e-05
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    48   8e-05
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    48   8e-05
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    47   8e-05
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    48   1e-04
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    48   1e-04
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    48   1e-04
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    47   1e-04
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    47   1e-04
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    47   1e-04
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    47   1e-04
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    47   1e-04
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    47   2e-04
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    47   2e-04
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    47   2e-04
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    47   2e-04
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    47   2e-04
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    47   2e-04
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    47   2e-04
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    47   2e-04
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    47   2e-04
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    47   2e-04
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    46   3e-04
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    46   3e-04
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    46   3e-04
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    46   4e-04
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    46   4e-04
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    46   4e-04
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    45   5e-04
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    45   6e-04
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    45   6e-04
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    45   6e-04
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    45   7e-04
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    45   7e-04
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    45   7e-04
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    45   7e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    44   7e-04
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    45   8e-04
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    45   9e-04
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    45   9e-04
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    45   0.001
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    44   0.001
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    44   0.001
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    44   0.001
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.001
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    44   0.001
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    44   0.002
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    44   0.002
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    43   0.002
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    43   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    44   0.002
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    44   0.002
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    43   0.003
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    43   0.003
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    43   0.004
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    42   0.005
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    41   0.005
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    42   0.006
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    42   0.006
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    41   0.006
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    42   0.006
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    41   0.006
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.006
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    42   0.006
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    42   0.007
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    42   0.007
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    42   0.007
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    41   0.008
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    42   0.009
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    42   0.009
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    42   0.009
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    41   0.010
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    41   0.010
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    41   0.012
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    41   0.012
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    41   0.012
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    40   0.014
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    40   0.015
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    40   0.019
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    40   0.020
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    40   0.023
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    40   0.026
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    40   0.027
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    40   0.028
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    40   0.030
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    39   0.032
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    40   0.032
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    39   0.036
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    40   0.037
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    39   0.039
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    39   0.045
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    39   0.049
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    39   0.049
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    39   0.055
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       39   0.068
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    39   0.071
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    38   0.080
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    37   0.087
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    38   0.092
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    38   0.098
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    37   0.099
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    38   0.10 
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    38   0.11 
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    38   0.11 
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    38   0.11 
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    38   0.12 
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    38   0.12 
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    38   0.13 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.15 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    37   0.15 
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    37   0.15 
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    37   0.17 
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    37   0.19 
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    37   0.19 
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    37   0.21 
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    37   0.22 
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    37   0.22 
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    37   0.22 
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    37   0.23 
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...    37   0.24 
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    37   0.27 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    37   0.30 
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    37   0.30 
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    36   0.47 
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    35   0.63 
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    35   0.69 
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    35   0.70 
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    35   0.70 
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...    35   0.71 
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    35   0.78 
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    35   0.78 
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    35   0.81 
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    35   0.92 
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    35   0.92 
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    35   0.95 
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    35   0.95 
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    35   0.97 
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    35   1.0  
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    35   1.0  
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    35   1.3  
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    34   1.5  
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    34   1.6  
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    34   1.8  
TPHA0A03580 Chr1 (791948..792679) [732 bp, 243 aa] {ON} Anc_3.35...    33   1.8  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    34   1.9  
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    34   1.9  
NDAI0C04950 Chr3 (1146017..1146676) [660 bp, 219 aa] {ON} Anc_8....    33   2.5  
NCAS0C04460 Chr3 complement(914189..915700) [1512 bp, 503 aa] {O...    33   3.0  
Kwal_33.14336 s33 (624433..626049) [1617 bp, 538 aa] {ON} YHR064...    33   3.2  
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    33   3.4  
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    33   4.0  
KLTH0G16808g Chr7 (1458675..1459718) [1044 bp, 347 aa] {ON} simi...    32   4.0  

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score = 1348 bits (3489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/751 (89%), Positives = 675/751 (89%)

Query: 1   MLKLCLPRTTLLRSQLAGSNLRIIPSIRLLXXXXXXXXXXXXXXXXXCLTVPSRTNFIPR 60
           MLKLCLPRTTLLRSQLAGSNLRIIPSIRLL                 CLTVPSRTNFIPR
Sbjct: 1   MLKLCLPRTTLLRSQLAGSNLRIIPSIRLLSYSRPSPFPSNSPRPTRCLTVPSRTNFIPR 60

Query: 61  TLPQFLVPHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKI 120
           TLPQFLVPHRTLKTASTDNGSSWRDLKR                   TISCSIGMAIPKI
Sbjct: 61  TLPQFLVPHRTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKI 120

Query: 121 IGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERL 180
           IGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERL
Sbjct: 121 IGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERL 180

Query: 181 VSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXX 240
           VSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRS       
Sbjct: 181 VSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFG 240

Query: 241 XXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRT 300
             LMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRT
Sbjct: 241 IGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRT 300

Query: 301 VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH 360
           VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH
Sbjct: 301 VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH 360

Query: 361 GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAK 420
           GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAK
Sbjct: 361 GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAK 420

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
           FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL
Sbjct: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480

Query: 481 LHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE 540
           LHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE
Sbjct: 481 LHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE 540

Query: 541 IRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEA 600
           IRLVAKQCFCHNFITKFPDTYD               QKQRIAIARALIKKPNILILDEA
Sbjct: 541 IRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEA 600

Query: 601 TSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660
           TSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE
Sbjct: 601 TSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660

Query: 661 LYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEADNASEENGAKLDDSK 720
           LYDNP                ATPQPVNPPPFIDLQTNPEEKKEADNASEENGAKLDDSK
Sbjct: 661 LYDNPTSELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEADNASEENGAKLDDSK 720

Query: 721 EDVSVPDNMTSSDDSLKEAVNEGGPIKITPR 751
           EDVSVPDNMTSSDDSLKEAVNEGGPIKITPR
Sbjct: 721 EDVSVPDNMTSSDDSLKEAVNEGGPIKITPR 751

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/561 (67%), Positives = 450/561 (80%), Gaps = 10/561 (1%)

Query: 108 TISCSIGMAIPKIIGTILDTLRN---NYENLTSLSQIKILNIPLSTFLMGVGITLIFGCF 164
           TISC+IGM IPKIIG ILD L++     +  +S     +  + L  FL G  + L  GC 
Sbjct: 185 TISCTIGMMIPKIIGLILDALKSVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALFIGCA 244

Query: 165 ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSIT 224
           AN+GR+++LRI+SERLV+RLRS V+K+ +H+D EFFD  KVGDL+SR+G D+++VSRSIT
Sbjct: 245 ANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSIT 304

Query: 225 HKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT 284
            K++DGV+S         +ML LS +L+  L   + P++   S+FGKQIR+NS++LQD T
Sbjct: 305 QKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDAT 364

Query: 285 GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGD 344
           G LTRV+EEQ NG+RTVQ FVAE+ EIKRFN+ +REIF VGK +AFIN KFFTS SL+GD
Sbjct: 365 GQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGD 424

Query: 345 LGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE 404
           L FL VL YGSYLV+HGS++IGDLTAFMLYTEYTGNAIFGLS+FYSE+MQG GAASR+FE
Sbjct: 425 LSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE 484

Query: 405 INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464
           + D+ P I+ T G+  + P    G  EIEFKNVSF YPTRP+NQIFK+LNFK+  GSNVC
Sbjct: 485 LTDRVPTIRPTLGKT-YTP----GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVC 539

Query: 465 IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
           IVGPSG+GKSTIA LLLH+YN  SGQILIDGQDI  LN+KSLRR+I +VQQEP+LMSGTI
Sbjct: 540 IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTI 599

Query: 525 RDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
           RDNITYGLTEEP+KEEIR VAKQCFCHNFI KFP TYD               QKQRIAI
Sbjct: 600 RDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYD--TYIGPHGTLLSGGQKQRIAI 657

Query: 585 ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVI 644
           ARALIKKPNILILDEATSALDVESEGAINYTFGQ+MKSKSMTIVSIAHRLSTIRR E++I
Sbjct: 658 ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENII 717

Query: 645 VLGNDGSVVEMGKFKELYDNP 665
           VLGNDGSVVEMGKFKEL+ +P
Sbjct: 718 VLGNDGSVVEMGKFKELFADP 738

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/629 (61%), Positives = 463/629 (73%), Gaps = 11/629 (1%)

Query: 109 ISCSIGMAIPKIIGTILDTLR----NNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCF 164
           ISC IGM IPK+IG ILD+L+       E   +   I +  + +  FL G  I L+ GC 
Sbjct: 150 ISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCM 209

Query: 165 ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSIT 224
           ANFGR+++LRI+SERLV+RLRS V+K  IH+D +F+D  K GDL+SR+G DA++VSRSIT
Sbjct: 210 ANFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSIT 269

Query: 225 HKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT 284
            K++DG +S         +M +LS +L+  L  ++ P++   S+FGKQIR+NS++LQD T
Sbjct: 270 QKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDAT 329

Query: 285 GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGD 344
           G LTRV+EEQ NG++TVQ FVAE+ EIKRFN  +R IF VGK SAFIN KFFTS SL+GD
Sbjct: 330 GQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGD 389

Query: 345 LGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE 404
           L FL VL YGSYLV+HGS++IGDLTAFMLYTEYTGN+IFGLS+FYSE+MQG GAASR+FE
Sbjct: 390 LSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449

Query: 405 INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464
           + D  P+I+ T G+         G  EIEFKNVSF YPTRP NQIFKNLNFK+  GSNVC
Sbjct: 450 LTDYVPEIRPTLGKTYLP-----GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVC 504

Query: 465 IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
           IVGPSG+GKSTIA LLLH+YN  SGQILIDGQDI  +N+KSLRRK+GIVQQEP+LMSG+I
Sbjct: 505 IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSI 564

Query: 525 RDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
           RDNITYGLT  P+KEEIR VAKQCFCHNFITKFP TYD               QKQRIAI
Sbjct: 565 RDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYD--TQIGPSGTLLSGGQKQRIAI 622

Query: 585 ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVI 644
           ARALIKKPNILILDEATSALDVESEGAINYTFGQ+MK+KSMTIVSIAHRLSTIRR E+VI
Sbjct: 623 ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVI 682

Query: 645 VLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKE 704
           VLGNDGSV+EMGKFKEL+ +P                    P++  P +D     E  + 
Sbjct: 683 VLGNDGSVIEMGKFKELFSDPSSELSKLLNEKSSRKKTKSDPISSAPEVDADATGEPVEP 742

Query: 705 ADNASEENGAKLDDSKEDVSVPDNMTSSD 733
            D A E+    + +     S P  M+++D
Sbjct: 743 IDPAIEDALHSVLNDVTSESKPIKMSTTD 771

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/700 (56%), Positives = 480/700 (68%), Gaps = 23/700 (3%)

Query: 62  LPQFLVPHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKII 121
           LP      +  K A       ++D+ R                   TISCSIGM+IPK+I
Sbjct: 78  LPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVI 137

Query: 122 GTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLV 181
           G +LDTL+ +  +     +I I ++PL  FL    + L+ GC ANFGR ++LRI+SER+V
Sbjct: 138 GIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVV 197

Query: 182 SRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXX 241
           +RLR+ V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T KV+DGV++        
Sbjct: 198 ARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 257

Query: 242 XLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTV 301
            +M +LS +L+  L    PP+++  SVFGKQIR  SK LQ+ TG LTRV EEQ +GI+TV
Sbjct: 258 GMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 317

Query: 302 QGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHG 361
           Q FVAE NE+ R+N  +R+IFQVGK +AF N KFFT+ SL+GDL FL VL YGSYLV+  
Sbjct: 318 QSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQS 377

Query: 362 SMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKF 421
            +SIGDLTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+ D++P I  T G  K+
Sbjct: 378 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGH-KY 436

Query: 422 KPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL 481
           KP   V    IEFK+VSF YPTRP+ QIFK+LNFK+  GS+VCIVGPSGRGKSTIA LLL
Sbjct: 437 KPDRGV----IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 492

Query: 482 HHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEI 541
            +YN  +G I+ID QDI  +N KSLRR IGIVQQEP+LMSGTIRDNITYGLT  P+KEEI
Sbjct: 493 RYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 552

Query: 542 RLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEAT 601
           R VAKQCFCHNFITKFP+TYD               QKQRIAIARALIKKP +LILDEAT
Sbjct: 553 RSVAKQCFCHNFITKFPNTYD--TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEAT 610

Query: 602 SALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           SALDVESEGAINYTFGQ+MKSKSMTIVSIAHRLSTIRR E+VIVLG+DGSVVEMGKFKEL
Sbjct: 611 SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 670

Query: 662 YDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEADNASEEN----GAKLD 717
           Y NP                  P P      ++     EE  E +N  + N    G+  D
Sbjct: 671 YSNP-----TSALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHD 725

Query: 718 DSKEDVSVPDNMTSSDD-------SLKEAVNEGGPIKITP 750
           +   +  +      SDD        LK+A  E  PIK++P
Sbjct: 726 NDSNNKPLESKDKKSDDIEESVEHVLKDAAKEANPIKLSP 765

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/673 (58%), Positives = 487/673 (72%), Gaps = 20/673 (2%)

Query: 78  DNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNYENLTS 137
           ++  +++D+ R                   T+SC IGM IPK+IGT+LD+L++       
Sbjct: 83  EDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGK--E 140

Query: 138 LSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDL 197
            S++ I ++ L  F  G+   L+ GC AN+ RV++LRI+SE LV++LR+ V+K+IIH+D 
Sbjct: 141 FSELMIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKHIIHQDA 200

Query: 198 EFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFA 257
           +FFDT+KVGDL+SRVGNDAF+VSRSIT K++DGV++         +ML++S  L+ ++  
Sbjct: 201 QFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPLSCSILI 260

Query: 258 IL-PPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNN 316
           ++  P++    VFGKQIR NSKKLQ+VT +LTRV+EEQFNGI+T+Q FVAE++E+ +FN 
Sbjct: 261 LMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNG 320

Query: 317 VLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTE 376
            +R+IF VGKE+AFIN KFFT+AS+IGDL FL+VL+YGS+LV    +S+GDLTAFMLYTE
Sbjct: 321 SIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTE 380

Query: 377 YTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKN 436
           YTGNAIF LS F+SE+MQG GAASRIFE+ D +P+I  T G +KF P     G EIEFKN
Sbjct: 381 YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRG-SKFIPAK---GGEIEFKN 436

Query: 437 VSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQ 496
           VSF YPTRPT  IF+NLNFK+  GSNVCIVGPSG+GKSTIA LLLH+YN   GQILIDGQ
Sbjct: 437 VSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQ 496

Query: 497 DIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITK 556
           DI+ L+TKSLRR IGIVQQEPILMSGTIRDNITYGLT  P+KEEIR VAKQCFCHNFIT+
Sbjct: 497 DISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITR 556

Query: 557 FPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF 616
           FPDTYD               QKQRIAIARALIKKP +LILDEATSALDVESEGAINYTF
Sbjct: 557 FPDTYD--TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF 614

Query: 617 GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXX 676
           GQ+MKSKSMTIVSIAHRLSTIRR E+VIVLGNDGSVVE GKFKEL+ NP           
Sbjct: 615 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLLREK 674

Query: 677 XXXXXATPQPVNPPPFID-LQTNPEEKKEADNASEENGAKLDDSKEDVSVPDNMTSSDDS 735
                A P+ + P      ++ +P    EA  AS   G K +   E +         ++ 
Sbjct: 675 SSGNNAAPE-IQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETI---------NEV 724

Query: 736 LKEAVNEGGPIKI 748
           LK+   EG P+KI
Sbjct: 725 LKDISTEGKPLKI 737

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/660 (59%), Positives = 469/660 (71%), Gaps = 34/660 (5%)

Query: 110 SCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGR 169
           SCSIGM+IPK+IG +LDTL+ +  +     +I I ++PL  FL    + L+ GC ANFGR
Sbjct: 129 SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGR 188

Query: 170 VVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVAD 229
            ++LRI+SER+V+RLR+ V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T KV+D
Sbjct: 189 FILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSD 248

Query: 230 GVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTR 289
           GV++         +M +LS +L+  L    PP+++  SVFGKQIR  SK LQ+ TG LTR
Sbjct: 249 GVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308

Query: 290 VTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLI 349
           V EEQ +GI+TVQ FVAE NE+ R+N  +R+IFQVGK +AF N KFFT+ SL+GDL FL 
Sbjct: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLT 368

Query: 350 VLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKE 409
           VL YGSYLV+   +SIGDLTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+ D++
Sbjct: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428

Query: 410 PKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPS 469
           P I  T G  K+KP   V    IEFK+VSF YPTRP+ QIFKNLNFK+  GS+VCIVGPS
Sbjct: 429 PSISPTVGH-KYKPDRGV----IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPS 483

Query: 470 GRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
           GRGKSTIA LLL +YN  +G I ID QDI+ LN KSLRR IGIVQQEP+LMSGTIRDNIT
Sbjct: 484 GRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNIT 543

Query: 530 YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
           YGLT  P+KEEIR VAKQCFCHNFITKFP+TYD               QKQRIAIARALI
Sbjct: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD--TVIGPHGTLLSGGQKQRIAIARALI 601

Query: 590 KKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGND 649
           KKP ILILDEATSALDVESEGAINYTFGQ+MKSKSMTIVSIAHRLSTIRR E+VIVLG+D
Sbjct: 602 KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661

Query: 650 GSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEADNAS 709
           GSVVEMGKFKELY NP                A P P +      LQ     +KE  N S
Sbjct: 662 GSVVEMGKFKELYANP-----TSALSQLLNEKAAPGPSDQ----QLQIEKVIEKEDLNES 712

Query: 710 EE------------------NGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKITPR 751
           +E                  +        +D +  D   S +  LK+A  E  PIKITP+
Sbjct: 713 KEHDDQKKDDNDDNDNNHDNDSNNQSPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQ 772

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/660 (58%), Positives = 473/660 (71%), Gaps = 34/660 (5%)

Query: 110 SCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGR 169
           SCSIGM+IPK+IG +LDTL+ +  +     +I I ++PL  FL    + L+ GC ANFGR
Sbjct: 129 SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGR 188

Query: 170 VVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVAD 229
            ++LRI+SER+V+RLR+ V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T KV+D
Sbjct: 189 FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSD 248

Query: 230 GVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTR 289
           GV++         +M +LS +L+  L    PP+++  SVFGKQIR  SK LQ+ TG LTR
Sbjct: 249 GVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308

Query: 290 VTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLI 349
           V EEQ +GI+TVQ FVAE NE+ R+N  +R+IFQVGK +AF N KFFT+ SL+GDL FL 
Sbjct: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLT 368

Query: 350 VLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKE 409
           VL YGSYLV+   +SIGDLTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+ D++
Sbjct: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428

Query: 410 PKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPS 469
           P I  T G  K++P   V    IEFK+VSF YPTRP+ QIFK+LNFK+  GS+VCIVGPS
Sbjct: 429 PSISPTVGH-KYQPERGV----IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 483

Query: 470 GRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
           GRGKSTIA LLL +YN  +G I+ID QDI  LN KSLRR+IGIVQQEP+LMSGTIRDNIT
Sbjct: 484 GRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT 543

Query: 530 YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
           YGLT  P+KEEIR VAKQCFCHNFITKFP+TYD               QKQRIAIARALI
Sbjct: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD--TVIGPHGTLLSGGQKQRIAIARALI 601

Query: 590 KKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGND 649
           KKP ILILDEATSALDVESEGAINYTFGQ+MKSKSMTIVSIAHRLSTIRR E+VIVLG+D
Sbjct: 602 KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661

Query: 650 GSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEADNAS 709
           GSVVEMGKFKELY N                 A P P +      LQ    E+KE  N  
Sbjct: 662 GSVVEMGKFKELYAN-----STSALSQLLNERAAPGPSDQ----QLQIEKVEEKEDTNEG 712

Query: 710 EENGAK-------------LDDSKEDVSVPDNMT-----SSDDSLKEAVNEGGPIKITPR 751
           E++  +              D + + + V D  +     S +  LK+A  E  PIK+TP+
Sbjct: 713 EKHDQQNKQDDDNSHNNHDNDSNNQSLEVKDKNSENIEESVEHLLKDAAKEANPIKLTPQ 772

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/704 (55%), Positives = 482/704 (68%), Gaps = 41/704 (5%)

Query: 68  PHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDT 127
           P R  + + TD+   ++D+ R                   TISCSIGM+IPK+IG +LDT
Sbjct: 90  PARPPQRSKTDD---YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDT 146

Query: 128 LRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQ 187
           L+ +  +     +I I ++PL  FL    + L+ GC ANFGR ++LRI+SER+V+RLR+ 
Sbjct: 147 LKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206

Query: 188 VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
           V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T KV+DGV++         +M +L
Sbjct: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S +L+  L    PP+++  SVFGKQIR  SK LQ+ TG LTRV EEQ +GI+TVQ FVAE
Sbjct: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367
            NE+ R+N  +R+IFQVGK +AF N KFFT+ SL+GDL FL VL YGSYLV+   +SIGD
Sbjct: 327 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386

Query: 368 LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427
           LTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+ D++P I  T G  K+KP   V
Sbjct: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGH-KYKPHRGV 445

Query: 428 GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487
               +EFK+VSF YPTRP+ QIFKNLNFK+  GS+VCIVGPSGRGKSTIA LLL +YN  
Sbjct: 446 ----VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501

Query: 488 SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQ 547
           +G I+ID QDI  +N KSLRR IGIVQQEP+LMSGTIRDNITYGLT  P+KEEIR VAKQ
Sbjct: 502 TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561

Query: 548 CFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE 607
           CFCHNFITKFP+TYD               QKQRIAIARALIKKP ILILDEATSALDVE
Sbjct: 562 CFCHNFITKFPNTYD--TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619

Query: 608 SEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPXX 667
           SEGAINYTFG +MKSKSMTI+SIAHRLSTIRR E+VIVLG+DGSVVEMGKFK+LY NP  
Sbjct: 620 SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANP-- 677

Query: 668 XXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEADNASEENG-------------- 713
                         A P P       D Q   E+  E + ++EE                
Sbjct: 678 ---TSALSQLLNERAAPGPS------DQQQQIEKDNENEESTEEKAPDHSNKNDNDDNDN 728

Query: 714 ----AKLDDSKE--DVSVPDNMTSSDDSLKEAVNEGGPIKITPR 751
                    S+E    +  D   S +  L++A  E  PIK+TP+
Sbjct: 729 NHDNDSNKQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQ 772

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/650 (57%), Positives = 467/650 (71%), Gaps = 34/650 (5%)

Query: 108 TISCSIGMAIPKIIGTILDTLRNNYE-NLTSLSQIKILNIP-------LSTFLMGVGITL 159
           T+SC IGM IPK+IG ILD L+   E N      I + ++P       +  FL G    +
Sbjct: 116 TVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALM 175

Query: 160 IFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVV 219
           +FG  AN+GR+V+LRI+SER+V+RLR+ V+K  IH+D EFFD  KVGDL+SR+G+DA+VV
Sbjct: 176 VFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVV 235

Query: 220 SRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKK 279
           SRS+T KV+DG ++         +M+++S +L+G L    PP+++  S+FG++IR  S  
Sbjct: 236 SRSMTQKVSDGFKALICGGVGVGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTD 295

Query: 280 LQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSA 339
           LQ+ TG LTRV+EEQ +G+RTVQ FVAE+ EI R+++ +R+IF VGK +A+IN +FFT+ 
Sbjct: 296 LQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTAT 355

Query: 340 SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAA 399
           S +GD+ FL+VL YGSYLV+ G ++IGDLTAFMLYTEYTG+++FGL+SFYSELMQGVGAA
Sbjct: 356 SSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAA 415

Query: 400 SRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPA 459
           +R+FE+ D+ P IK TTG+ KF P    G  EI FK+V+F YPTRP N IF++++ K+PA
Sbjct: 416 TRLFELTDRVPSIKPTTGK-KFVP----GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPA 470

Query: 460 GSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPIL 519
           GSNVC+VGPSGRGKSTIA LLL  YN  SGQI IDGQDI+ LN KSLRR IG+VQQEP+L
Sbjct: 471 GSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVL 530

Query: 520 MSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
           MSGT+RDNITYGLTE PSKEEIR+VAKQCFCHNFI KFP  YD               QK
Sbjct: 531 MSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHGYD--TVIGPQGALLSGGQK 588

Query: 580 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRR 639
           QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFGQ+MKSKS+TIVSIAHRLSTIRR
Sbjct: 589 QRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRR 648

Query: 640 FEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNP 699
            E++IVLGNDGSVVE GKFKEL+ +P                 +    +     +    P
Sbjct: 649 SENIIVLGNDGSVVETGKFKELFADPSSELSKLLNEKSSRSENSSSSYS----PNASEQP 704

Query: 700 EEKKEADNASEENGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKIT 749
           E++    NA EE     DDS E++            LK+   EG PIKI+
Sbjct: 705 EDEANQKNAPEEAH---DDSVEEI------------LKDVTAEGKPIKIS 739

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/627 (59%), Positives = 450/627 (71%), Gaps = 15/627 (2%)

Query: 73  KTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNY 132
           ++ + +N S +RD+ R                   TISCSIGM IPK+IG ILD L+N  
Sbjct: 107 QSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNAL 166

Query: 133 E-NLTSLSQIKILNIP-------LSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRL 184
             N      + I  +P          FL G  + L+ G  AN+GR+++LR++SERLV+RL
Sbjct: 167 AANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARL 226

Query: 185 RSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM 244
           R+ V+K  IH+D EFFDT KVGDL+SR+G+DA+VVSRS+T KV+DG ++         +M
Sbjct: 227 RATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMM 286

Query: 245 LTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGF 304
           L LS +L+  L    PP+I   SVFGKQI   S++LQ+ TG LT+V EEQ +GI+TVQ F
Sbjct: 287 LALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSF 346

Query: 305 VAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMS 364
           VAE+ EI R+N  +R+IF +GK++A IN KFF+S S +GDL FL VL +GSYLV+  S++
Sbjct: 347 VAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLT 406

Query: 365 IGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL 424
           IGDLTAFM+YTEYTGN+IFGLS+FYSE+MQG GAASR+FE+ D+ P I +T G  K+KP 
Sbjct: 407 IGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-VKYKP- 464

Query: 425 NEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
              G  EIEFKNVSF YPTRP+N IFKNLNFK+ AGSNVCIVGPSGRGKST+A LL  +Y
Sbjct: 465 ---GNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYY 521

Query: 485 NAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLV 544
              SG+ILIDGQ+I  LN+KSLRR IG+VQQEPILMSGTIRDNI YGLTE P+K+EIR V
Sbjct: 522 KPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQV 581

Query: 545 AKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
           AKQCFCHNFIT+F  +YD               QKQRIAIARALIKKP ILILDEATSAL
Sbjct: 582 AKQCFCHNFITRFQSSYD--TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSAL 639

Query: 605 DVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
           DVESEGAINYTFGQ+MK K MTIVSIAHRLSTIRR E+VIVLG+DGSVVEMGKFKEL+D+
Sbjct: 640 DVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699

Query: 665 PXXXXXXXXXXXXXXXXATPQPVNPPP 691
           P                 T   V PPP
Sbjct: 700 PTSELSQLLNEKSTPHQTTNITVTPPP 726

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/706 (53%), Positives = 481/706 (68%), Gaps = 33/706 (4%)

Query: 52  PSRTNFIPRTLPQFLVPHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISC 111
           PS+    P+ + Q L P +  +       SS++D  R                   TISC
Sbjct: 53  PSQEENRPKPVKQILEPIQKKE-------SSYKDAVRLFSLAKRDWRLLCAAIALLTISC 105

Query: 112 SIGMAIPKIIGTILDTLRNNYE-------NLTSLSQIKILNIPLSTFLMGVGITLIFGCF 164
            IGM+IPK+IG +LD LR   E       N+  L  I    + +  FL      L+ G  
Sbjct: 106 VIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIA-FGLTIYQFLGVFAGLLLVGTA 164

Query: 165 ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSIT 224
           ANF R+V+LRI+SER+V+RLRS V+   +H+D EF+DT KVGDL+SR+G+DA+VVSRS+T
Sbjct: 165 ANFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMT 224

Query: 225 HKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT 284
            KV+DG ++         +M+++S EL+G L    PPI+W  SVFGK+IR  SK LQ+ T
Sbjct: 225 QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284

Query: 285 GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGD 344
           G LTRV EEQ +G++TVQ FVAE+ E+ R+N  +R I+ VG+++AFIN +FFTS +++GD
Sbjct: 285 GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344

Query: 345 LGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE 404
           + F++VL YGSYLV+ GS++IGDLTAFMLYTEYTG+++FGL++FYSELMQGVGAASR+F+
Sbjct: 345 MSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404

Query: 405 INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464
           + D    I  T G+ K+ P    G  +IEFKNVSF YPTRP NQIFK++N KVP GSNVC
Sbjct: 405 LTDHISSISPTKGQ-KYIP----GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVC 459

Query: 465 IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
           IVGPSGRGKSTIA LLL +YN  +GQIL+DGQDI+ +N K+LRR IG+VQQEPILMSGTI
Sbjct: 460 IVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTI 519

Query: 525 RDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
           RDNITYGL E  +KEEIR VAKQCFCHNFITKFPD YD               Q+QRIAI
Sbjct: 520 RDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYD--TMIGAQGALLSGGQRQRIAI 577

Query: 585 ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVI 644
           ARALIKKPNIL+LDEATSALDVESEGAINYTFGQ+MKS SMTIVSIAHRLSTI+R E+VI
Sbjct: 578 ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637

Query: 645 VLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKE 704
           VLG DGSV+E GKFKEL+ NP                       PPP      N  + K 
Sbjct: 638 VLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPP------NATQDKV 691

Query: 705 ADNASEENGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKITP 750
            +  +E+   +  ++ +    PD   +  +  K+  +EG PIKITP
Sbjct: 692 VEQIAEKILERFPEAGQS---PD--ATVKEIFKDVSSEGKPIKITP 732

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/631 (58%), Positives = 458/631 (72%), Gaps = 29/631 (4%)

Query: 48  CLTVPSRTNFIPRTLPQFLVPHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXX 107
           C     R +    T PQ  VP       S ++G+   D+KR                   
Sbjct: 48  CTITTKRWSSSKTTAPQVRVPK------SRNDGN---DIKRLLSLAKKDWKLLCIAVGLL 98

Query: 108 TISCSIGMAIPKIIGTILDTLRN------NYENLTSLSQIKILNIP-------LSTFLMG 154
           T+SC+IGM++PK+IG +LD L+N      + E  ++   I+   +P       L  FL  
Sbjct: 99  TVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGC 158

Query: 155 VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGN 214
           +G  L+ G  ANFGRVV+LR++SER+V+RLRSQV+K  IH+D EFFD  KVGDL+SR+G+
Sbjct: 159 IGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGS 218

Query: 215 DAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIR 274
           DA+VVSRS+T KV+DG ++         +M+++S EL+  L    PP++  +  FG+ IR
Sbjct: 219 DAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLIR 278

Query: 275 MNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGK 334
            NS+KLQ+ TG LTRV+EEQF+G++TVQ FVAE+ EIKR+NNV+++++ VGKESAFIN K
Sbjct: 279 DNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAK 338

Query: 335 FFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQ 394
            FT  S +GD+ FL+VL YGSYLV+HG +SIGDLTA+M+YTE TG+A+FGLSSFYSE+MQ
Sbjct: 339 LFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQ 398

Query: 395 GVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLN 454
           GVGAASR+FE+ D+ P I  TTG+ K+ P    G  EIEFKNVSF YPTRP +QIFK+LN
Sbjct: 399 GVGAASRLFELTDRIPMISPTTGK-KYIP----GKGEIEFKNVSFAYPTRPGSQIFKSLN 453

Query: 455 FKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQ 514
           FK+  GSNVCIVGPSGRGKSTIASLLL +Y   +G I +DGQDI+ LN+KSLRR IGIVQ
Sbjct: 454 FKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQ 513

Query: 515 QEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXX 574
           QEPILMSG+IRDNITYGLT E + EEIR V KQCFCHNFITKFPD Y             
Sbjct: 514 QEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQ--TILGPNGTLL 571

Query: 575 XXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRL 634
              QKQRIAIARAL+KKPN+LILDEATSALDVESE AINYTFG++MK K +TI+SIAHRL
Sbjct: 572 SGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRL 631

Query: 635 STIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           STIRR E VIVLGNDGSVVE+GKFK L+ NP
Sbjct: 632 STIRRSEIVIVLGNDGSVVEIGKFKTLFGNP 662

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/585 (59%), Positives = 448/585 (76%), Gaps = 12/585 (2%)

Query: 85  DLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNYEN----LTSLSQ 140
           DLKR                   ++SC IGM++PKIIG +LD L+    N    +  + +
Sbjct: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPE 160

Query: 141 IKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF 200
           I    + L  F+  VG++L+ G  AN+GRV++LR++SER+V+RLR+ V+K  +H+D EFF
Sbjct: 161 IA-FGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF 219

Query: 201 DTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILP 260
           D  KVGDL+SR+ +DA+VVSRS+T KV+DG ++         +M+++S +L+  L  + P
Sbjct: 220 DNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTP 279

Query: 261 PIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLRE 320
           P++   S FG+ IR NS+ LQ+ TG LT+V EEQF+GI+TVQ FVAE+ EIKR+N+ +R 
Sbjct: 280 PVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH 339

Query: 321 IFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGN 380
           IF VGK+SAFIN KFF+  +++GD+ FL+VL YGSYLV+HGS+SIGDLTA+M+YTEYTG+
Sbjct: 340 IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGS 399

Query: 381 AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
           +IFGLS+FYSE+MQG GAASR+FE+ D+ P I  T G+ KF P       EIEFKNVSF 
Sbjct: 400 SIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK-KFVP----NKGEIEFKNVSFS 454

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
           YPTR +NQIFKNL+FK+ AGSNVCIVGPSGRGKSTIASLLL +YN  +GQI +DGQDI+ 
Sbjct: 455 YPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISK 514

Query: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
           +++KSLRR + IVQQEP+LMSGTIRDNITYGL E+P+++E+R + K+CFCHNFITKFP++
Sbjct: 515 VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
           YD               QKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG++M
Sbjct: 575 YD--TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLM 632

Query: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           KSKS+TI+SIAHRLSTIRR E+VIVLGNDGSV E+GKFKELY +P
Sbjct: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/651 (55%), Positives = 458/651 (70%), Gaps = 38/651 (5%)

Query: 110 SCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIP-------LSTFLMGVGITLIFG 162
           SCSIGMAIPK+IG +LD L+N   +  S S ++  ++P       L  FL      L+ G
Sbjct: 172 SCSIGMAIPKVIGLVLDALKNVMTD--SPSSLETSDLPPIAFGLTLYPFLGAFAGALVIG 229

Query: 163 CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRS 222
              N+GR ++LR++SER+V+RLRS V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS
Sbjct: 230 TMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRS 289

Query: 223 ITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQD 282
           +T KV+DG ++         +M+++S +L+  L    P ++   S+FGK+IR  S  LQ+
Sbjct: 290 LTQKVSDGFKAILCGGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQE 349

Query: 283 VTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLI 342
            TG LTRV+EEQ NG++TVQ FVAE+ EI+R+NN +R+I+ +GK SA +N KF TS S+I
Sbjct: 350 ATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409

Query: 343 GDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI 402
           GD+ FL+VL YGSYLV+HGS++IGDLTAFMLYT+YT N+IFGLS+FYSE+MQGVGAA R+
Sbjct: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469

Query: 403 FEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSN 462
           F++ D+ P I+ T GE KF P +   GC IEF+N+ F YPTRP NQ+FKNLNFK+  G++
Sbjct: 470 FDLTDRIPAIRPTIGE-KFIPGD---GC-IEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSG 522
           VCIVGPSGRGKSTIA LLL +YN  SGQILID QDI  LN KSLR+ +GIVQQEP+LMSG
Sbjct: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584

Query: 523 TIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRI 582
           +IRDNITYGL  E + +EIR V+KQCFCHNFITKFPD Y+               QKQRI
Sbjct: 585 SIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYE--TIIGPHGTLLSGGQKQRI 642

Query: 583 AIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFED 642
           AIARALIKKP ILILDEATSALDVESEGAINYTFG++MKSKS+TIVSIAHRLSTIRR E 
Sbjct: 643 AIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY 702

Query: 643 VIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEK 702
           +IVLGNDGSVVE GKFKELY +P                    P+ P             
Sbjct: 703 IIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPP------------- 749

Query: 703 KEADNASEENGAKLDDSKEDVSVP---DNMTSSDDSLKEAVNEGGPIKITP 750
                +  ENG   + +    S P   +N+ +  D LKE  ++  P+KI P
Sbjct: 750 ----QSDGENGDDFEGNGTPASPPSLHNNLVT--DVLKEVSDDSSPLKIAP 794

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/689 (52%), Positives = 469/689 (68%), Gaps = 35/689 (5%)

Query: 70  RTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLR 129
           +T K +ST +G    D+KR                   T+SC+IGMA+PK+IG +LD  +
Sbjct: 100 KTNKPSSTVSGG-LADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATK 158

Query: 130 N------------NYENLTSLSQIK----ILNIPLSTFLMGVGITLIFGCFANFGRVVIL 173
           N              E+  SL+       + +I L  F +  G  L+ G  ANFGRVV+L
Sbjct: 159 NALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLL 218

Query: 174 RIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRS 233
           +I+ ERLV+RLRS V+K  +H D+EF+D  KVGDL+SR+G DA++VSRS+T  ++DG ++
Sbjct: 219 KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKA 278

Query: 234 XXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEE 293
                    +M  +S  L   LF   PP++   +++G +IR  S++LQ  +G+LT+V EE
Sbjct: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338

Query: 294 QFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTY 353
           Q +GI+TVQ FVAE  E+ R+NN +R++F VGK+ AF N  FF+S +++GD  FL+VL Y
Sbjct: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398

Query: 354 GSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIK 413
           GS+LV+ G+++IGDLTAFMLYTEYTG+A+FGLS+FYSELM+G GAA+R+FE+ D +P IK
Sbjct: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIK 458

Query: 414 STTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473
           STTG+A FKPLN     ++EF++VSF YPTR TNQIFK+LNF +  GSNVCIVGPSGRGK
Sbjct: 459 STTGKA-FKPLN----GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGK 513

Query: 474 STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLT 533
           STIASLLL +YN  SG+IL+DGQDI  L++KSLRR++G+VQQEPILMSGTIR+NITYG++
Sbjct: 514 STIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVS 573

Query: 534 EEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
            +PS EEIR VAK+CFCH FI+KFP+ Y+               QKQRIAIARAL+ KP 
Sbjct: 574 RQPSMEEIRSVAKKCFCHAFISKFPNGYE--TIIGPRGALLSGGQKQRIAIARALLNKPK 631

Query: 594 ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
           ILILDEATSALDVESEGAINYT G++MKSK +TI+SIAHRLSTIRR E+VIVLG DGSVV
Sbjct: 632 ILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVV 691

Query: 654 EMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEADNASEENG 713
           EMGKFK+LY N                 +  Q   PP            +E++  +EENG
Sbjct: 692 EMGKFKDLYANHDSALHKLLTEPSEQQHSQHQQYAPPAIT---------QESEPQTEENG 742

Query: 714 AKLDDSKEDVSVPDNMTSSDDSLKEAVNE 742
              DDS ED +      S D + K    E
Sbjct: 743 K--DDSGEDQNSDHEENSQDQNEKRLQEE 769

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/596 (56%), Positives = 435/596 (72%), Gaps = 14/596 (2%)

Query: 73  KTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNY 132
           ++ S ++G+ ++++ R                   TISCSIGMA+PK+IG +LD  +N  
Sbjct: 114 ESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAI 173

Query: 133 ------ENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRS 186
                 ++L  L  + +  + L  FL      L+   FANFGRVV+LRI+ E+LV+RLRS
Sbjct: 174 TSDEKPKDLRDLPPV-VWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRS 232

Query: 187 QVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLT 246
            V+K  IH+D EFFD  KVGDL+SR+ +DA+VVSRS+T  ++DG ++         +M  
Sbjct: 233 NVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFH 292

Query: 247 LSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVA 306
           +S  L  ALF   PP++   +++G++IR  S+ LQ  TG+LT+V EEQ +G++TVQ FVA
Sbjct: 293 ISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVA 352

Query: 307 ERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIG 366
           E+ EIKR+N+ +R++F VGK  A  N  FF+S S++GD  FLIVL YGS+LV+ GS+SIG
Sbjct: 353 EQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIG 412

Query: 367 DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNE 426
           DLTAFMLYTEY+G+A+FGLS+FYSELM+G GAASR+FE+ D +P I +T G   + P   
Sbjct: 413 DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKG-VPYVP--- 468

Query: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
            G  EI+F+NVSF YPTR  NQIF NLNF + +GSNVC+VGPSGRGKSTIASLLL +YN 
Sbjct: 469 -GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527

Query: 487 VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAK 546
            SG+I IDGQDI+ ++ KSLRR +G+VQQEPILMSG+IRDNITYG+   P+ +EIR V+K
Sbjct: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587

Query: 547 QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDV 606
           +CFCHNFITKF D Y+               QKQRIAIARALIKKPNILILDEATSALDV
Sbjct: 588 KCFCHNFITKFSDGYE--TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645

Query: 607 ESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
           ESEGAINYT GQ+MKS+ +TI+SIAHRLSTIRR E+VIVLG+DGSVVEMGKFKELY
Sbjct: 646 ESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/562 (57%), Positives = 423/562 (75%), Gaps = 12/562 (2%)

Query: 108 TISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIK-----ILNIPLSTFLMGVGITLIFG 162
           TIS ++GM IPK+IG +LD ++N     +    ++     I  + +  FL      L+FG
Sbjct: 131 TISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFG 190

Query: 163 CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRS 222
             ANFGR+V+LR++ E+LV+RLRS V+K IIH+D EFFD  KVGDL+SR+ +DA+VVSRS
Sbjct: 191 TIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRS 250

Query: 223 ITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQD 282
           +T  V+DG ++         +M+ +S  LT ALF   PP++    ++GK+IRM S++LQ+
Sbjct: 251 MTQNVSDGFKAIICGGVGIGMMINISASLTSALFLFAPPLLVGALIYGKKIRMISRELQE 310

Query: 283 VTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLI 342
            TG+LT+V+EEQ +G++T+Q FVAE  E+ R+NN +R++F  GK+ A  N  FF+S  ++
Sbjct: 311 STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGIL 370

Query: 343 GDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI 402
           GDL FLIVL YGS+LV+ G +S+GDLTAFMLYTEYTG+A+FGLS+FYSELM+G GAASR+
Sbjct: 371 GDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 430

Query: 403 FEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSN 462
           FE+ D   +IK ++G    KP     G EI+F++VSF YPTRP NQIF  LNF +  GSN
Sbjct: 431 FEMTDHTSQIKPSSG----KPYVPSWG-EIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSN 485

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSG 522
           VC+VGPSGRGKSTIASLLL +Y+  SG+I+IDGQ+I+ L+ KSLRR +G+VQQEP+LMSG
Sbjct: 486 VCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG 545

Query: 523 TIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRI 582
           +IR N+TYG+  E + +EIR VAK+CFCH FITKFP+ Y+               QKQRI
Sbjct: 546 SIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYE--TVIGPRGASLSGGQKQRI 603

Query: 583 AIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFED 642
           AIARALIKKP ILILDEATSALDVESEGAINYT G++M+S+ +TI+SIAHRLSTIRR E+
Sbjct: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSEN 663

Query: 643 VIVLGNDGSVVEMGKFKELYDN 664
           VIVLGNDGSVVEMGKFKELY N
Sbjct: 664 VIVLGNDGSVVEMGKFKELYAN 685

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/567 (56%), Positives = 420/567 (74%), Gaps = 17/567 (2%)

Query: 108 TISCSIGMAIPKIIGTILDTLRN---NYENLTSLSQIKILNIP-------LSTFLMGVGI 157
           TISCSIGMA+PK+IG +LD  ++     E   + + + +L++P       L   L     
Sbjct: 128 TISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAG 187

Query: 158 TLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAF 217
            L+ G  ANFGR+ +L+++ ERLV+RLR+QV+K  +H D EFFD  KVGDL+SR+G+DA+
Sbjct: 188 ALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAY 247

Query: 218 VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNS 277
           +VSRS+TH ++DGV++         +M  +S  LT A+    PP++   +++GK+IR  S
Sbjct: 248 IVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAIS 307

Query: 278 KKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFT 337
           ++LQ  TG+LTRV+EEQFNGI+T++ FVAE  E++R+N  +R +F V K     +  FF+
Sbjct: 308 RELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS 367

Query: 338 SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
             +++GD+ FL+VL YGS+LV+ G +S+G LTAFMLYTEYTG+++FGLS+FYSELM+G G
Sbjct: 368 GTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAG 427

Query: 398 AASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKV 457
           AASR+FE+ D +  + ST G+  F P +      IEFK+VSF YPTRPT+QIFK L   +
Sbjct: 428 AASRLFELTDYKKSVPSTVGQT-FVPRD----GRIEFKDVSFSYPTRPTSQIFKKLRLTI 482

Query: 458 PAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEP 517
             GSNVCIVGPSGRGKSTIASLLL  Y+A SG ILIDGQDI+ ++ KSLR+ +G+VQQEP
Sbjct: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542

Query: 518 ILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
           +LMSGTIRDNITYGL+  PS +EIR VAK+CFCHNFITKFPD YD               
Sbjct: 543 VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD--TVIGPRGALLSGG 600

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
           Q+QRIAIARALIKKP ILILDEATSALDVESEGAINYT G++M+SK +TIVSIAHRLSTI
Sbjct: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660

Query: 638 RRFEDVIVLGNDGSVVEMGKFKELYDN 664
           RR E+++VLGNDGSV+E GKF +LY +
Sbjct: 661 RRSENIVVLGNDGSVIEAGKFADLYRD 687

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/560 (58%), Positives = 417/560 (74%), Gaps = 12/560 (2%)

Query: 108 TISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKIL-----NIPLSTFLMGVGITLIFG 162
            IS  IGM+IPK+IG +LD ++N Y + T    +  L     ++ +  FL      L+ G
Sbjct: 164 AISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIG 223

Query: 163 CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRS 222
             ANFGR+V+LR++ E+LV+RLRS V++ IIH+D EFFD  KVGDL+SR+ +DA+VVSRS
Sbjct: 224 TVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRS 283

Query: 223 ITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQD 282
           +T  V+DG ++         +M+ +S  LT AL    PP++    ++GK+IRM S+ LQ+
Sbjct: 284 MTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIYGKRIRMISRDLQE 343

Query: 283 VTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLI 342
            TG+LTRV+EEQ +G++T+Q FVAE  E++R+N  +R++F  GK+ A  N  FF+S +++
Sbjct: 344 STGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVL 403

Query: 343 GDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI 402
           GDL FLIVL YGS+LV+ G +++GDLTAFMLYTEYTG+A+FGLS+FYSELM+G GAASR+
Sbjct: 404 GDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 463

Query: 403 FEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSN 462
           FE+ D  P IK T G+  + P    G  +I FK+VSF YPTRP NQIF  LNF +  GSN
Sbjct: 464 FEMTDHAPSIKPTAGKP-YVP----GSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSN 518

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSG 522
           VCIVGPSGRGKSTI SLLL +YN  SGQI ID QDI+ L+ KSLRR +G+VQQEP+LMSG
Sbjct: 519 VCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSG 578

Query: 523 TIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRI 582
           +I+ N+TYGL  E S +EIR VAK+CFCH F+TKFP+ YD               QKQRI
Sbjct: 579 SIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD--TIIGPRGASLSGGQKQRI 636

Query: 583 AIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFED 642
           AIARAL+KKP ILILDEATSALDVESEGAINYT G++MKSK +TI+SIAHRLSTIRR E+
Sbjct: 637 AIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSEN 696

Query: 643 VIVLGNDGSVVEMGKFKELY 662
           VIVLGNDGSVVE+GKFK+LY
Sbjct: 697 VIVLGNDGSVVEVGKFKDLY 716

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/607 (54%), Positives = 434/607 (71%), Gaps = 32/607 (5%)

Query: 83  WRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILD----TLRNNYE----N 134
           WR++ R                   ++SC+IGMA+PK+IG +LD    TL+++YE    +
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 135 LTSLSQIK--ILNIPLSTF-----LMG-------VGI---TLIFGCFANFGRVVILRIIS 177
           L  +++ K  ++  P+++      ++G       VGI    L+ G  ANFGRVV+L+II 
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 178 ERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXX 237
           ERLVSRLRSQV+K  +H D+EFFD  KVGDL+SR G+DA+VVSRS+T  V+DG ++    
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 238 XXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNG 297
                +M  +S  LT  +    PP++    ++GK+I   S++LQ  +G+LTRV EEQ NG
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 298 IRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357
           IRT++ FVAE+ EI+R+N+ +R++F VGK  AF N  FF+S +++GD+ F+IVL YG+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 358 VMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG 417
           V+ G++SIGDLTAFMLYTEYTG+++FGLS+FYSELM+G GAASR+FE+ D +  ++S   
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 418 EAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477
            A    L    G +IEF++VSF YPTRP+NQIFK+++F +  GSNVCIVGPSG+GKSTI 
Sbjct: 457 HA----LTPTQG-KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511

Query: 478 SLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
           SLLL  Y+   G ILID  DI+   TKSLRR +G+VQQEP LMSGTIRDNITYGL+  P+
Sbjct: 512 SLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPT 571

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
            +EIR+V+KQCFCH FITKFPD YD               Q+QRIAIARALIKKP ILIL
Sbjct: 572 MDEIRVVSKQCFCHGFITKFPDGYD--TVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629

Query: 598 DEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGK 657
           DEATSALDVESEGAINYT G +M+SK +TI+SIAHRLSTIRR E++IV+GNDGSVVE+GK
Sbjct: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689

Query: 658 FKELYDN 664
           F +LY N
Sbjct: 690 FDKLYRN 696

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  463 bits (1191), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 248/595 (41%), Positives = 362/595 (60%), Gaps = 17/595 (2%)

Query: 81  SSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNY------EN 134
           S ++D++R                    IS S+ M +P IIG +LD  +         ++
Sbjct: 92  SGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEEDS 151

Query: 135 LTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIH 194
            T +  I    +  + F   +G+  + G  AN GR++IL++  ERLV+RLR++ +K  + 
Sbjct: 152 KTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALD 211

Query: 195 KDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGA 254
           +D  F D  +VGDL+SR+ +DA +VS+++T  V+DG R+         +M  LS +LTG 
Sbjct: 212 QDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGV 271

Query: 255 LFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRF 314
           +  ++PP+     V+G++IR  SK+LQ+  G L++V EEQ N  +T+Q +V ER EI R+
Sbjct: 272 MMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRY 331

Query: 315 NNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLY 374
              +R +F++G + A  +G FF S  L+G++  + +L  G+ ++  G++++G+L++FM+Y
Sbjct: 332 ATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMY 391

Query: 375 TEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF 434
             YTG+++FGLSSFYSELM+G GAASR+FE+ND++P IKST G     P   + G  I+F
Sbjct: 392 AVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVG---IDP-KTLFGKSIKF 447

Query: 435 KNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           +NVSF YP+RP ++IF NLN ++  G +VCIVG SG GKSTIASLLL +Y+  +G I I 
Sbjct: 448 ENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIG 507

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYG----LTEEPSKEEIRLVAKQCFC 550
             DI   + +  RR IG VQQEP L +G+I DNI Y     LT E   E ++L  KQ  C
Sbjct: 508 DNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANC 567

Query: 551 HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
           + F+ KFPD                  QKQRIA+ARA +  P +LILDE+TSALD  SE 
Sbjct: 568 NIFLGKFPDGLQ--TLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEE 625

Query: 611 AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +  T  Q   ++ +T +SIAHRLSTI+    VIV+G  GSVVE G F  L DNP
Sbjct: 626 LVAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNP 679

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  461 bits (1186), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/605 (40%), Positives = 372/605 (61%), Gaps = 24/605 (3%)

Query: 76  STDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNYENL 135
           ST+ G  ++D+KR                    IS ++ M +P +IG +LD   N   + 
Sbjct: 88  STNTG--FKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDD 145

Query: 136 TSLSQIK-------------ILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVS 182
           T  ++ K             I     + F  G+GI  + G  AN GR+VIL++  E+LV+
Sbjct: 146 TGDAKSKEKVDNKEDRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVA 205

Query: 183 RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
           RLR++ +K  + +D  F D+ +VGDL+SR+ +DA +V++S+T  V+DG R+         
Sbjct: 206 RLRTRTMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFS 265

Query: 243 LMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQ 302
           +M  +S +LT  +  ++PP+     V+GK+IR  S++LQ   G LT+V EEQ N  +T+Q
Sbjct: 266 MMSYISFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQ 325

Query: 303 GFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGS 362
            +  E+ EI+R+ + +R++F VG + A  +G FF S  L+G+   L +L  G+ ++  GS
Sbjct: 326 AYGGEKKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGS 385

Query: 363 MSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFK 422
           +++GDL++FM+Y  YTG+++FGLSSFYSELM+G GAA+R+FE++D++P IK T G+    
Sbjct: 386 LTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGK---D 442

Query: 423 PLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH 482
           P+  + G  I F++VSF YPTRP +++F  ++FK+  G ++C VGPSG GKST++ LLL 
Sbjct: 443 PVT-LKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLR 501

Query: 483 HYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEE--PSKEE 540
           +Y+A  G ILI   +I +L+ +  R+ +G+VQQEP+L +GTI DNI Y + +E    K +
Sbjct: 502 YYDATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNK 561

Query: 541 IRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEA 600
           + L  K+  C  F+  FPD  +               QKQRIAIAR+ +  P+IL+LDEA
Sbjct: 562 VDLAIKKSNCTKFLANFPDGLN--TIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEA 619

Query: 601 TSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660
           TSALD +SE  I  T  +  +++ +T +SIAHRLSTI+    V+VL  +GSVVE GKF E
Sbjct: 620 TSALDTQSEDIIAMTLKK-REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTE 678

Query: 661 LYDNP 665
           L  NP
Sbjct: 679 LIANP 683

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  459 bits (1182), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 244/628 (38%), Positives = 370/628 (58%), Gaps = 22/628 (3%)

Query: 53  SRTNFIPRTLPQFLVPHRTLKTASTDNG-SSWRDLKRXXXXXXXXXXXXXXXXXXXTISC 111
           S  N +     +  +P +  K    ++G S ++D+KR                    IS 
Sbjct: 66  STVNAVAAQERELKIPPKIQKLTPDESGRSGFKDVKRLFELARPETFYISIALLLIFISS 125

Query: 112 SIGMAIPKIIGTILDTLR---NNYENLTSLSQI---------KILNIPLSTFLMGVGITL 159
           ++ M +P +IG +LD  +    + EN   +S+          KI  +    F   +G+  
Sbjct: 126 AVSMVVPSVIGKLLDIAKPPSADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVF 185

Query: 160 IFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVV 219
             G  AN GR++IL++  ERLV+RLR++ +K  + ++  F D+ KVGDL+SR+  DA +V
Sbjct: 186 TVGALANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIV 245

Query: 220 SRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKK 279
           ++S+T  V+DG R+         +M  +S +LT  +  ++PP+     ++G++IR  S++
Sbjct: 246 AKSVTQNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQ 305

Query: 280 LQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSA 339
           LQ   G LT+V EEQ N  RT+Q +  E+ EI R+   +R +F +G + A  +G FF S 
Sbjct: 306 LQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGST 365

Query: 340 SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAA 399
            L+G+   L +L  G+ ++  G++++G+L++FM+Y  YTG+++FGLS+FYSELM+G GAA
Sbjct: 366 GLVGNTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAA 425

Query: 400 SRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPA 459
           +R+FE++D++P IK T G+    P+   G   +EFKNVSF+YPTRP  QIF++ + K+  
Sbjct: 426 ARVFELSDRKPAIKPTIGK---DPITLFGKT-VEFKNVSFWYPTRPKQQIFQDFSIKIEP 481

Query: 460 GSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPIL 519
           G +VC VGPSG GKST++SLLL +Y+   G IL+ G+DI   + +  RR +G+VQQEP+L
Sbjct: 482 GEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPML 541

Query: 520 MSGTIRDNITYGLTEEPSKEEIRL--VAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
            +GTI +NI Y + EE + E  R+    +   C  F+  FPD  +               
Sbjct: 542 FNGTILENILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLN--TLVGPRGTQLSGG 599

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
           QKQRIA+AR  +  P+ILILDEATSALD +SE  I     Q    K  T +SIAHRLSTI
Sbjct: 600 QKQRIALARTFLLDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTI 658

Query: 638 RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           +    V+VLG +G VVE G F+EL  NP
Sbjct: 659 KHSSRVVVLGKNGCVVETGTFQELISNP 686

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  453 bits (1166), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 241/606 (39%), Positives = 360/606 (59%), Gaps = 10/606 (1%)

Query: 63  PQFLVPHRTLKTASTDN-GSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKII 121
           P      + L+ +  D+  S W+D+KR                    +S ++ MA+P +I
Sbjct: 62  PSLTATVKGLRLSPHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVI 121

Query: 122 GTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLV 181
           G +LD  R  +E   +  +  I  +  + F   +G   + G  AN GR+VIL++  ERLV
Sbjct: 122 GKLLDIAREEHEQPETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLV 181

Query: 182 SRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXX 241
           +RLR++ +K  + +D  F D  +VGDL+SR+ +DA +VS+S+T  ++DG R+        
Sbjct: 182 ARLRTRTMKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGF 241

Query: 242 XLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTV 301
            +M  +S +LT  +  + PP+     V+GK+IR  S++LQ   G+LT+V+EEQ +  +T+
Sbjct: 242 GMMSFISWKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTI 301

Query: 302 QGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHG 361
           Q +  E+ EI R+ + +R++F VG + A  +G FF     +G++  L +L  G+ ++  G
Sbjct: 302 QAYCGEKKEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTG 361

Query: 362 SMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKF 421
            M++GDL++FM+Y  YTG+++FGLSSFYSELM+G GAA+R+FE+ND++P I  T G+   
Sbjct: 362 LMTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPV 421

Query: 422 KPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL 481
              N+     I F +V F YPTRP + IF++LNF V  G +VCIVGPSG GKST+ASLLL
Sbjct: 422 TLENK----SIHFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLL 477

Query: 482 HHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEI 541
            +Y+  SG+I +   +I   N +  RR +G+VQQEP+L SGTI DNITY + +E   +E 
Sbjct: 478 RYYDIGSGEIKLGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDET 537

Query: 542 RL--VAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDE 599
           R+     Q  C  F+  FPD                  QKQRIA+ARA +  P+ILILDE
Sbjct: 538 RISRAIGQANCTKFLANFPDGLQ--TTVGPRGTQLSGGQKQRIALARAFLLDPSILILDE 595

Query: 600 ATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFK 659
           ATSALD +SE  +  +  Q   ++  T +SIAHR+STI+    VIVL   G+V E G F 
Sbjct: 596 ATSALDSQSEEVVAQSLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFD 654

Query: 660 ELYDNP 665
           +L   P
Sbjct: 655 KLIAIP 660

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  452 bits (1162), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 255/631 (40%), Positives = 374/631 (59%), Gaps = 23/631 (3%)

Query: 49  LTVPSRTNFIPRTL---------PQFLVPHRTLKTASTDNGSS-WRDLKRXXXXXXXXXX 98
           L +P R  F+ +++           F  P  TLK +  ++ SS ++D+KR          
Sbjct: 44  LIIPYRKQFLSQSIRLQSSVSEGKTFTKP--TLKLSDANSKSSGFKDIKRLFVLSKPESK 101

Query: 99  XXXXXXXXXTISCSIGMAIPKIIGTILD--TLRNNYENLTSLSQIKILNIPLSTFLMGVG 156
                     IS S+ MA+P +IG +LD  +   + E        K+  +    F   +G
Sbjct: 102 YIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEKEEKAKSNKLYGLTKRQFFTALG 161

Query: 157 ITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDA 216
           +  I G  AN  R++IL++  ERLV+RLR++ +K  + +D  F DT +VGDL+SR+ +DA
Sbjct: 162 LVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDA 221

Query: 217 FVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMN 276
            +V++S+T  V+DG R+         +M  LS +LT  +  + PP+     ++G++IR  
Sbjct: 222 SIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNL 281

Query: 277 SKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFF 336
           S++LQ   G LT+V EEQ N  RT+Q +  E+NE++R+   +R +F +G + A  +G FF
Sbjct: 282 SRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFF 341

Query: 337 TSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGV 396
            S  L+G+   L +L  G+ ++  GSM++G+L++FM+Y  YTG+++FGLSSFYSELM+G 
Sbjct: 342 GSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGA 401

Query: 397 GAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFK 456
           GAA+R+FE+ND++P I+ T G+    P++ +    I FKNVSF YPTRP +QIFK+LN  
Sbjct: 402 GAAARVFELNDRKPLIRPTIGK---DPVS-LAQKPIVFKNVSFTYPTRPKHQIFKDLNIT 457

Query: 457 VPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQE 516
           +  G +VC VGPSG GKSTIASLLL +Y+  SG I    +DI + N +  RR IG VQQE
Sbjct: 458 INPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQE 517

Query: 517 PILMSGTIRDNITYGLTEEPSKEEIRL--VAKQCFCHNFITKFPDTYDXXXXXXXXXXXX 574
           P+L +GTI DNI Y +  E +++E R+     Q  C  F+  FPD               
Sbjct: 518 PLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQ--TTVGARGAQL 575

Query: 575 XXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRL 634
              QKQRIA+ARA +  P +LILDEATSALD +SE  +     Q    + +T +SIAHRL
Sbjct: 576 SGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRVERGLTTISIAHRL 634

Query: 635 STIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           STI+    V+VLG  GSVVE G F++L   P
Sbjct: 635 STIKHSTRVVVLGKHGSVVETGSFQDLIAIP 665

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  452 bits (1162), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 255/628 (40%), Positives = 373/628 (59%), Gaps = 18/628 (2%)

Query: 49  LTVPSRTNFIPRT--LPQFLVPHR-----TLKTASTDNGSS-WRDLKRXXXXXXXXXXXX 100
           L +P R +F+ R+  L   +   +     TLK ++ ++ SS ++D+KR            
Sbjct: 44  LIIPHRKHFLLRSIRLQSDIAQGKKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYI 103

Query: 101 XXXXXXXTISCSIGMAIPKIIGTILD-TLRNNYENLTSLSQIKILNIPLSTFLMGVGITL 159
                   IS S+ MA+P +IG +LD    ++ E+       K+       F   +G   
Sbjct: 104 GLALLLILISSSVSMAVPSVIGKLLDLASESDGEDEEGSKSNKLYGFTKKQFFTALGAVF 163

Query: 160 IFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVV 219
           I G  AN  R++IL++  ERLV+RLR++ +K  + +D  F DT +VGDL+SR+ +DA +V
Sbjct: 164 IIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIV 223

Query: 220 SRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKK 279
           ++S+T  V+DG R+         +M  LS +LT  +  + PP+     ++G++IR  S++
Sbjct: 224 AKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQ 283

Query: 280 LQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSA 339
           LQ   G LT+V EEQ N  RT+Q +  E+NE++R+   +R +F +G + A  +G FF S 
Sbjct: 284 LQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGST 343

Query: 340 SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAA 399
            L+G+   L +L  G+ ++  GSM++G+L++FM+Y  YTG+++FGLSSFYSELM+G GAA
Sbjct: 344 GLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAA 403

Query: 400 SRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPA 459
           +R+FE+ND++P I+ T G+    P++ +    I FKNVSF YPTRP +QIFK+LN  +  
Sbjct: 404 ARVFELNDRKPLIRPTIGK---DPVS-LAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKP 459

Query: 460 GSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPIL 519
           G +VC VGPSG GKSTIASLLL +Y+  SG I    +DI   N +  RR IG VQQEP+L
Sbjct: 460 GEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLL 519

Query: 520 MSGTIRDNITYGLTEEPSKEE--IRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
            +GTI DNI Y +  E ++++  IR    +  C  F+  FPD                  
Sbjct: 520 FNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQ--TMVGARGAQLSGG 577

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
           QKQRIA+ARA +  P +LILDEATSALD +SE  +     Q    +  T +SIAHRLSTI
Sbjct: 578 QKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRVERGFTTISIAHRLSTI 636

Query: 638 RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           +    VIVLG  GSVVE G F++L   P
Sbjct: 637 KHSTRVIVLGKHGSVVETGSFRDLIAIP 664

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  451 bits (1161), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 249/600 (41%), Positives = 359/600 (59%), Gaps = 12/600 (2%)

Query: 71  TLKTASTDNGSS-WRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLR 129
           TLK +  ++ SS ++D+KR                    IS S+ MA+P +IG +LD   
Sbjct: 73  TLKLSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVAS 132

Query: 130 NNYENLTSLS--QIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQ 187
            + +          K+  +    F   +G+  + G  AN  R++IL+I  ERLV+RLR++
Sbjct: 133 ESDDEEDEEKARDSKLYGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTR 192

Query: 188 VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            +K  + +D  F DT +VGDL+SR+ +DA +V++S+T  V+DG R+         +M  L
Sbjct: 193 TMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL 252

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S +LT  +  + PP+     V+GK+IR  S++LQ   G LT+V EEQ N  RT+Q +  E
Sbjct: 253 SWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGE 312

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367
           +NE+ R+   +R +F +G + A  +G FF S  L+G+   L +L  G+ ++  G M+IG+
Sbjct: 313 KNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGE 372

Query: 368 LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427
           L++FM+Y  YTG+++FGLSSFYSELM+G GAA+R+FE+ND++P I  T G+    P++ +
Sbjct: 373 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGK---DPIS-L 428

Query: 428 GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487
               + FKNVSF YPTRP +QIFK+LN  +  G +VC VGPSG GKSTIASLLL +Y+  
Sbjct: 429 AHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVN 488

Query: 488 SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVA-- 545
           SG I  D +D+   N +  RR IG VQQEP+L +GTI DNI Y +  E ++ E R+    
Sbjct: 489 SGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAI 548

Query: 546 KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD 605
           +Q  C  F+  FPD                  QKQRIA+ARA +  P +LILDEATSALD
Sbjct: 549 EQANCTKFLANFPDGLQ--TMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALD 606

Query: 606 VESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +SE  +     Q    + +T +SIAHRLSTI+    +IVLG  GSVVE G F++L   P
Sbjct: 607 SQSEEIVAKNL-QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIP 665

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  447 bits (1151), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 242/597 (40%), Positives = 360/597 (60%), Gaps = 18/597 (3%)

Query: 76  STDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNYENL 135
           S  NG   +D+KR                    IS S+ M IP IIG +LD  + + ++ 
Sbjct: 88  SKSNG--MKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDE 145

Query: 136 TSLSQIK-----ILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVK 190
              +  K     I  +    F   +G   + G  AN  R+VIL++  ERLV+RLR++ +K
Sbjct: 146 DGDNNAKKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMK 205

Query: 191 NIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRE 250
             +++D  F DT +VGDL+SR+ +DA +V++++T  V+DG R+         +M  +S +
Sbjct: 206 AALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWK 265

Query: 251 LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNE 310
           LT  +  ++PP+     V+G++IR  S++LQ   G LT+V EEQ N  RT+Q +  E  E
Sbjct: 266 LTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALE 325

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTA 370
           I R+   +R++F VG + A  +G FF S  L+G++  + +L  G+ ++ +G++++GDL++
Sbjct: 326 IHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSS 385

Query: 371 FMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGC 430
           FM+Y  YTG+++FGLS FYSELM+G GAA+R+FE+ND++P IK T G   + P   + G 
Sbjct: 386 FMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIG---YDP-KSLLGK 441

Query: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
            IEF+NVSF YPTRPT+ I  NL+  +  G +VCIVGPSG GKST++SLLL +Y+  +G 
Sbjct: 442 SIEFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGS 501

Query: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGL----TEEPSKEEIRLVAK 546
           I IDGQ+I   N +  RR +G+VQQEP+L +GTI DNI Y +    T   +  +++   +
Sbjct: 502 IKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALE 561

Query: 547 QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDV 606
           Q  C  F+  FP+  +               QKQRIA+ARA +  P +LILDEATSALD 
Sbjct: 562 QANCTKFLKNFPEGVN--TLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDS 619

Query: 607 ESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
           +SE  +     + ++   +T +SIAHRLSTI+    VIVL   GSVVE G F+EL D
Sbjct: 620 QSEEIVAKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVD 675

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  446 bits (1147), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/619 (39%), Positives = 363/619 (58%), Gaps = 33/619 (5%)

Query: 70  RTLKTASTDN-GSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTL 128
           +TLK +  D+  S ++D+KR                    IS ++ M IP +IG +LD  
Sbjct: 88  KTLKLSPHDSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAA 147

Query: 129 RNNY-----------------ENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVV 171
           +  +                 +N    S   I  +    F   +G   + G FAN GR+V
Sbjct: 148 KEGHLAGVSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIV 207

Query: 172 ILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGV 231
           +L++  E+LV+RLR++ +K  + +D  F D  +VGDL+SR+ +DA +VS+S+T  ++DG 
Sbjct: 208 LLKVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGA 267

Query: 232 RSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVT 291
           R+         +M  +S +LT  +  + PP+     V+GK+IR  S++LQ   G LT+V 
Sbjct: 268 RAVIQGAVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVA 327

Query: 292 EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVL 351
           EEQ +  RTVQ +  E+ EI+R+   +R +F +G + A  +G FF     +G++  L +L
Sbjct: 328 EEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALL 387

Query: 352 TYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPK 411
             G+ ++  G++++GDL++FM+Y  YTG+++FGLSSFYSELM+G GAA+R+FE+ND++P 
Sbjct: 388 LTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPL 447

Query: 412 IKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGR 471
           I  T G     P+  + G  IEF+NV+F YPTR  N+IF  L+  +  G +VCIVGPSG 
Sbjct: 448 IHPTKG---VDPVT-LQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGG 503

Query: 472 GKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYG 531
           GKSTIASLLL +Y+  +G+I I GQDI   N +  RR +G+VQQEP+L +GTI DNITY 
Sbjct: 504 GKSTIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYA 563

Query: 532 LTEEPSKEEIRL--VAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
           +  E + ++ R+     Q  C  F+  FPD  +               QKQRIA+ARA +
Sbjct: 564 VPGELAGDDSRVSRAIGQANCTKFLANFPDGLE--TLVGPRGAQMSGGQKQRIALARAFL 621

Query: 590 KKPNILILDEATSALDVESEGAINYTFGQIMKSKSM---TIVSIAHRLSTIRRFEDVIVL 646
             P +LILDEATSALD +SE  +     Q ++S+S    T VSIAHRLSTI+    VIVL
Sbjct: 622 LDPAVLILDEATSALDSQSEEVV----AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIVL 677

Query: 647 GNDGSVVEMGKFKELYDNP 665
              G V E G F+EL  +P
Sbjct: 678 DRHGGVGETGSFRELISDP 696

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  445 bits (1145), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/600 (41%), Positives = 364/600 (60%), Gaps = 12/600 (2%)

Query: 71  TLKTASTDNGSS-WRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLR 129
           TLK +  D+ SS ++D+KR                    IS S+ MA+P +IG +LD   
Sbjct: 72  TLKLSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLAS 131

Query: 130 NNYENLTSLSQI--KILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQ 187
           ++ +   +      K+  +    F   +G   + G  AN  R++IL++  ERLV+RLR++
Sbjct: 132 DDDDEEDAKETKDNKLYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTR 191

Query: 188 VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            +K  + +D  F DT +VGDL+SR+ +DA +V++S+T  V+DG R+         +M  L
Sbjct: 192 TMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL 251

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S +LT  +  + PP+     ++G++IR  S++LQ   G LT+V EEQ N  RT+Q +  E
Sbjct: 252 SWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGE 311

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367
           +NE++R+   +R +F VG + A  +G FF S  L+G+   L +L  G+ ++  G+M++G+
Sbjct: 312 KNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGE 371

Query: 368 LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427
           LT+FM+Y  YTG+++FGLSSFYSELM+G GAA+R+FE+ND++P I+ T G+    P++ +
Sbjct: 372 LTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGK---DPVS-L 427

Query: 428 GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487
               I FK+VSF YPTRP +QIFK+LN  +  G +VC VGPSG GKSTIASLLL +Y+  
Sbjct: 428 AHKPIVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTS 487

Query: 488 SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAK- 546
           +G I    +DI   N +  RR +G VQQEP+L +GTI DNI Y +  E +++E R+    
Sbjct: 488 AGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVARAI 547

Query: 547 -QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD 605
            Q  C  F+  FPD                  QKQRIA+ARA +  P +LILDEATSALD
Sbjct: 548 GQANCTKFLANFPDGLQ--TMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALD 605

Query: 606 VESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +SE  +     + +K + +T +SIAHRLSTI+    VIVLG  GSVVE G F++L   P
Sbjct: 606 SQSEEVVAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIP 664

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  443 bits (1140), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 238/592 (40%), Positives = 352/592 (59%), Gaps = 12/592 (2%)

Query: 79  NGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNYENLTSL 138
           NGS ++D+KR                    IS ++ M IP I+G +LD  ++  +   + 
Sbjct: 86  NGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDRKDADDTT 145

Query: 139 SQI---KILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHK 195
                 KI  +    F   +    + G  AN GR+VIL+I  ERLV+RLR++ +K  + +
Sbjct: 146 EDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAALDQ 205

Query: 196 DLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGAL 255
           D  F DT +VGDL+S + +DA +V++S+T  V+DG R+         +M  +S +LT  +
Sbjct: 206 DATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVM 265

Query: 256 FAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFN 315
             ++PP+     V+G++IR  S++LQ   G LT+V+EEQ   ++T+Q +V E+ EI R+ 
Sbjct: 266 ILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYA 325

Query: 316 NVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYT 375
             +R +F +G + A  +G FF S  L+G++  L +L  G+ ++ +G +++GDL++FM+Y 
Sbjct: 326 TEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYA 385

Query: 376 EYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK 435
            YTG+++FGLSSFYSELM+G GAA+R+FE+ D++P I  T G+      N+     I F+
Sbjct: 386 VYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKT----IRFE 441

Query: 436 NVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG 495
           NVSF YPTR   +IF  L+  V  G +VCIVGPSG GKST+ASLLL +Y+   G+I+I  
Sbjct: 442 NVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGD 501

Query: 496 QDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE--IRLVAKQCFCHNF 553
            +I + N +  RR +GIVQQEP L +GTI DNI Y +  E +  +  I     Q  C  F
Sbjct: 502 HNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANCSKF 561

Query: 554 ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 613
           +  FPD                  QKQRIA+ARA +  P++LILDEATSALD +SE  + 
Sbjct: 562 LANFPDGLQ--TLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVA 619

Query: 614 YTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            T  ++   + +T +SIAHRLSTI+    V+VLG  G VVE G F+EL  NP
Sbjct: 620 QTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNP 670

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  442 bits (1137), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 238/561 (42%), Positives = 342/561 (60%), Gaps = 11/561 (1%)

Query: 109 ISCSIGMAIPKIIGTILDTLRNNYE--NLTSLSQIKILNIPLSTFLMGVGITLIFGCFAN 166
           IS ++ M IP +IG +LD  +      +     + +I  +    F   +G   + G  AN
Sbjct: 106 ISGAVSMTIPSVIGKLLDISKEKEAGGDGDEEQETRIYGLTEKQFYTALGGVFVIGACAN 165

Query: 167 FGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHK 226
            GR+VIL++  E+LV+RLR++ +K  + +D  F D  +VGDL+SR+ +DA +VS+SIT  
Sbjct: 166 VGRIVILKVTGEKLVARLRTKTMKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQN 225

Query: 227 VADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD 286
            +DG R+         +M  +S +LTG +  + PP++    V+G++IR  +++LQ   G 
Sbjct: 226 TSDGARAVIQGMVGFGMMGYISAQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGG 285

Query: 287 LTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLG 346
           LT+V EEQ N  RT+Q +  ER EI+R+   +R +F+VG   A  +G FF +  L+G++ 
Sbjct: 286 LTKVAEEQLNATRTIQSYCGERKEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMA 345

Query: 347 FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN 406
            L +L  G+ ++  G++++G+L++FM+Y  YTG+++FGLSSFYSELM+G GAASR+FE+N
Sbjct: 346 LLALLLTGTSMIRSGAITVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELN 405

Query: 407 DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466
           D+ P I  T G+    P++ +   EIEFKNV F YP+R  + +F  LN K+  G +VC+V
Sbjct: 406 DRVPLIHPTKGK---DPIS-LAAKEIEFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVV 461

Query: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
           GPSG GKSTI+SLLL  Y+  SG I I GQ+I   N +  RR +GIVQQEP+L +G+I+D
Sbjct: 462 GPSGGGKSTISSLLLRFYDVDSGVITIGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKD 521

Query: 527 NITYGLTEE--PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
           NI Y L       K  +    +   C  FI+ FPD  D               QKQRIAI
Sbjct: 522 NICYALPPHIISDKHRVNRALEAANCTRFISNFPDGLD--TMVGPRGTQLSGGQKQRIAI 579

Query: 585 ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVI 644
           ARA I  P+ILILDEATSALD +SE  I        +S  +TI SIAHR+STI     VI
Sbjct: 580 ARAFILDPSILILDEATSALDSQSEDIIAQALRARSESGKITI-SIAHRISTIEHSNRVI 638

Query: 645 VLGNDGSVVEMGKFKELYDNP 665
           VL  +G V E G F +L + P
Sbjct: 639 VLSRNGGVSETGAFCDLINQP 659

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  436 bits (1120), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/603 (39%), Positives = 355/603 (58%), Gaps = 12/603 (1%)

Query: 68  PH--RTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTIL 125
           PH  R   + +T N S  +D++R                    IS ++ M IP +IG +L
Sbjct: 65  PHQERLELSTATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLL 124

Query: 126 DTLRNNYENLTSLSQIKIL-NIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRL 184
           D  R + E  +   +  +L  +P   F + +      G  AN GR+V+L+   ERLV+RL
Sbjct: 125 DVAREDVEQESGDEEEAVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARL 184

Query: 185 RSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM 244
           R++ +K  + ++  F D+ +VGDL+SR+ +DA +VS+SIT   +DG R+         +M
Sbjct: 185 RTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMM 244

Query: 245 LTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGF 304
             +S +LT  +  + PP++   + +G+++R  S++LQ   G LT+V EEQ N  RTVQ +
Sbjct: 245 SYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAY 304

Query: 305 VAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMS 364
             ER EI+R+   +R +F VG + A I+G FF +   +G+   L +L  G+ ++  G +S
Sbjct: 305 CGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGIS 364

Query: 365 IGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL 424
           +G+L++FM+Y  YTG+++F LSSFYSELM+G GAA R+FE+ND++P I  T G+    P+
Sbjct: 365 VGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGK---DPV 421

Query: 425 NEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
           + + G  I F +V+F YPTRP +Q+F  ++  +  G +VCIVGPSG GKST+ASLLL  Y
Sbjct: 422 S-LTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFY 480

Query: 485 NAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRL- 543
           + +SG I I G+DI   N    RR +GIVQQEP+L + +I +NITY L    +K+  R+ 
Sbjct: 481 DPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARID 540

Query: 544 -VAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATS 602
              +   C  F+  FP+                  QKQR+A+ARA ++ P ILILDEATS
Sbjct: 541 RALRLSNCSAFVGSFPEGLQ--TAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATS 598

Query: 603 ALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
           ALD +SE  +  T  Q  +   +TI SIAHR STI+    VIVL   G V+E G +++L 
Sbjct: 599 ALDSKSEDIVASTLLQRCQEAKITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLI 657

Query: 663 DNP 665
            +P
Sbjct: 658 GDP 660

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  435 bits (1119), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 243/611 (39%), Positives = 360/611 (58%), Gaps = 21/611 (3%)

Query: 68  PHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDT 127
           P  TL T    N SSW+D+KR                    IS S+ M +P +IG ++D 
Sbjct: 70  PSSTL-TPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDA 128

Query: 128 LRNN------YENLTSLSQI-----KILNIPLSTFLMGVGITLIFGCFANFGRVVILRII 176
            +++       EN +  +       +I  + +  F   +    + G  AN GR+VIL++ 
Sbjct: 129 AKDDQQASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVT 188

Query: 177 SERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXX 236
            E+LV+RLR++ +K  + +D  F D  KVGDL+SR+ +DA +VS+S+T  ++DG RS   
Sbjct: 189 GEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQ 248

Query: 237 XXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFN 296
                 +M  +S +LT  +  + PP+     ++GK+IR  S+ LQ   G LT+  EEQ +
Sbjct: 249 GFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLS 308

Query: 297 GIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSY 356
             RT+Q +  E++ I ++   +R+++QVG + A  +G FF    L+G++  L +L  G+ 
Sbjct: 309 ATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTS 368

Query: 357 LVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTT 416
           ++  G+M++GDL++FM+Y  YTG+++FG+SSFYSELM+G GAA+R+FE+ND+ P I  T 
Sbjct: 369 MIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTR 428

Query: 417 GEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTI 476
           G     P++ + G  +EF+NV F YPTR  + IF+NL F++ AG +VCIVGPSG GKST+
Sbjct: 429 G---IDPVS-LAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTV 484

Query: 477 ASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP 536
           ASLLL  Y+  +G I I GQ IA+ N +  RR +G+VQQEP+L +GTI DNI Y + +  
Sbjct: 485 ASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSL 544

Query: 537 SKEEIRLVAK--QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNI 594
             +E R+     Q  C  F++ FPD                  QKQRIA+ARA +  P++
Sbjct: 545 LNDENRVARAIGQANCSAFLSSFPDGLQ--TLVGPRGTQLSGGQKQRIALARAFLLDPDL 602

Query: 595 LILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
           LILDEATSALD  SE  +         ++  T +SIAHR+STI+    VIVLG  G VVE
Sbjct: 603 LILDEATSALDSRSEEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVE 661

Query: 655 MGKFKELYDNP 665
            G F EL  +P
Sbjct: 662 TGTFDELISDP 672

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  435 bits (1119), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 233/607 (38%), Positives = 356/607 (58%), Gaps = 22/607 (3%)

Query: 74  TASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDTLRNNY- 132
           +++  N S +RD+ R                    IS ++ M +P +IG +LD  +++  
Sbjct: 81  SSNEKNSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSP 140

Query: 133 -ENLTSLSQIK-----------ILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERL 180
            EN    S              I       F + +G   + G FAN GR++IL++  ERL
Sbjct: 141 SENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERL 200

Query: 181 VSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXX 240
           V+RLR++ +K  + +D  F D  +VGDL+SR+ +D+ +V++S+T  V+DG R+       
Sbjct: 201 VARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVG 260

Query: 241 XXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRT 300
             +M  +S +LT  +  +LPPI     ++GK+IR  SK+LQ   G LT+V EEQ    +T
Sbjct: 261 FGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKT 320

Query: 301 VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH 360
           +Q +V E+ EI+R+   +R++F +G + A  +G FF S   +G++  L +L  G+ ++  
Sbjct: 321 IQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQS 380

Query: 361 GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAK 420
           G +++GDL++FM+Y  YTG ++FGLS+FYSELM+G GAA+R+FE+ND++P I  T G+  
Sbjct: 381 GLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGP 440

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
                 +    I FK+VSF YPTR   +IF +LN  +  G ++CI GPSG GKSTIASLL
Sbjct: 441 ----TSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLL 496

Query: 481 LHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE 540
           + +Y+   G I I   D+ T N +  RR IG+V QEP+L +GTI +NI Y +    +++E
Sbjct: 497 VRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDE 556

Query: 541 IRLVAK--QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILD 598
            R+ A   +  C  F++ FPD  +               QKQR+A+ARA +  P +L+LD
Sbjct: 557 RRVSAAIGKANCSKFLSNFPDGLE--TLVGPRGAQLSGGQKQRVALARAFLLDPALLVLD 614

Query: 599 EATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKF 658
           EATSALD +SE  +  T  + ++ + +T +SIAHR+STI     V+VLG DG VVE G F
Sbjct: 615 EATSALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPF 673

Query: 659 KELYDNP 665
           +EL D P
Sbjct: 674 QELIDRP 680

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  429 bits (1103), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 248/623 (39%), Positives = 361/623 (57%), Gaps = 37/623 (5%)

Query: 68  PHRTLKTASTDNGSSWRDLKRXXXXXXXXXXXXXXXXXXXTISCSIGMAIPKIIGTILDT 127
           P  TL T+   N SSW+D+KR                    +S S+ M +P +IG ++D 
Sbjct: 70  PSTTL-TSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDV 128

Query: 128 LRNNYENLTSLSQIK-----------------------ILNIPLSTFLMGVGITLIFGCF 164
            +   E+ TS S+                         IL + L  F  G+    + G  
Sbjct: 129 AK---EDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAA 185

Query: 165 ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSIT 224
           AN GR+VIL++  E+LV+RLR++ +K  + +D  F D  KVGDL+SR+ +DA +VS+S+T
Sbjct: 186 ANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLT 245

Query: 225 HKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT 284
             ++DG RS         +M  +S +LT  +  + PP+     V+G++IR  S+ LQ   
Sbjct: 246 QNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASV 305

Query: 285 GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGD 344
           G LT+  EEQ +  RT+Q +  E+  I+ +   +R+++QVG + A  +G FF    L+G+
Sbjct: 306 GGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGN 365

Query: 345 LGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE 404
              L +L  G+ ++  G+M++GDL++FM+Y  YTG+++FG+SSFYSELM+G GAA+R+FE
Sbjct: 366 SAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFE 425

Query: 405 INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464
           +ND++P I  T G     P++ +    +EFK V F YPTR  + IF++L+ ++  G +VC
Sbjct: 426 LNDRKPAIHPTKGR---DPVS-LARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVC 481

Query: 465 IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
           IVGPSG GKST+ASLLL  Y+  +G ILI GQ+IA  N +  RR +GIVQQEP+L +GTI
Sbjct: 482 IVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTI 541

Query: 525 RDNITYGLTEEPSKEEIRLVAK---QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQR 581
            +NI Y + +    EE   VA+   Q  C  F++ FPD                  QKQR
Sbjct: 542 LENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQ--TMVGPRGTQLSGGQKQR 599

Query: 582 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFE 641
           IA+ARA +  P++LILDEATSALD  SE  I  T      ++  T +SIAHR+STI+   
Sbjct: 600 IALARAFLLDPDLLILDEATSALDSRSEEVIARTL-HSRTTRGKTTISIAHRVSTIQHST 658

Query: 642 DVIVLGNDGSVVEMGKFKELYDN 664
            VIVLG +G VVE G F EL  N
Sbjct: 659 RVIVLGRNGGVVETGTFDELASN 681

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  418 bits (1075), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/578 (39%), Positives = 349/578 (60%), Gaps = 36/578 (6%)

Query: 109 ISCSIGMAIPKIIGTILDT------LRNNYENLTS-------------LSQIKILNIPLS 149
           I+ ++ M +P +IG +LD         N  EN  S               Q  I      
Sbjct: 122 ITSAVSMLVPSVIGKLLDISTGIEFASNKDENDESSKEDKNENENENENKQTLIYGYTPL 181

Query: 150 TFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLM 209
            F  G+G+  + G  AN GR++IL++  ER+V+RLR++ +KNI+ +D +F D+ KVGDL+
Sbjct: 182 VFFSGLGVIFVVGAIANTGRIIILKLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLI 241

Query: 210 SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
           SR+ +D+ +VS ++T  V+DG R+         +M  +S +L+G +  ++PPI     ++
Sbjct: 242 SRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIY 301

Query: 270 GKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESA 329
           G++IR  SKKLQ+  G LT+++EEQ NG RT+Q +V E+ EI ++   +R+++ VG   A
Sbjct: 302 GRKIRNISKKLQESVGSLTKISEEQLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEA 361

Query: 330 FINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFY 389
             +G FF    LIG+   L +L  G  ++ +G++SIG L++FM+Y  YTG+++FGLSSFY
Sbjct: 362 VASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFY 421

Query: 390 SELMQGVGAASRIFEINDKEPKIKSTTG----EAKFKPLNEVGGCEIEFKNVSFFYPTRP 445
           SE+M+G GAASRIFEIN   P I +T G      + KP        IEF+++ F YPTR 
Sbjct: 422 SEIMKGSGAASRIFEINKYVPDINATKGIDPISFQDKP--------IEFEHIKFAYPTRS 473

Query: 446 TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKS 505
            + IF++LN K+  G +VCI+GPSG GKSTI+SLLL +Y+ ++G I I G+DI   + + 
Sbjct: 474 GHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYDPLAGTISIGGKDIKEYSLRK 533

Query: 506 LRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRL--VAKQCFCHNFITKFPDTYDX 563
            R+ +G+V QEP+L +GTI +NI Y + EE + ++ RL    +   C+ F+   P   + 
Sbjct: 534 YRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSNAIESSNCNKFLNTLPLGLE- 592

Query: 564 XXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK 623
                         QKQR+A+ARA + +P +L+LDEATSALD  SE  +  T  Q   +K
Sbjct: 593 -TPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALDPRSESIVAQTLKQ-RCAK 650

Query: 624 SMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             T +SIAHR+STI+    V+VL   G VVE G ++EL
Sbjct: 651 GFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEEL 688

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  404 bits (1037), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 219/553 (39%), Positives = 333/553 (60%), Gaps = 21/553 (3%)

Query: 109 ISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFG 168
           +S ++ M++P +IGT++D          S     I  +  + FL+ +G   + G  AN G
Sbjct: 57  VSSAVSMSLPSVIGTLIDH--------ASTPDAPIYGLTRNQFLLALGSVFVVGAIANSG 108

Query: 169 RVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVA 228
           R++IL+I  E+LV+RLR++ +K+++ +D  F D  +VGDL+SR+ +DA +VS+S+T  ++
Sbjct: 109 RIIILKITGEKLVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLS 168

Query: 229 DGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLT 288
           DG R+         +M  +S +LT  +  ++PP+     ++G +I+  S++LQD  G L+
Sbjct: 169 DGCRATLQGVVGIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLS 228

Query: 289 RVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFL 348
           + +EEQ N ++TVQ +  ER E++R++N +R +F +G + A  +  FF S  LIG++  +
Sbjct: 229 KTSEEQLNSLKTVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMI 288

Query: 349 IVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDK 408
            +L  G+      S+++G+L++FM+Y  YTG+++FGL+ FYSELM+G GAA R+ E+ + 
Sbjct: 289 GLLLVGT---ADSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNM 345

Query: 409 EPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGP 468
           + KI  T G     P   + G  I F NVSF Y    +  +   +NF++  G +VC VG 
Sbjct: 346 KTKISPTKG---ISPPKTLKGLPITFNNVSFAYSNGKS--VLSEMNFQIHPGEHVCFVGG 400

Query: 469 SGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI 528
           SG GKSTI+SLLL +Y   SG I I   DI+  N +  RR +G+VQQEP+L +GTI DNI
Sbjct: 401 SGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNI 460

Query: 529 TYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARAL 588
           TYGL  + S  ++ +  K   C  FI +     D               Q+QRIA+AR  
Sbjct: 461 TYGL-HDKSLTDLNMALKAANCDQFIKESHMGLD--TLVGPRGAQLSGGQRQRIALARVF 517

Query: 589 IKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGN 648
           ++ P+ILILDEATSALD +SE  IN    Q  +   MT +SIAHRLSTIR    VIV+  
Sbjct: 518 LQNPDILILDEATSALDTKSEDIINKEL-QRRQEAGMTTISIAHRLSTIRHSSRVIVI-E 575

Query: 649 DGSVVEMGKFKEL 661
           DG VVE G F +L
Sbjct: 576 DGRVVESGSFDQL 588

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  186 bits (472), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 155/529 (29%), Positives = 256/529 (48%), Gaps = 31/529 (5%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLM 209
            L+ +G+    G F NF +  +L   SE  V  LR++V++ +  K++++F  +  K  ++ 
Sbjct: 764  LLVLGVAAADGIF-NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEIS 822

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLS-RELTGALFAILPPIIWCTSV 268
            + V ND   + RS+  +    + S         +   +S  +L+    ++ P II  +++
Sbjct: 823  ALVLNDLRDL-RSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAI 881

Query: 269  FGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKES 328
            +G  ++      +     L     +    I+T++   AE +    ++++  ++ Q+  + 
Sbjct: 882  YGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKR 941

Query: 329  AFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSF 388
            A   G   +  ++I      I+  YG  LVM    +  ++        +T  +   L S 
Sbjct: 942  AIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQ 1001

Query: 389  YSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVG-------GCE----IEFKNV 437
              ++ +G  AAS I+ I D+    K  T E +      VG       G E    +  +N+
Sbjct: 1002 IPDISRGQRAASWIYRILDE----KHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNL 1057

Query: 438  SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497
            +F YP+ PT  ++KN+NF +  G  + I+G SG GKST+  LL   YN   G+I IDG D
Sbjct: 1058 TFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTD 1117

Query: 498  IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557
            +   N  SLR++I +V+Q+P+L +GTIRDN+TYGL +E  + E+    K    H+F+   
Sbjct: 1118 VNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISS 1177

Query: 558  PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617
            P   D               Q QR+ IARAL++K  ILILDE TSALD  S   IN    
Sbjct: 1178 PQGLD----TRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN---- 1229

Query: 618  QIMKSK--SMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            +I+K    ++  + I H    +R    + VL  DG VVE G F  LY+N
Sbjct: 1230 EIVKKGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  150 bits (380), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 141/512 (27%), Positives = 228/512 (44%), Gaps = 38/512 (7%)

Query: 176 ISERLVSRLRSQVVKNIIH-KDLEFFDTFK--VGDLMSRVGNDAFVVSRSITHKVADGVR 232
           I ER   R+RSQ+++  +  K +E++D  +  +GD  +++      +  S     A   +
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 233 SXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTE 292
           +              S  LT  +    P I +   VF + I + S+K    T    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 293 EQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV-- 350
              N  + V+ +  +R E K+F  ++     +   + FI   FF +A+  G L FL +  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEII-----LNCNTFFIKSCFFVAAN-AGILRFLTLTM 271

Query: 351 ----LTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEI- 405
                 +GS ++  G ++I D+          G+ +         L +G  A  +I  + 
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLL 331

Query: 406 ---NDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSN 462
              + + P  K+   +    PL +    ++ F NVSF YP+RP+  + KN++    AG  
Sbjct: 332 KDGSKRNPLNKTVAHQF---PL-DYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQF 387

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSG 522
             IVG SG GKST+++LLL  Y+  +G I I+G +I T++ K L   I +V+Q   L + 
Sbjct: 388 TFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFND 447

Query: 523 TIRDNITYGLTEE------PSKEEIRLVAKQC---FCHNFITKFPDTYDXXXXXXXXXXX 573
           T+R NI  G T+        + E   L+   C       FI   PD  +           
Sbjct: 448 TLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLE--TLIGTGGVT 505

Query: 574 XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR 633
               Q+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H 
Sbjct: 506 LSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HE 563

Query: 634 LSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           LS I   +D + L  +G VVE G   EL  +P
Sbjct: 564 LSQIES-DDYLYLMKEGEVVESGTQSELLADP 594

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 142/536 (26%), Positives = 250/536 (46%), Gaps = 46/536 (8%)

Query: 146  IPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTF 203
            +  S  ++GV I        NF +  +    SE  + +LR+QV++ I  ++L++F  +  
Sbjct: 733  LKWSLIVIGVAIA---DAILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERH 789

Query: 204  KVGDLMSR----------VGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTG 253
            K  ++ +           + +D  +   S     + G+             L +  +L+ 
Sbjct: 790  KASEVSALLLNDLRDLRALASDFLIAVSSFAVVSSVGI----------IWALIIGWKLSL 839

Query: 254  ALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKR 313
               ++ P I+  ++V+G  ++    + +    DL  +  E   GI+T++    E N +++
Sbjct: 840  VCISMFPLIVIFSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQ 899

Query: 314  FNNVLREIFQVGKESAFINGKFFTSASLIGDLGF---LIVLTYGSYLVMHGSMSIGDL-- 368
            +  +   +  +    A   G      ++I  L      I+  Y   LV+ G  +   +  
Sbjct: 900  YKRLESHMRVIASRRAITTG---LGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFE 956

Query: 369  -TAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427
                +L+T  T N    L S   ++ +G  AA+RI ++ D++ + +    E K      V
Sbjct: 957  TLTLLLFTIMTCNI---LISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSV 1013

Query: 428  G--GCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYN 485
                  I  +NV+F YP+ P+  IF +L  ++P G    +VG SG GKST+ +LL   Y 
Sbjct: 1014 SESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYR 1073

Query: 486  AVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVA 545
              SG +L++ +D+   N + LRR++ +V+Q P + SGT+R+N+ YGL  +P + E+  V 
Sbjct: 1074 PTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVL 1133

Query: 546  KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD 605
            +    H+FI+K P   D               Q QR+ IARA++K+P ILILDE TSALD
Sbjct: 1134 RYVGIHDFISKLPLGLD----TTIDIDLLSGGQLQRLCIARAILKRPKILILDECTSALD 1189

Query: 606  VESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              S   IN    +     +   +SI H +  ++  +++I L N G V   G F  L
Sbjct: 1190 PFSSHVINNIVRR--GCPAPLTISITHNVDMMKACDEIIFLKN-GRVAGTGSFDAL 1242

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 120/431 (27%), Positives = 205/431 (47%), Gaps = 29/431 (6%)

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S  LT       P II C   F ++++  +    + T   +++ +      + ++    E
Sbjct: 158 SWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTE 217

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV------LTYGSYLVMHG 361
             EIK F N ++        + F+    ++S +L   L FL +        +GS ++  G
Sbjct: 218 LREIKSFKNCVQNC-----TNNFVKMCQYSSINL-ATLKFLSLAMFVQAFWFGSTMIRKG 271

Query: 362 SMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI--FEINDKEPKIKSTTGEA 419
            M+IGD+          G+ I G       + +G  A + +  F  +DK     +TT   
Sbjct: 272 KMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDK----TATTDIR 327

Query: 420 KFK--PLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477
           +++  P  E+ G +I F+NV F YP+RP + + ++++    AG    ++G SG GKS+++
Sbjct: 328 RWQDVPFPELKG-DIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSGKSSLS 386

Query: 478 SLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGL---TE 534
           +LLL  Y   +G I +DG++I  ++   L + I +V+Q   + +GT+++NI  G+    E
Sbjct: 387 NLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGIDGADE 446

Query: 535 EPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNI 594
           E    +++LV +     NFI    D  +               Q+Q++AIARAL+K P I
Sbjct: 447 EEILTKLKLVCRISLLENFIHDLSDGLN--TLIGSGGISLSGGQQQKVAIARALMKDPQI 504

Query: 595 LILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
           LILDE+ SALDV   G I        K K+  I++  H L+ I    D   L   G  +E
Sbjct: 505 LILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELNQIGS-NDFCYLIESGQCIE 561

Query: 655 MGKFKELYDNP 665
            G  + L ++P
Sbjct: 562 HGLEETLVNDP 572

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  174 bits (440), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 183/372 (49%), Gaps = 23/372 (6%)

Query: 301 VQGFVAERNEIKRFNNVLREI----FQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSY 356
           V+ F  ER    +++N L        +V +  AF+N    +  +LI       ++  G  
Sbjct: 315 VKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLN----SGQNLIFTSALTAMMYMGCT 370

Query: 357 LVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTT 416
            VM G +S+GDL             +  L S Y EL Q +     +F++   +  I+++ 
Sbjct: 371 GVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNKVNIQNSK 430

Query: 417 GE---AKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473
                 K KP      CEI+F+NV+F Y   P  +I +N NF +PAG    IVGPSG GK
Sbjct: 431 TPLMLPKDKP------CEIKFENVTFGY--HPDRKILENANFTLPAGWKTAIVGPSGSGK 482

Query: 474 STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLT 533
           STI  L+   Y+   G+ILIDG+DI  L+ KSLRR IG+V Q+  L + TI +N+ +G  
Sbjct: 483 STILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENVKFGKI 542

Query: 534 EEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
              + ++IR    +      I   P   +               +KQR+AIAR L+K   
Sbjct: 543 -TATDDDIRKAIDKAQLAPLIHSLPQGSE--TIVGERGLMISGGEKQRLAIARVLLKDTP 599

Query: 594 ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
           I+  DEATSALD  +E A+  T  +     S T + IAHRL TI   + ++VL N G V 
Sbjct: 600 IMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVLEN-GRVK 658

Query: 654 EMGKFKELYDNP 665
           E GK  EL   P
Sbjct: 659 EEGKHAELLSKP 670

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  176 bits (446), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 146/520 (28%), Positives = 240/520 (46%), Gaps = 43/520 (8%)

Query: 165  ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSIT 224
            +NF +  IL   SE  +  LR++ ++ I  K LE+F         SR  N +  ++  + 
Sbjct: 764  SNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWF---------SREENKSPEIAALLM 814

Query: 225  HKVADGVRSXXXXXXXXXLMLTLSRELTGALFAI-------------LPPIIWCTSVFGK 271
            + + D               LT+S  L G ++AI              P I+  + ++G 
Sbjct: 815  NDLRDLRSLVSQFLSVISTFLTVS--LVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGT 872

Query: 272  QIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFI 331
             ++      +    +L  +  E   G++T++    + +  K ++ +  E+ Q+ ++ A +
Sbjct: 873  VLKNYETTYKTKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIV 932

Query: 332  NGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLT---AFMLYTEYTGNAIFGLSSF 388
             G      + I      I+  YG  LVM G  S   +      +L+T  T N++    S 
Sbjct: 933  TGLGIAITTAIATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLI---SQ 989

Query: 389  YSELMQGVGAASRIFEI-NDKEPKIKSTTGEAKFKPLN---EVGGCE--IEFKNVSFFYP 442
              ++ +G  AAS I+ I  + E   + T  + +F  ++   +V   +  +   N+ F YP
Sbjct: 990  IPDISRGQRAASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYP 1049

Query: 443  TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
            T     I+ NL+  +  G  V IVG SG GKST+  LL   Y      I IDG D+   +
Sbjct: 1050 TALDVNIYDNLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWD 1109

Query: 503  TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             ++LRR+I +V+Q+P+L  GT+R+N+ YGL   P + +I  + K    ++FI   P+  +
Sbjct: 1110 NETLRRQISVVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLE 1169

Query: 563  XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                           Q QR+ IARAL++KP ILILDE TSALD  S   IN    +    
Sbjct: 1170 ----TSVDTSLISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GP 1223

Query: 623  KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
             S+  +SI H    +R    V VL  DG + E G F +L+
Sbjct: 1224 PSLLTISITHNEQMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 118/504 (23%), Positives = 220/504 (43%), Gaps = 47/504 (9%)

Query: 184 LRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXL 243
           +R +++ + + K +E++D          +  D   ++R +    A    +          
Sbjct: 108 VRYRMLNSYLDKSMEWYDK------KENLSGDFTQLNRCVEELRASSAEASAITLQNISS 161

Query: 244 MLTL-------SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFN 296
           ML+L       S  LT  +    P +I    +F + I+  +      +G    +     N
Sbjct: 162 MLSLIGVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMN 221

Query: 297 GIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV------ 350
             + ++    +  EI+ F     E   +     FI    + +A+ I  L FL +      
Sbjct: 222 SAQMIKLSCTQLKEIESF-----EELTLKCNDYFIKLSLYVAAN-ISTLRFLSLAMFVQG 275

Query: 351 LTYGSYLVMHGSMSIGD-LTAF--MLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-IN 406
             +G+  +  G+++I D +T F   L    T N   G   F   L +G  A  +I   +N
Sbjct: 276 FWFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIF---LQKGQVALRKIQSFLN 332

Query: 407 DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466
           D + +I     E+  K + ++   +I F++VSF YP+RP + +  +++    +G    IV
Sbjct: 333 DNKVEID----ESALKQI-DISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIV 387

Query: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
           G SG GKST+++LLL  Y+   G I I    I  ++ + L + I +V+Q   L + T+ +
Sbjct: 388 GRSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVN 447

Query: 527 NITYGLTEEPS-----KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQR 581
           NI  G  +E       +++++   K     + I    +  D               Q+QR
Sbjct: 448 NILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLD--TILGTGGISLSGGQQQR 505

Query: 582 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFE 641
           +A+ARA ++   +LILDEA SALD+     +     +  + ++  I++  H LS I   +
Sbjct: 506 VALARAYMRDTEVLILDEAVSALDIVHREQLMSNITKWRQGRTTIILT--HELSQI-SIQ 562

Query: 642 DVIVLGNDGSVVEMGKFKELYDNP 665
           D + +  +G ++E G   +L  +P
Sbjct: 563 DYLYVVEEGRIIESGFQGQLMYDP 586

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  173 bits (438), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 163/575 (28%), Positives = 266/575 (46%), Gaps = 57/575 (9%)

Query: 113 IGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVI 172
           + + +P     I+D++   + + T++  I +  + LS      G +++FG   N     I
Sbjct: 123 LNVQVPFFFKQIVDSMNIEWADPTAVLPIAVTAMILSYGAARFG-SVLFGELRN----AI 177

Query: 173 LRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL---MSR-VGNDAFVVSRSITHKV- 227
              +++  ++R+  Q  ++++  DL +  + + G L   M R     ++V+S  + H + 
Sbjct: 178 FASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIP 237

Query: 228 -------ADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKL 280
                    G+ +         +  T     T  L++I     + T+ +  + R ++ K 
Sbjct: 238 ITVEIGAVCGILTYQFGASFAAMTFT-----TMLLYSIF---TFKTTAWRTEFRKSANKA 289

Query: 281 QDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREI----FQVGKESAFINGK-- 334
            +       V  +       V+ F  E+    +++N L +      +V +  AF+N    
Sbjct: 290 DNKAAT---VAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQN 346

Query: 335 -FFTSASLIGDLGFLIVLTY-GSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSEL 392
             FTSA        L  + Y G   V+ G++S+GDL             +  L S Y EL
Sbjct: 347 FIFTSA--------LTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYREL 398

Query: 393 MQGVGAASRIFEINDKEPKIKSTTGEAKFKPL--NEVGGCEIEFKNVSFFYPTRPTNQIF 450
            Q +     +F++   + KI++     K KPL  +     +I F+NVSF Y   P   I 
Sbjct: 399 KQSLIDMESLFQLQRNKVKIQN-----KEKPLMLSSQRPSKIVFENVSFGYD--PDRMIL 451

Query: 451 KNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKI 510
           KN +F +PAG    IVGPSG GKSTI  L+   Y+   G+IL+DG+D+  L+ +SLRR I
Sbjct: 452 KNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAI 511

Query: 511 GIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXX 570
           G+V Q+  L + +I +N+ +G     S EEIRL  ++    + + + P   D        
Sbjct: 512 GVVPQDTPLFNDSIWENVRFGKI-SASDEEIRLAVEKAQLESLVDQLPKGRD--TIVGER 568

Query: 571 XXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSI 630
                  +KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V I
Sbjct: 569 GLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYI 628

Query: 631 AHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           AHRL TI   + +IV+   G V E GK  EL   P
Sbjct: 629 AHRLRTIADADKIIVI-QQGQVKEEGKHAELLAKP 662

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  171 bits (432), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 158/568 (27%), Positives = 257/568 (45%), Gaps = 43/568 (7%)

Query: 113 IGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVI 172
           + + +P     I+D++   + + TS+  I I ++ LS      G +++FG   N     I
Sbjct: 151 LNVQVPFFFKQIVDSMNIEWTDATSVLPIAIGSMILSYGAARFG-SVLFGELRN----AI 205

Query: 173 LRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL---MSR-VGNDAFVVSRSITHKVA 228
              + +  ++R+  Q  ++++  DL +  + + G L   M R     ++V+S  + H + 
Sbjct: 206 FASVGQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIP 265

Query: 229 DGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFG-------KQIRMNSKKLQ 281
             V           +   L+ +  G+  A+    +   S+F         + R ++ K  
Sbjct: 266 ITVE-------IGAVCGILTYQFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKSANKAD 318

Query: 282 DVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREI----FQVGKESAFINGKFFT 337
           +       V  +       V+ F  E+    +++  L +      +V +  AF+N    +
Sbjct: 319 NKAAS---VAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLN----S 371

Query: 338 SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
             +LI       ++  G   VM G +S+GDL             +  L S Y EL Q + 
Sbjct: 372 GQNLIFTSALTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 431

Query: 398 AASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKV 457
               +F++   +  I+++       P       EI FKNVSF Y   P   I KN +F +
Sbjct: 432 DMESLFQLQRNKVSIQNSKKPLMLPPNVP---SEIVFKNVSFGYD--PDRLILKNASFTI 486

Query: 458 PAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEP 517
           P GS   IVGPSG GKSTI  L+   Y+ + G+IL+DG+D+  L+ +SLRR IG+V Q+ 
Sbjct: 487 PTGSKTAIVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDT 546

Query: 518 ILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
            L + +I DN+ +G   + + +EI     +      I + P   D               
Sbjct: 547 PLFNESIWDNVKFGRI-DATDQEIERAIDRAQLRALIRQLPKGRD--TIVGERGLMISGG 603

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T  +   + S T V IAHRL TI
Sbjct: 604 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTI 663

Query: 638 RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              + +IVL   G V E GK  EL   P
Sbjct: 664 ADADKIIVL-EHGRVKEEGKHAELLATP 690

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 147/500 (29%), Positives = 230/500 (46%), Gaps = 22/500 (4%)

Query: 173  LRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRVGNDAFVVSRSITHKVADG 230
            L  +SE  +  LR++ +++I +K+LE+F  D  K  +L + V ND   +   I+  ++  
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAM 828

Query: 231  VRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRV 290
                          LT   +L+    A+ P II  ++++G  ++      +    DL   
Sbjct: 829  STFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENC 888

Query: 291  TEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV 350
              E   GI+T++    E++ I+R++ +   +  +G++ A   G      + +      I+
Sbjct: 889  VYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAIL 948

Query: 351  LTYGSYLVMHG---SMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND 407
              YG  LV  G   +M +      +L+T  T  ++        ++ +G  AASRIF I D
Sbjct: 949  FYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTSLINQ---IPDVTRGQRAASRIFRILD 1005

Query: 408  KEPKIKSTT---GEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464
            +  +    +   G  +  P N      I   N+ F YP+  ++ +F  LN ++     V 
Sbjct: 1006 ESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVA 1065

Query: 465  IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
            +V  SG GKST+  LL   Y      I IDG DI      SLR  I IV+Q+P L  G+I
Sbjct: 1066 VVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSI 1125

Query: 525  RDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
            R N+ YG   E    +I  V KQ    +F+T  P+  D               Q QRI I
Sbjct: 1126 RKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGID----TNVDTSLLSGGQAQRICI 1181

Query: 585  ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTIVSIAHRLSTIRRFED 642
            ARAL++K  ILILDE TSALD ES     +    ++KS    +  ++I H    +R   +
Sbjct: 1182 ARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGN 1237

Query: 643  VIVLGNDGSVVEMGKFKELY 662
            VIVL  DG   + G F ELY
Sbjct: 1238 VIVL-QDGETAQQGTFDELY 1256

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 122/507 (24%), Positives = 219/507 (43%), Gaps = 51/507 (10%)

Query: 183 RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
           R+R  ++ + + K +E+FD            ND  +      H+  + VRS         
Sbjct: 103 RIRRTILLSYLKKPMEWFDE-----------NDQLLGDFVQMHRCVEEVRSGSAEASAIT 151

Query: 243 LM------------LTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRV 290
                            S  LT  +    P +I   + F + I   +K   D TG   + 
Sbjct: 152 FQNFVAIIALVCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQS 211

Query: 291 TEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSAS-----LIGDL 345
                N  + V+ +  +  EIK+F  ++     +     FIN  F+ SA+      +   
Sbjct: 212 LTWSMNAAQLVKLYCTQDFEIKKFKEIV-----IRCNDYFINAWFYVSANTSILRFLSLA 266

Query: 346 GFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFG--LSSFYSELMQGVGAASRIF 403
            F+    +GS ++    MS+  +      T ++   + G  L++   +++    A   + 
Sbjct: 267 MFVQGFWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVGLN 321

Query: 404 EIND-KEPKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGS 461
            + D  E K +  T   +   +N +     I F  +SF YP+RP + + KN++       
Sbjct: 322 RVQDFLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNK 381

Query: 462 NVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMS 521
              IVG SG GKST+++LLL  YN  +G I ++G ++ +++   + + + +V+Q+  L +
Sbjct: 382 TTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFN 441

Query: 522 GTIRDNITYGLTEEPSKEEI--RL--VAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
            T+R+N+  GL+   + E++  RL    +     N I K P   D               
Sbjct: 442 DTLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLD--TKVGSGGVSLSGG 499

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
           Q+QR+A+ARA ++   ++ILDEA SALD  +   +        +SK+  I++  H L+ I
Sbjct: 500 QQQRVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSKTAIILT--HELNQI 557

Query: 638 RRFEDVIVLGNDGSVVEMGKFKELYDN 664
               D + L  +G + E G   EL +N
Sbjct: 558 LP-SDFLYLMENGQIKEEGYQNELIEN 583

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 175/345 (50%), Gaps = 17/345 (4%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       ++  G   V+ G +++GDL             +
Sbjct: 335 KVSQSLAFLN----SGQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPL 390

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN--EVGGCEIEFKNVSFF 440
             L S Y +L Q +     +F++   E KIKS       +PL   E    EI F+NV+F 
Sbjct: 391 NFLGSVYRDLKQSLIDMETLFKLRKNEVKIKSVE-----RPLMLPEHVPYEITFENVTFG 445

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
           Y   P  +I KN +F +PAG    IVG SG GKSTI  L+   Y+  SG+ILI+G+DI  
Sbjct: 446 Y--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKE 503

Query: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
            +  +LRR IG+V Q+  L + TI +N+ +G   + + EE++   ++      I K P  
Sbjct: 504 YDIDALRRVIGVVPQDTPLFNDTIWENVKFGRI-DATDEEVKTAVQKAQLAPLIKKLPQG 562

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
           ++               +KQR+AIAR L+K   I+  DEATSALD  +E A+  T     
Sbjct: 563 FE--TIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNF 620

Query: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            S S T V IAHRL TI   + +IVL N G+V E GK  EL   P
Sbjct: 621 PSGSRTSVYIAHRLRTIADADKIIVLDN-GTVKEDGKHIELLATP 664

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  169 bits (429), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 142/520 (27%), Positives = 247/520 (47%), Gaps = 38/520 (7%)

Query: 164  FANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRVGNDAFVVSR 221
            F NF +  +L   SE  +  LR++++  +  K++ +F  ++ K  ++ + V ND   + R
Sbjct: 776  FFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDL-R 834

Query: 222  SITHKVADGVRSXXXXXXXXXLMLTLS-RELTGALFAILPPIIWCTSVFGKQIRMNSKKL 280
            S+  +    + S         +   +S  +L+    ++ P I+  ++++G  ++      
Sbjct: 835  SLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDY 894

Query: 281  QDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSAS 340
            +     L     +    I+T++   AE +    ++++ +++ Q+  + A   G   +  +
Sbjct: 895  KTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTN 954

Query: 341  LIGDLGFLIVLTYGSYLVM---HGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
            +I      I+  YG  LV+   + S  + +    +L+T  +  ++ G      ++ +G  
Sbjct: 955  MIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQR 1011

Query: 398  AASRIFEINDKEP---KIKSTTGEAKFKPLNEVGGCE---------IEFKNVSFFYPTRP 445
            AAS I+ I D+E    +I++    A      ++ G E         I  +N+SF YP+ P
Sbjct: 1012 AASWIYRILDEEEDTLEIENNDARAL-----DISGAEYYGDRNIPIISIRNLSFAYPSAP 1066

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKS 505
               IFK+++  +     + IVG SG GKST+A LL   YN  +  I+IDG D+   N  S
Sbjct: 1067 NVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTS 1126

Query: 506  LRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXX 565
            LR++I +V+Q+P    G+IRDN+TYG   E  + EI  V K    ++F+   P   D   
Sbjct: 1127 LRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLD--- 1183

Query: 566  XXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK-- 623
                        Q QR+ IARAL++K  ILILDE TSALD  S   IN     I++    
Sbjct: 1184 -TRVDTNLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVRKGPP 1238

Query: 624  SMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
             +  + I H    +R    + VL + G VVE G F  LY+
Sbjct: 1239 GLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLYN 1277

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 114/426 (26%), Positives = 190/426 (44%), Gaps = 34/426 (7%)

Query: 259 LPPIIWCTS--------VFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNE 310
           L  II C+S        +F + I   ++K    T +  ++     N  + V+ +  +  E
Sbjct: 177 LTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQPLE 236

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV------LTYGSYLVMHGSMS 364
            ++F  ++     +   + FI    + +A+  G L FL +        +GS ++  G ++
Sbjct: 237 RQKFQEII-----LSCNTFFIKSCLYVAAN-AGILRFLTLTMFVQGFWFGSTMIRKGKLN 290

Query: 365 IGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL 424
           I D+          G+ +         L +G  A  +I  + +   K  ++      +P 
Sbjct: 291 INDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHLQPP 350

Query: 425 NEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
                 ++ F+NVSF YP+RP+  + +N+N K P+G    IVG SG GKSTI++LLL+ Y
Sbjct: 351 LNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFY 410

Query: 485 NAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE---- 540
           +   G ILI+G++  ++  K L   I +V+Q   L + T++ NI  G T      +    
Sbjct: 411 DNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTI 470

Query: 541 -----IRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNIL 595
                I+   +       I   PD  +               Q+QR+AIARA I+   IL
Sbjct: 471 GNNNLIKDACRMALLDRLILDLPDGLE--TLIGSGGVSLSGGQQQRVAIARAFIRDTPIL 528

Query: 596 ILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEM 655
            LDEA SALD+     +        K K+  I++  H LS I   +D + +  +G VVE 
Sbjct: 529 FLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQIES-DDHLYVMQEGRVVES 585

Query: 656 GKFKEL 661
           G   EL
Sbjct: 586 GIQSEL 591

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  166 bits (419), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 175/345 (50%), Gaps = 17/345 (4%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       ++  G   V+ G++++GDL             +
Sbjct: 334 KVSQSLAFLN----SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPL 389

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN--EVGGCEIEFKNVSFF 440
             L S Y +L Q +     +F++   E KIK+       +PL   E    +I F+NV+F 
Sbjct: 390 NFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAE-----RPLMLPEHVPYDITFENVTFG 444

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
           Y   P  +I KN +F +PAG    IVG SG GKSTI  L+   Y+  SG+ILI+G+DI  
Sbjct: 445 Y--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIRE 502

Query: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
            +  +LR+ IG+V Q+  L + TI +N+ +G   + + EE+  V ++      I K P  
Sbjct: 503 YDINALRKVIGVVPQDTPLFNDTIWENVKFGRI-DATDEEVMTVVEKAQLAPLIKKLPQG 561

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
           +D               +KQR+AIAR L+K   I+  DEATSALD  +E A+  T     
Sbjct: 562 FD--TIVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNF 619

Query: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            S S T V IAHRL TI   + +IVL N G V E GK  EL   P
Sbjct: 620 TSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLATP 663

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  165 bits (418), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 174/345 (50%), Gaps = 17/345 (4%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       ++  G   V+ G +++GDL             +
Sbjct: 337 KVSQSLAFLN----SGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPL 392

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN--EVGGCEIEFKNVSFF 440
             L S Y EL Q +     +F++   E KIK+       +PL   E    +I F+NV+F 
Sbjct: 393 NFLGSVYRELKQSLIDMEALFKLRKNEIKIKNAE-----RPLMLPEHVPYDITFQNVTFG 447

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
           Y   P  +I KN +F +PAGS   IVG SG GKSTI  L+   Y+  SG+ILI+G+DI  
Sbjct: 448 Y--HPDRKILKNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKE 505

Query: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
            +  +LR+ IG+V Q+  L + TI +N+ +G  +  + EE+  V ++      I K P  
Sbjct: 506 YDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDA-TDEEVNTVVEKAQLAPLIKKLPQG 564

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
           ++               +KQR+AIAR L+K   I+  DEATSALD  +E A+  T     
Sbjct: 565 FN--TIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNF 622

Query: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            S S T V IAHRL TI   + +IV  N G V E GK  EL   P
Sbjct: 623 PSGSRTSVYIAHRLRTIADADKIIVFDN-GKVREEGKHLELLATP 666

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  164 bits (415), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 174/345 (50%), Gaps = 17/345 (4%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       ++  G   V+ G++++GDL             +
Sbjct: 334 KVSQSLAFLN----SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPL 389

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN--EVGGCEIEFKNVSFF 440
             L S Y +L Q +     +F++   E KIK+       +PL   E    +I F+NV+F 
Sbjct: 390 NFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAE-----RPLMLPENVPYDITFENVTFG 444

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
           Y   P  +I KN +F +PAG    IVG SG GKSTI  L+   Y+  SG+ILI+G+DI  
Sbjct: 445 Y--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKE 502

Query: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
            +  +LR+ IG+V Q+  L + TI +N+ +G  +   +E I +V K       I K P  
Sbjct: 503 YDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAP-LIKKLPQG 561

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
           +D               +KQR+AIAR L+K   I+  DEATSALD  +E A+  T     
Sbjct: 562 FD--TIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNF 619

Query: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            S S T V IAHRL TI   + +IVL N G V E GK  EL   P
Sbjct: 620 TSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLAMP 663

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 137/524 (26%), Positives = 251/524 (47%), Gaps = 23/524 (4%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLM 209
            L+ + I L  G F NF ++ IL   SE  +  LR+++++ +  K  E++   + K  ++ 
Sbjct: 726  LIVLAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEIS 784

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
            +   ND   +   +T  ++                +    +L+    ++ P II  + ++
Sbjct: 785  ALALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIY 844

Query: 270  GKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESA 329
            G  ++      +    DL  +  E    I+T++      + +  ++ + +++ ++ K+  
Sbjct: 845  GTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRT 904

Query: 330  FINGKFFTSASLIGDLGFLIVLTYGSYLVMHG---SMSIGDLTAFMLYTEYTGNAIFGLS 386
             + G   +  + I      I+  YG  LV+ G   S ++      +L+T  T N+   L 
Sbjct: 905  IVTGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNS---LV 961

Query: 387  SFYSELMQGVGAASRIFEINDKEPKIKSTTGE-AKFKPLNEVGGCE--IEFKNVSFFYPT 443
            S   ++ +G  AAS +  I D+    K   GE  + + +      +  IE +N++F YP 
Sbjct: 962  SQIPDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPN 1021

Query: 444  RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNT 503
             P   ++++LN K+ +G  + +VG SG GKST+  LL   Y+    +ILI+G DI   + 
Sbjct: 1022 TPGVNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSY 1081

Query: 504  KSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP--SKEEIRLVAKQCFCHNFITKFPDTY 561
              LR +I +V+Q+P L  GTIR+NITYG++E+   S+ E++ + +    H F+   P   
Sbjct: 1082 DILRAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKAL 1141

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG---AINYTFGQ 618
            D               Q QR+ I R L++KP +LILDE TS+LD ++     A+      
Sbjct: 1142 D----TVVDIGLLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNT 1197

Query: 619  IMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
             +    +TIV I H    ++    ++VL + G VVE G+F +L+
Sbjct: 1198 KLGWDILTIV-ITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLH 1239

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 127/507 (25%), Positives = 232/507 (45%), Gaps = 40/507 (7%)

Query: 176 ISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXX 235
           + ER   R+RS++++  + K +E++D      L   +  D   ++R +    +    +  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 236 XXXXXXXLMLTL-------SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLT 288
                   ++ L       S +LT  +    P II C + F + I+  +      T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 289 RVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFL 348
            +     +  +TV+    +  EIK+F  ++ +         FI    FT+A+ IG L FL
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKC-----NDYFIRTSLFTAAN-IGILRFL 260

Query: 349 IV------LTYGSYLVMHGSMSIGD-LTAFMLYTEYTGNAIFGLSSFYSELMQ-GVGAAS 400
            +        +GS ++  G ++I D +T F  Y+     +I   +  +   +Q G  A +
Sbjct: 261 TLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQVALA 318

Query: 401 RIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAG 460
           +I +  ++ P++ S T  +     + V   +I   N++F YP+RPT  + KN++ K+ + 
Sbjct: 319 KIQKFINESPELPSKTLTSSGLVYSHV---DISIDNLTFAYPSRPTENVLKNVSLKIKSA 375

Query: 461 SNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILM 520
               IVG SG GKSTI +L++  Y    G I++  +DI ++    L + I +V+Q   L 
Sbjct: 376 RTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLF 435

Query: 521 SGTIRDNITYGLTEEPSKEEIRLVAKQC--FC-HNFITKFPDTYDXXXXXXXXXXXXXXX 577
           + T+++NI  G           L++  C   C  + I+  PD  +               
Sbjct: 436 NDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIE--TRLGTDGITLSGG 493

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
           Q+QR+A+ARA ++  +ILILDEA SALD+     +     ++ ++K+  I++  H L+ I
Sbjct: 494 QQQRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLNQI 551

Query: 638 RRFEDVIVLGNDGSVVEMGKFKELYDN 664
               D I L  +  + E G  K L ++
Sbjct: 552 ND-NDYIYLFENNEIKENGFKKTLMND 577

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  164 bits (416), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 134/509 (26%), Positives = 233/509 (45%), Gaps = 15/509 (2%)

Query: 160  IFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTF--KVGDLMSRVGNDAF 217
            I   F  F +  I+   SE  +  LR +V++ I +   E+F     K  ++ +   ND  
Sbjct: 761  IIDAFCTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLR 820

Query: 218  VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNS 277
             +   +T  +A                L    +L+    ++ P II  + V+G  ++   
Sbjct: 821  DLRTLVTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCE 880

Query: 278  KKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFT 337
               +     L     E    ++T++    + +   R++   + +  +G+  + I G    
Sbjct: 881  TDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIA 940

Query: 338  SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
                +      I+  YG  LV+ G  +   +        +T      L +   E+ +G  
Sbjct: 941  ITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQR 1000

Query: 398  AASRIFEINDKEPKIKSTTG-EAKFKPLNEVGGCE--IEFKNVSFFYPTRPTNQIFKNLN 454
            AA+ I+ I  +    +       +  P++     +  +  K+++F YP  P+  ++++LN
Sbjct: 1001 AATYIYRILKEAAATREHQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLN 1060

Query: 455  FKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQ 514
              + + ++V +VG SG GKSTI SLL   Y+     I +DG D++  +T SLR +I +V+
Sbjct: 1061 LNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVE 1120

Query: 515  QEPILMSGTIRDNITYGLTEEPSKE-EIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXX 573
            Q   L++GTIR+N+TYGL EE + E ++  + K    ++F+++ P+  D           
Sbjct: 1121 QSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGID----TIVDRDL 1176

Query: 574  XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMT-IVSIAH 632
                Q QR+ IARAL+K   ILILDE TSALD  S    N     + K    T I++I H
Sbjct: 1177 LSGGQAQRLCIARALVKPHRILILDECTSALDALST---NIIIDIVRKGIPNTLIIAITH 1233

Query: 633  RLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
                +R  E V++L N G++VE G F EL
Sbjct: 1234 DEHMMRSCESVLLLKN-GAIVEQGSFVEL 1261

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 106/388 (27%), Positives = 169/388 (43%), Gaps = 40/388 (10%)

Query: 294 QFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTS--ASLIGDLGFLIVL 351
           +FN +  V+ + A+  EI +F+  +         S FI    +++  +S+I  L   + +
Sbjct: 210 RFNDM--VKFYTAQNEEISKFDTSVTRC-----NSLFIKACLYSALNSSIIRFLTLCMFV 262

Query: 352 T---YGSYLVMHGSMSIGD-LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND 407
               +G+ ++    + I D +T F        ++   L +  SE M  V    +    N 
Sbjct: 263 QGFWFGATMIRRNKLDINDVITCF--------HSCLMLGATVSEAMSQVTVIQKGHVANK 314

Query: 408 KEPKIKSTTG----EAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNV 463
           K        G    +A  K   +     I F N+SF YP R +N   +N++ ++ +G   
Sbjct: 315 KLEGFLELEGKTIMQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMT 374

Query: 464 CIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGT 523
            I+G SG GKST+A LLL  Y   SG I +D   I  LN + L   I +V+Q   L + T
Sbjct: 375 FIIGKSGSGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDT 434

Query: 524 IRDNITYGL--TEEPSK-----EEIRLVAKQC---FCHNFITKFPDTYDXXXXXXXXXXX 573
           +R+NI  G     EP++     E  R + K C     +  +    D  D           
Sbjct: 435 LRNNILLGSENQSEPARMESIEERERKLRKACNFALLNEMLADLTDGLD--TVIGSGGVE 492

Query: 574 XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR 633
               Q+QR+A+ARA ++   I+I DE+ SALDV     +        + K  T + + H 
Sbjct: 493 LSGGQRQRVALARAFLRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHE 550

Query: 634 LSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           LS I    D I +   G V E G  ++L
Sbjct: 551 LSQINP-TDFIYIMEHGRVCEYGYQEDL 577

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  162 bits (410), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 115/343 (33%), Positives = 172/343 (50%), Gaps = 12/343 (3%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  A++N    +  +LI       ++  G   V+ G +++GDL             +
Sbjct: 333 KVSQSLAYLN----SGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPL 388

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
             L S Y EL Q +     +F++   E KI++ T     K  +  G  EI F+NV+F Y 
Sbjct: 389 NFLGSVYRELKQSLIDMESLFQLRKNEIKIENGTNPIVLKASD--GPFEITFENVTFGYD 446

Query: 443 TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
           ++   +I  N +F +P G    +VGPSG GKSTI  L+   Y+   G+ILI+G D+   +
Sbjct: 447 SK--RKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYD 504

Query: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             SLRR +G+V Q+  L + TI +N+ +G  +  + EE+  V ++      I K P  Y+
Sbjct: 505 VDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDA-TDEEVHTVIEKAQLAPLIKKLPQGYE 563

Query: 563 XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                          +KQR+AIAR L+K   I+  DEATSALD  +E A+  T     +S
Sbjct: 564 --TIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFES 621

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            S T V IAHRL TI   + +IVL  DG+V E G    L   P
Sbjct: 622 GSRTSVYIAHRLRTIADADKIIVL-EDGAVKEEGTHSGLLATP 663

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  164 bits (414), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 144/532 (27%), Positives = 243/532 (45%), Gaps = 43/532 (8%)

Query: 155  VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRV 212
            +G+    G F NF +  +L   SE  +  LR+++++ +  K++ +F  +  K  ++ + V
Sbjct: 768  LGVAAADGIF-NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALV 826

Query: 213  GNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLS-RELTGALFAILPPIIWCTSVFGK 271
             ND   + RS+  +    + S         +   +S  +L+    ++ P II  + ++G 
Sbjct: 827  MNDLRDL-RSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGS 885

Query: 272  QIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFI 331
             ++      +     L     +    I+T++   AE +    ++++  ++  +  + A  
Sbjct: 886  SLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIA 945

Query: 332  NGKFFTSASLIGDLGFLIVLTYGSYLVM-HGSMSIGDLTAF--MLYTEYTGNAIFGLSSF 388
             G   +  ++I      I+  YG  LVM H   S      F  +L+T  +   + G    
Sbjct: 946  TGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQ--- 1002

Query: 389  YSELMQGVGAASRIF----------EINDKEPKIKSTTGEAKF----KPLNEVGGCEIEF 434
              ++ +G  AAS I+          EI D   ++   +G   +    KP+       +  
Sbjct: 1003 IPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPI-------VSI 1055

Query: 435  KNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
            +N++F YP+ P   I+K ++  +  G  V IVG SG GKST+  LL   Y    G I ID
Sbjct: 1056 QNLTFAYPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEID 1115

Query: 495  GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
            G D+   N  SLRR+I +V+Q+P L  G+IRDN+TYG   +    E+    K    ++F+
Sbjct: 1116 GTDVNDWNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFV 1175

Query: 555  TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 614
               P + D               Q QR+ IARAL++K  ILILDE TSALD  S   IN 
Sbjct: 1176 ASLPQSLD----TRIDTNLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN- 1230

Query: 615  TFGQIMKSK--SMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
                I+K    ++  + I H    +R    V+V   DG +VE G F  LY++
Sbjct: 1231 ---DIVKKGPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 125/429 (29%), Positives = 195/429 (45%), Gaps = 26/429 (6%)

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S  LT  +    P I      F + I + +KK    TG   ++     N  + V+ +  +
Sbjct: 174 SWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLTWSMNAAQLVRLYCTQ 233

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV------LTYGSYLVMHG 361
             E K+F  ++         + FI   F+ +A+  G L FL +        +GS ++  G
Sbjct: 234 PLERKKFEEIVSNC-----NTFFIKSCFYLAAN-AGVLRFLTLTMFVQGFWFGSTMIRKG 287

Query: 362 SMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKF 421
            ++I D+          G  +         L +G  A  +I  + +  PK  ++     +
Sbjct: 288 RLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGPKRNTSNTIELY 347

Query: 422 KPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL 481
           +PL +    ++ F+NVSF YP+RPT  I +N   K P G    IVG SG GKSTI++LLL
Sbjct: 348 QPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSGSGKSTISNLLL 407

Query: 482 HHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLT------EE 535
             Y+   G I I+G++I T+  KSL   I +V+Q   L + T+++NI  G T      + 
Sbjct: 408 KFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNILLGSTGSIRNADS 467

Query: 536 PSKEEIRLVAKQC---FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKP 592
            + +   L+ + C        I   PD  +               Q+QR+AIARA I+  
Sbjct: 468 NTIDNNNLIKEACRMALLDRLILDLPDGLE--TIIGSGGITLSGGQQQRVAIARAFIRDT 525

Query: 593 NILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSV 652
            IL LDEA SALD+     +        K K+  I++  H+LS I   +D + L  DG V
Sbjct: 526 PILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT--HQLSQIEA-DDYLYLMQDGKV 582

Query: 653 VEMGKFKEL 661
           +E G   EL
Sbjct: 583 IESGIQSEL 591

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/339 (34%), Positives = 173/339 (51%), Gaps = 12/339 (3%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           ++ K  AF+N    +  +LI       ++  G   V+ G++++GDL             +
Sbjct: 351 KISKSLAFLN----SGQNLIFTTALTGMMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPL 406

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
             L S Y EL Q +     +F++   E KI +   E     L E G  EI F+NV+F Y 
Sbjct: 407 NFLGSVYRELKQSLIDMESLFKLRKNEVKIHNI--ENPKIILKEDGPFEITFENVTFGY- 463

Query: 443 TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
                +I KN +F +PAG    IVGPSG GKSTI  L+   Y+   G+ILI+G D+  + 
Sbjct: 464 -HADRKILKNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIE 522

Query: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             SLR+ IG+V Q+  L + +I +N+ +G  +     EI  V ++    + I K P +Y+
Sbjct: 523 LDSLRKLIGVVPQDTPLFNDSIWENVKFGRIDALD-SEIYEVIEKAQLDSLIRKLPQSYE 581

Query: 563 XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                          +KQR+AIAR L+K  +++  DEATSALD  +E A+  T     K+
Sbjct: 582 --TIVGERGLMISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKT 639

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            S T + IAHRL TI   + +IVL  DG+V E G   EL
Sbjct: 640 GSRTSIYIAHRLRTIADADKIIVL-EDGTVREEGTHNEL 677

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 173/342 (50%), Gaps = 18/342 (5%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       ++  G   V+ G++++GDL             +
Sbjct: 347 KVAQSLAFLN----SGQNLIFTSALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPL 402

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL---NEVGGCEIEFKNVSF 439
             L S Y EL Q +     +F++   E KI++       +PL   NE+   EI+F+NV+F
Sbjct: 403 NFLGSVYRELKQSLIDMESLFKLRKNEIKIQNV-----HRPLMLPNELTPFEIKFENVTF 457

Query: 440 FYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIA 499
            Y      +I KN +F +PAG    +VGPSG GKSTI  L+   Y+   G+IL++G DI 
Sbjct: 458 GYDKE--RKILKNASFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIK 515

Query: 500 TLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
            ++  SLR+ IG+V Q+  L + TI +N+ +G  E    E ++ + K       I K P 
Sbjct: 516 EIDLASLRKVIGVVPQDTPLFNDTIWENVKFGRIEATDNEILQAIEKAQLAP-LIKKLPK 574

Query: 560 TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQI 619
             +               +KQR+AIAR L+K   I+  DEATSALD  +E ++  T  + 
Sbjct: 575 GRE--TIVGERGLMISGGEKQRLAIARVLLKNSGIMFFDEATSALDTHTEQSLLRTIKEN 632

Query: 620 MKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
               S T V IAHRL TI   + +IVL  DG V E G  ++L
Sbjct: 633 FDGSSRTSVYIAHRLRTIADADKIIVL-KDGQVEEEGTHRQL 673

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/349 (34%), Positives = 171/349 (48%), Gaps = 25/349 (7%)

Query: 323 QVGKESAFINGK---FFTSASLIGDLGFLIVLTY-GSYLVMHGSMSIGDLTAFMLYTEYT 378
           +V +  AF+N      FTSA        L  + Y G+  VM G++++GDL          
Sbjct: 354 KVAQSLAFLNAGQNFIFTSA--------LTAMMYMGASGVMEGALTVGDLVLINQLVFQL 405

Query: 379 GNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN--EVGGCEIEFKN 436
              +  L S Y EL Q +     +F++      IK+T      +PL   E   CEI+F+N
Sbjct: 406 SVPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTE-----RPLMLPEHLPCEIKFEN 460

Query: 437 VSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQ 496
           V+F Y  +P   I KN  F +  G    IVGPSG GKSTI  L+   Y+   G+IL+DG+
Sbjct: 461 VTFGY--QPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGK 518

Query: 497 DIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITK 556
           DI  L+   LRR +G+V Q+  L + TI +N+ +G       E +  + K     + I K
Sbjct: 519 DIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAIEKAQLS-DLIHK 577

Query: 557 FPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF 616
            P   +               +KQR+AIAR L+K   I+  DEATSALD  +E ++  T 
Sbjct: 578 LPKGTE--TIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTI 635

Query: 617 GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +     + T V IAHRL TI   + +IVL N G+V E G    L  NP
Sbjct: 636 KENFSDVAKTSVYIAHRLRTIADADKIIVLEN-GAVREEGTHNALLANP 683

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 173/340 (50%), Gaps = 11/340 (3%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI      +++  G   V+ G++++GDL             +
Sbjct: 365 KVAQSLAFLN----SGQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPL 420

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKST-TGEAKFKPLNEVGGCEIEFKNVSFFY 441
             L S Y EL Q +     +F++     KI++  TG A     +  G  EI+F+NV+F Y
Sbjct: 421 NFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGY 480

Query: 442 PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATL 501
            T    +I KN +F +PAG    +VGPSG GKSTI  L+   Y+   G++LI+G ++   
Sbjct: 481 DT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRY 538

Query: 502 NTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
           +  SLRR +G+V Q+  L + TI +N+ +G     + EEI+ V ++      I K P   
Sbjct: 539 DIDSLRRVMGVVPQDTPLFNDTIWENVKFGRI-NANDEEIKQVIEKAQLAPLIEKLPQR- 596

Query: 562 DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMK 621
                           +KQR+AIAR L+K  NI+  DEATSALD  +E A+  T      
Sbjct: 597 -EKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFP 655

Query: 622 SKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           S + T + IAHRL TI   + +IVL  DG V E G   EL
Sbjct: 656 SGTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNEL 694

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  161 bits (408), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 233/501 (46%), Gaps = 36/501 (7%)

Query: 177  SERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSX 234
            SE  +  LR   ++ I  +DL +F  D  K  ++ + V ND   + RS+  +    + + 
Sbjct: 818  SEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDL-RSLVSEFLSSISTL 876

Query: 235  XXXXXXXXLMLTLS-RELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEE 293
                    +   +S  +L+    ++ P  I  +  +G  ++      +    +L     E
Sbjct: 877  IIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLHE 936

Query: 294  QFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGF-LIVLT 352
             F GI T++    E   ++++ N+ +++ +  K+ A   G F  +AS    L    I+  
Sbjct: 937  IFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIG-FGVAASNTLTLAVQAILFY 995

Query: 353  YGSYLVMHGSMS---IGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND-- 407
            YG  LV  GS S   + +    +L+T  T  ++ G      ++ +G  AA+ IF I D  
Sbjct: 996  YGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRIIDNQ 1052

Query: 408  ----KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNV 463
                K+ K K  + +    PL       I  KN+SF YP+ P+  I+K L   V +G  +
Sbjct: 1053 SPAAKDEKKKIASYKFTHDPL-------ISVKNLSFSYPSAPSTAIYKGLKLDVFSGETI 1105

Query: 464  CIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGT 523
             +VG SG GKST+  L+   Y   +G I IDG DI   +T  LR  I +V+Q+P    GT
Sbjct: 1106 AVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGT 1165

Query: 524  IRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIA 583
            + +N+ YG++   ++ +++         +F+   P+  D               Q QR++
Sbjct: 1166 VGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLD----TRIDTSLISGGQAQRLS 1221

Query: 584  IARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTIVSIAHRLSTIRRFE 641
            IARA+++KP IL LDE TSALD  +  AI      ++K     +T + I H    +R  E
Sbjct: 1222 IARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACE 1277

Query: 642  DVIVLGNDGSVVEMGKFKELY 662
             + VL N G V E G F +LY
Sbjct: 1278 RIAVLQN-GKVAEDGSFDDLY 1297

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 115/423 (27%), Positives = 181/423 (42%), Gaps = 24/423 (5%)

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S  LT  + A +P II  + +  K I   ++     +    ++    F+    ++ F  +
Sbjct: 177 SWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQ 236

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVL-----TYGSYLVMHGS 362
           + EI++F   +++  +      FI    F+SAS      F + +      +G+ ++  G 
Sbjct: 237 QFEIEKFELSVKKCTKY-----FIRISLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGV 291

Query: 363 MSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGE--AK 420
           ++ GD+          GN +         + +G  A  +I     +E        E  + 
Sbjct: 292 LTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISD 351

Query: 421 FKPLNEVG------GCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
              LN +       G EI FKNVSF YPTRP   + KN++   P      IVG SG GKS
Sbjct: 352 AFILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKS 411

Query: 475 TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE 534
           TI  LLL  Y   +G I +DG DI  + T  L   I +V+Q   L + TI++NI  G   
Sbjct: 412 TIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKG 471

Query: 535 EPSKEE-IRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
           +   +  +R   +       I   P+  D               QKQR+A+ARA ++   
Sbjct: 472 KAYGDSLVREACQMALLDRLIFDLPNGLD--TVLGSGGVSLSGGQKQRVALARARVRDSP 529

Query: 594 ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
           ILILDEA S +D+     +     +    K MT V + H L+ I   ED +    +G + 
Sbjct: 530 ILILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQISD-EDYLYFMEEGQIR 586

Query: 654 EMG 656
           E G
Sbjct: 587 ESG 589

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 138/516 (26%), Positives = 239/516 (46%), Gaps = 36/516 (6%)

Query: 165  ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRVGNDAFVVSRS 222
            +NF +  IL   SE  +  LR++ +++I++KDL +F  DT K  +L + + ND   +   
Sbjct: 774  SNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRSL 833

Query: 223  ITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQD 282
            ++  ++                L    +L+    ++ P II  ++V+G  ++      + 
Sbjct: 834  VSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYKT 893

Query: 283  VTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLI 342
                L     E   GI+T++   AE + IK ++ +   +  +  + +   G   +  ++I
Sbjct: 894  SVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNMI 953

Query: 343  GDLGFLIVLTYGSYLVMHGSMS---IGDLTAFMLYTEYTGNAIF-----------GLSSF 388
                  I+  YG  LV  G  S   + +    +L+T  T  ++              +  
Sbjct: 954  TICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATFL 1013

Query: 389  YSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQ 448
            Y  L +G+ +    FE + K  +I +   E+K  PL       I+ +N++F YP+     
Sbjct: 1014 YRILDEGLASDESEFETHRK-AEIVAPKQESKSNPL-------IKIQNLTFAYPSETNVN 1065

Query: 449  IFKNLNFKVPAGS-NVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLR 507
            ++++LN ++ A    + +VG SG GKST+  LL   Y      I +DG D+      +LR
Sbjct: 1066 VYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLR 1125

Query: 508  RKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
             +I +V+Q+P L  GT+R+N++YG++ +    E+  + K    + F+   P   D     
Sbjct: 1126 TQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLD----T 1181

Query: 568  XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS--KSM 625
                      Q QRI IARAL++KP ILILDE TSALD  S   I      I+K+   ++
Sbjct: 1182 RIDTKLLSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPAL 1237

Query: 626  TIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              + I H    +R    + VL N G ++E G FKEL
Sbjct: 1238 LTIVITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL 1272

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 182/413 (44%), Gaps = 24/413 (5%)

Query: 261 PIIWCTSVFGKQIRMNSKKLQDV-TGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLR 319
           PII   +VF   +     +L++  TG   ++     + I+ V+ +  +  E++ F    R
Sbjct: 187 PIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQFREVRNF----R 242

Query: 320 EIFQVGKESAFINGKFFTSA--SLIGDLG---FLIVLTYGSYLVMHGSMSIGDLTAFMLY 374
           E+     +  FI    + SA  +L+  L    F+    +G+ +V  G + I ++      
Sbjct: 243 ELTSNCND-LFIKCCLYVSANTALLRFLSLSMFIQGFWFGATMVRKGKLQISNVVTCFQS 301

Query: 375 TEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF 434
               G+ +         L +G  A  +I         +     E  ++P      C I F
Sbjct: 302 CLMLGSTLSNTLQVIVILQKGDVALKKILGF--LSTSVDHGADEPIYEPETPAELCTIAF 359

Query: 435 KNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
            N++F YP+RP++ + KN++          I+G SG GKST+++LLL  Y+  +G I + 
Sbjct: 360 NNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVK 419

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE------EPSKEEIRLVAKQC 548
           G D+  +N   L   + +V+Q   L + T+R+NI  G+++      E  +++++      
Sbjct: 420 GNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLEDHESIEQKLKDACSIS 479

Query: 549 FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVES 608
                +   P  +                Q+QR+AIARA ++   ILILDEA SALD+  
Sbjct: 480 MLDRLVCDLP--HGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEAVSALDIIH 537

Query: 609 EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              +     Q    K  T + + H LS I   +D   +  +G V E G  K+L
Sbjct: 538 RELLMKNIRQWRSGK--TTILLTHELSQIEP-DDYTYVIQEGEVKENGYQKDL 587

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 136/519 (26%), Positives = 237/519 (45%), Gaps = 27/519 (5%)

Query: 155  VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRV 212
            +GIT+I G  +NF +  +L I SE  +  LR + +K I+ K +++F  + ++  ++ + +
Sbjct: 776  IGITIIDG-ISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALI 834

Query: 213  GNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQ 272
             ND   +   ++  ++                L    +L     A+ P II  ++++G  
Sbjct: 835  LNDLRDLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAV 894

Query: 273  IRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFIN 332
            ++ +    +    +L  +  +  + I+T++    E +    +     ++  V  + +   
Sbjct: 895  LQKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYT 954

Query: 333  GKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSEL 392
            G   +  + I      I+  YG  L+M G  ++  +        +T      L +   ++
Sbjct: 955  GLGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDM 1014

Query: 393  MQGVGAASRIF----------EINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
             +G  AAS ++          E+ND    I      +   P+       ++ KN++F Y 
Sbjct: 1015 SRGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPI-------LDIKNLTFAYE 1067

Query: 443  TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
            + P+ ++   L  K+  G  + I G SG GK+T+ SLL+  Y+    QI  +G+DI    
Sbjct: 1068 STPSIKVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYE 1127

Query: 503  TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             +SLR  I IV+Q+P ++SG+IRDN+        S  E+  V K     +FI   P   D
Sbjct: 1128 FESLRDAIVIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGID 1187

Query: 563  XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                           Q QRI IARAL++KP ILILDE TSALD  S   IN    +  + 
Sbjct: 1188 ----TIIDTTLLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSK--EL 1241

Query: 623  KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              +TI+SI H  S +   ++V VL N G +VE+G +  L
Sbjct: 1242 NGVTIISITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL 1279

 Score =  129 bits (323), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 126/243 (51%), Gaps = 14/243 (5%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           I F+N+SF YP+RP   I   +N      +   IVG SG GKST+++LLL  Y    G I
Sbjct: 358 ISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDI 417

Query: 492 LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSK---------EEIR 542
           LID  +I  LN K+L   I IV+Q+  L + TIR+NI +G++   ++         E ++
Sbjct: 418 LIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLK 477

Query: 543 LVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATS 602
                    +F+   P+  D               Q+QR+A+ARA ++ P ILILDEA S
Sbjct: 478 NACTFALLDHFLIDLPNGID--TVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVS 535

Query: 603 ALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
           ALDV     +     ++ +S   TI+ + H L+ I   +D + +   G ++E GK KEL 
Sbjct: 536 ALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDN-DDFLYVIKHGRIIEHGKRKELI 592

Query: 663 DNP 665
            +P
Sbjct: 593 TDP 595

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  156 bits (394), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 124/369 (33%), Positives = 181/369 (49%), Gaps = 24/369 (6%)

Query: 301 VQGFVAERNEIKRFNNVLREI----FQVGKESAFINGK---FFTSASLIGDLGFLIVLTY 353
           V+ F  E     ++NN L        +V +  AF+N      FTSA        L  + Y
Sbjct: 298 VKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSA--------LTAMMY 349

Query: 354 -GSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKI 412
            G   ++ G++++GDL             +  L S Y EL Q +     +F++   E  I
Sbjct: 350 MGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRRNEVVI 409

Query: 413 KSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRG 472
           K+   + K  P +     EI F+NV+F Y   P   I KN +F + AG  + IVGPSG G
Sbjct: 410 KNVE-QPKMLPADG-KPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIVGPSGSG 465

Query: 473 KSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGL 532
           KSTI  L+   Y+   G+ILI+G D+  ++  SLR+ IG+V Q+  L + TI +N+ +G 
Sbjct: 466 KSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVRFGR 525

Query: 533 TEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKP 592
             + + EE+    ++      I+K     D               +KQR+AIAR L+K  
Sbjct: 526 I-DATDEEVWAAVEKAHLSPLISKLSRGTD--TIVGERGLMISGGEKQRLAIARVLLKNA 582

Query: 593 NILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSV 652
           +I+  DEATSALD  +E  +  T     K+ S T + IAHRL TI   + +IVL  DGSV
Sbjct: 583 DIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-EDGSV 641

Query: 653 VEMGKFKEL 661
            E G   EL
Sbjct: 642 KEEGTHTEL 650

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  156 bits (394), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 167/346 (48%), Gaps = 27/346 (7%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL----VMHGSMSIGDLTAFMLYTEYT 378
           +V +  AF+N    T  +LI    F   LT   Y+    VM GS+++GDL          
Sbjct: 333 KVSQSLAFLN----TGQNLI----FTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQL 384

Query: 379 GNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKF---KPLNEVGGCEIEFK 435
              +  L S Y +L Q +     +F++   +  IK++         KPL      +I F+
Sbjct: 385 SVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPL------DIRFE 438

Query: 436 NVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG 495
           NV+F Y   P  +I  N++F +PAG    IVGPSG GKSTI  L+   Y    G+IL+ G
Sbjct: 439 NVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGG 496

Query: 496 QDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFIT 555
            DI  L+  SLR+ IG+V Q+  L + TI +N+ +G       E +R + K       + 
Sbjct: 497 TDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLT-KLLQ 555

Query: 556 KFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 615
             P                   +KQR+AIAR L+K   ++  DEATSALD  +E A+ +T
Sbjct: 556 NLPK--GASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHT 613

Query: 616 FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             Q   S S T V +AHRL TI   + +IVL   GSV E G    L
Sbjct: 614 IQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSVREEGTHSSL 658

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  155 bits (392), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 111/339 (32%), Positives = 170/339 (50%), Gaps = 12/339 (3%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  SLI       ++  G   V+ G +++GDL             +
Sbjct: 362 KVAQSLAFLN----SGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPL 417

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
             L S Y EL Q +     +F++   + KI++ +        +  G  EI+F+NV+F Y 
Sbjct: 418 NFLGSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKSD--GPFEIKFENVTFGYD 475

Query: 443 TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
            +   +I KN +F +PAG    I GPSG GKST+  L+   Y+   G++L++G D+   +
Sbjct: 476 GQ--RKILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYD 533

Query: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
              LR+ IG+V Q+  L + TI +N+ +G   E S EEI  V  +    + I K P    
Sbjct: 534 IDQLRKAIGVVPQDTPLFNDTIWENVKFGRI-EASDEEITRVIDKAQLSDLIAKLPQ--G 590

Query: 563 XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                          +KQR+AIAR L+K  +I+  DEATSALD  +E ++  T  +   S
Sbjct: 591 SSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNS 650

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              T V IAHRL TI   + +IVL  +G+V E G  +EL
Sbjct: 651 GEKTSVYIAHRLRTIADADKIIVL-EEGTVREEGTHQEL 688

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  154 bits (390), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 177/369 (47%), Gaps = 16/369 (4%)

Query: 301 VQGFVAERNEIKRFNNVLREI----FQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSY 356
           V+ F  E+    ++N  L+       +V +  AF+N    +  +LI       ++  G  
Sbjct: 325 VKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLN----SGQNLIFTSALTAMMYMGCT 380

Query: 357 LVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTT 416
            ++ G++S+GDL             +  L S Y +L Q +     +F++   E KI +  
Sbjct: 381 GILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLRKNEVKILNNK 440

Query: 417 GEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTI 476
             A     +  G   IEFKNV+F Y   P  +I +N +F +PAG    +VGPSG GKSTI
Sbjct: 441 NPAILSLKD--GPFNIEFKNVTFGYD--PNRKILRNASFIIPAGVKTAVVGPSGSGKSTI 496

Query: 477 ASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP 536
             L+   Y+   G++L++G D+   +  SLRR IG+V Q+  L + TI +N+ +G     
Sbjct: 497 LKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTIWENVKFG-DVTA 555

Query: 537 SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI 596
           + E+I    ++      I K P  Y+               +KQR+AIAR L+K   I+ 
Sbjct: 556 TDEQILNAVEKAQLGTLIEKLPKKYE--TIVGERGLMISGGEKQRLAIARVLLKNAPIMF 613

Query: 597 LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
            DEATSALD  +E  +  T        S T V IAHRL T+   + +IVL  +GS+ E G
Sbjct: 614 FDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL-KEGSIFEEG 672

Query: 657 KFKELYDNP 665
               L   P
Sbjct: 673 THLGLLSKP 681

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  154 bits (389), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 170/347 (48%), Gaps = 20/347 (5%)

Query: 323 QVGKESAFIN-GKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNA 381
           ++ +  AF+N G+ F   S +  + ++     G   V+ G +++GDL             
Sbjct: 330 KIAQSLAFLNAGQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVP 384

Query: 382 IFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL---NEVGGCEIEFKNVS 438
           +  L S Y EL Q +     +F + + + KI +       KPL      G  EI+F+NV+
Sbjct: 385 LNFLGSVYRELKQSLIDMEALFNLRNNKIKIHNND-----KPLMLPENAGPFEIKFENVT 439

Query: 439 FFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDI 498
           F Y TR   +I +N +F +PAG    IVGPSG GKSTI  L+   Y+  SG++L++G+D+
Sbjct: 440 FGYDTR--RKILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDV 497

Query: 499 ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFP 558
              +  S R+ IG+V Q+  L + TI +N+ +G  +    E    + K       I K P
Sbjct: 498 REYDLDSFRKVIGVVPQDTPLFNDTIWENVKFGRIDATDDEVTNAIEKAQLAP-LIHKLP 556

Query: 559 DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 618
                              +KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +
Sbjct: 557 --VGSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRE 614

Query: 619 IMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
                S T V +AHRL TI   + ++VL  +G V E G   EL   P
Sbjct: 615 NFDRGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSHTELLSRP 660

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 130/499 (26%), Positives = 232/499 (46%), Gaps = 21/499 (4%)

Query: 172  ILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRVGNDAFVVSRSITHKVAD 229
            IL   SE  +  LR   ++ I +  +E+   D  K  +L + + ND   +  S ++ ++ 
Sbjct: 771  ILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFISF 830

Query: 230  GVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTR 289
                           +    +L+    ++ P ++  + ++G  ++    + ++    L  
Sbjct: 831  VSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLEN 890

Query: 290  VTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLI 349
            V  E   G++T++    E +   +FN + +    +G+  A + G     ++ +      I
Sbjct: 891  VQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGLTMSIQGI 950

Query: 350  VLTYGSYLVMHGSMSIGDLT---AFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN 406
            +  Y   LV+HG  +   +      +L+T  T N    L +   ++ +G  AAS+I+ I 
Sbjct: 951  LYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCN---NLVNQIPDIRRGQRAASKIYRIL 1007

Query: 407  D--KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464
            +   E +   T G      +    G  I F ++SF YPT PT +I K+L+ ++ +G  + 
Sbjct: 1008 EGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIA 1067

Query: 465  IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
            IVG SG GKST+ +++   Y   S  + +D  D+       LR +I +V+Q+P L  GTI
Sbjct: 1068 IVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTI 1127

Query: 525  RDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
            R+N+ YG     +  ++  + K    ++F    P+  +               Q QR+ I
Sbjct: 1128 RENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLE----TKIDSGLLSGGQNQRLCI 1183

Query: 585  ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTIVSIAHRLSTIRRFED 642
            ARAL+++P ILILDE TSALD  S   IN    +I++    +M  +SI H    +R    
Sbjct: 1184 ARALLQRPKILILDECTSALDTMSSHIIN----EIIREGPPTMLTISITHDEQMVRACNK 1239

Query: 643  VIVLGNDGSVVEMGKFKEL 661
            V VL + G +VEMG  ++L
Sbjct: 1240 VAVL-DQGHIVEMGNREDL 1257

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 141/536 (26%), Positives = 233/536 (43%), Gaps = 54/536 (10%)

Query: 153 MGVG-ITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
           +G G I +I+ C +++       ++ ER   R+R+Q++ + + K ++++D          
Sbjct: 71  LGAGSIVIIWICISSW------MLLGERQNFRVRTQLIDSYLQKPMKWYD---------- 114

Query: 212 VGNDAFVVSRSITHKVADGVRSXXXXXXXXX-------LMLTL-----SRELTGALFAIL 259
             ND      + T++  + +RS                L LT+     S  LT       
Sbjct: 115 -DNDTLTGDLTQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTLVTMCGA 173

Query: 260 PPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFN---- 315
           P I+ C   F + I + S+K    T   +++        + V+    +  E++ F     
Sbjct: 174 PVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVK 233

Query: 316 ----NVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAF 371
               N ++        +A +  KF T         F+    +GS ++    + I D+   
Sbjct: 234 KCSKNFMKMCLYASANTAIL--KFLTLTI------FVQAFWFGSTMIRKHKLRIEDVITC 285

Query: 372 MLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCE 431
                  G  I G       L +G      + E   K+  +K      +   L+     +
Sbjct: 286 FQSCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEK 345

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           IE +NV F YP+RPT    KN++  +P G    +VG SG GKS++ +LLL  Y+  +G I
Sbjct: 346 IELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSI 405

Query: 492 LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPS---KEEIRLVAKQC 548
            IDG DI  ++ KS+ + I +V+Q   L + T+R+NI +G  E       E ++   +  
Sbjct: 406 SIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRIS 465

Query: 549 FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVES 608
              NFI   P+  D               Q+QRIAIARA ++   IL+LDEA SALD+  
Sbjct: 466 LLDNFIYDLPEGLD--TLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIH 523

Query: 609 EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            G +        +S+  TI+ + H LS I   +D+I L  DG VVE G+ + L  N
Sbjct: 524 RGLLMNAIRN-WRSEKTTII-LTHDLSEIGP-DDMIYLLEDGEVVEQGQQRNLLLN 576

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  154 bits (388), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 114/343 (33%), Positives = 168/343 (48%), Gaps = 13/343 (3%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       V+      VM GS+++GDL             +
Sbjct: 342 KVQQSLAFLN----SGQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPL 397

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
             L S Y EL Q +     +F +   +  IK+       + L E    +I F+NV+F Y 
Sbjct: 398 NFLGSVYRELKQSLIDMESLFRLQKNKITIKNVLNP---QMLPEKLPSDIRFENVTFGYD 454

Query: 443 TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
             P  +I KN  F +PAG    IVGPSG GKSTI  L+   Y    G+ILIDG+DI  ++
Sbjct: 455 --PERKILKNATFTIPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVD 512

Query: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             SLR+ IG+V Q+  L + TI +N+ +G   + S ++I    ++      I   P   +
Sbjct: 513 LDSLRKSIGVVPQDTPLFNDTIWENVKFGRI-DASDKDITNAIERAQLTKLIQNLPKGIN 571

Query: 563 XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                          +KQR+AI+R L+K   ++  DEATSALD  +E ++  T  +  + 
Sbjct: 572 --TIVGERGLMISGGEKQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEG 629

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           +S T V IAHRL TI   + +IVL N+  V E G  K L   P
Sbjct: 630 QSKTSVYIAHRLRTIADADKIIVL-NNSRVHEEGDHKTLLKTP 671

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 127/520 (24%), Positives = 235/520 (45%), Gaps = 13/520 (2%)

Query: 149  STFLMGVGITLI----FGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFK 204
            S++L+   + +I    F    NF ++ +L  +SE+ V +LR  +++ ++ +DL +    K
Sbjct: 757  SSYLLKWSLVVIGIASFDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNK 816

Query: 205  VGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIW 264
              ++ +   ND   +    +  ++                + +  +LT    ++LP  I 
Sbjct: 817  SSEITALTMNDLRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIG 876

Query: 265  CTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQV 324
              +++G  ++ +  + +     L  +  E   G++T++    E     R+  + + + + 
Sbjct: 877  VITLYGMFVQKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQ 936

Query: 325  GKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFG 384
             +  + + G      S +  L   I+  YG  LV+ G      L        +T  +  G
Sbjct: 937  MRRRSILYGSGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVG 996

Query: 385  LSSFYSELMQGVGAASRIF-EINDKEPKIKSTTGEAKFKPLNEVGGCE-IEFKNVSFFYP 442
            L S      +G  A + +F  + +  P+  + +   +  P N       +  + ++F YP
Sbjct: 997  LLSALPSSSRGQRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYP 1056

Query: 443  TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
                 QI+KN N ++  G+ V IVG SG GKST+  L+   Y      + IDG DI    
Sbjct: 1057 AAKDVQIYKNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWE 1116

Query: 503  TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
              +LR+ I +V+Q+P   +GTIR+N+ YGL    +  EI  V  +    NF+   P+  +
Sbjct: 1117 MSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLE 1176

Query: 563  XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                           Q QR++I RAL+++P +LILDE TSALD  +  AI       +  
Sbjct: 1177 ----TRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL-- 1230

Query: 623  KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
              +T++ I H    ++  + ++VL N G+V E G F +L+
Sbjct: 1231 HDITVIVITHSKQMMKMCDRIVVLKN-GAVAEDGSFDDLF 1269

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 125/509 (24%), Positives = 217/509 (42%), Gaps = 35/509 (6%)

Query: 175 IISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL--MSRVGNDAFVVSRSITHKVADGV- 231
           ++ ER   R+R +++++ + K ++++D  K+ D+  M  + N     +R+   + A GV 
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYD--KIDDINGMYTITNRCVEEARASCAE-ASGVL 153

Query: 232 -RSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRV 290
            +S              S +LT    A  P +   T VF K ++  +    + T   +  
Sbjct: 154 FQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 291 TEEQFNGIRTVQGFVAERNEIKRFN---NVLREIFQVGKESAFINGKFFTSASLIGDLGF 347
                N    V+ F  +  E+++FN   N+ ++ F      + IN       SL   + F
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSL---MMF 270

Query: 348 LIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND 407
           +    YGS L+    +    +      +    ++I  + S    L +G  A  +I E  +
Sbjct: 271 VQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVN 330

Query: 408 KEPKIKSTTGEAKFKPLNEVGG--------CEIEFKNVSFFYPTRPTNQIFKNLNFKVPA 459
            EP+ +       +    EVG          EI F  VSF YP RP  +    ++     
Sbjct: 331 VEPEGRPNQYAFPY----EVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRP 386

Query: 460 GSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPIL 519
                IVG SG GKST+ +LLL  Y+   G I ++  ++  ++   L + I +V+Q   L
Sbjct: 387 NQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTL 446

Query: 520 MSGTIRDNITYGLTEEPSKEEIRLVAKQC---FCHNFITKFPDTYDXXXXXXXXXXXXXX 576
            +GT+ +NIT  L+ +P  +    V + C        +   P+                 
Sbjct: 447 FNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPE--GLHTKVGSGGISMSG 502

Query: 577 XQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLST 636
            Q+QR+A+ARA+++   +LILDEA SALD+     +          K+  I++  H LS 
Sbjct: 503 GQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSH 560

Query: 637 IRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           +   +D + +   G V+E G   EL  NP
Sbjct: 561 VLD-DDYLYMMEHGQVIEQGYKSELLSNP 588

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
            YKL209C
          Length = 1293

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 140/517 (27%), Positives = 228/517 (44%), Gaps = 33/517 (6%)

Query: 165  ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRVGNDAFVVSRS 222
            +NF +  IL   SE  +  LR++ +  I++K L++F  +  K  +L + + ND   +   
Sbjct: 781  SNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRSL 840

Query: 223  ITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQD 282
            ++  ++                L    +L+    ++ P II  + ++G  ++      + 
Sbjct: 841  VSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKT 900

Query: 283  VTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLI 342
               +L     E    I+T++   A +  IK +  +   + ++  + +   G   +  + I
Sbjct: 901  AVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTI 960

Query: 343  GDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI 402
                  I+  YG  LV  G  S   +        +T  +   L S   ++ +G  AAS +
Sbjct: 961  AVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWL 1020

Query: 403  FEINDKEPKIKST------------TGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIF 450
            + I D+    K +            +G     PL       I  KN+ F YP+  T +I+
Sbjct: 1021 YRILDESDDNKESVDSGSRSADIIISGNTNSVPL-------ISIKNLRFSYPSAQTVEIY 1073

Query: 451  KNLNFKVPAGSN-VCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
            KN+   V +    + IVG SG GKST+  LL   Y   +  I IDG D+   +T  LR++
Sbjct: 1074 KNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQ 1133

Query: 510  IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
            I +V+Q P L  GT+RDN+ YG   + S+ EI  V K    + FI   P   D       
Sbjct: 1134 ISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLD----SRI 1189

Query: 570  XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVS 629
                    Q QR+ IARAL++KP ILILDE TSALD  S   IN     ++K+   T+++
Sbjct: 1190 DTKLVSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLT 1245

Query: 630  IA--HRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            I   H    +     + V+  DG + E G F EL  N
Sbjct: 1246 IVITHSKQMMEACNSLAVI-KDGRLAEQGNFAELMKN 1281

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 131/523 (25%), Positives = 218/523 (41%), Gaps = 56/523 (10%)

Query: 176 ISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXX 235
           + ER    +R +++   + K +E++D         ++  D   V+R +    +    +  
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGDFTQVNRCVEELRSSSAEASA 153

Query: 236 XXXXXXXLMLTL-------SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLT 288
                   ML L       S  LT  +    P II    +F   I   ++     TG   
Sbjct: 154 ITFQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAA 213

Query: 289 RVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSA--SLIGDLG 346
           ++     N  + V+ +  +  EI  F  ++ +         FI   F+ SA  S++  L 
Sbjct: 214 QLLNWSMNSAQLVKLYCTQAYEIHSFKELVGQC-----NDLFIKSCFYVSANTSILRFLS 268

Query: 347 ---FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIF 403
              F+    +G+ +V  G +SI D+          G+ +         L +G  A  +I 
Sbjct: 269 LSMFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKIL 328

Query: 404 EI---NDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAG 460
           +    + + P +     E  ++P   +   EI F+N+SF YPTRP   + K+++     G
Sbjct: 329 DFISFSQRSPSL-----EPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPG 383

Query: 461 SNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILM 520
            +  I+G SG GKST+A+LLL  YN   G I I   ++  +N   L   I +V+Q   L 
Sbjct: 384 RSTFIIGKSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLF 443

Query: 521 SGTIRDNITYGLTEEPSKEE---------IRLVAKQCFCHNFITKFPDTYDXXXXXXXXX 571
           + T+R+N+  G++    K E         ++   +       I + PD  D         
Sbjct: 444 NDTLRNNLLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLD--TIIGAGG 501

Query: 572 XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIA 631
                 Q+QR+AIARA IK  ++LILDEA SALD+     I          K+  I++  
Sbjct: 502 VSLSGGQQQRVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILT-- 559

Query: 632 HRLSTIRRFEDVIVLGNDGSVVEMGK-----------FKELYD 663
           H LS +  ++D + +  DG V E G            F +LYD
Sbjct: 560 HDLSQL-DYDDFLYVFEDGEVKESGYQQALLQDEKTIFSKLYD 601

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 110/339 (32%), Positives = 166/339 (48%), Gaps = 12/339 (3%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI       ++  G   ++ GS+++GDL             +
Sbjct: 329 RVAQSLAFLN----SGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPL 384

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
             L S Y EL Q +     +F + +  P +     + K  P N  G  +I F+NV+F Y 
Sbjct: 385 NFLGSVYRELKQSLIDMESLFNLRN-NPILIDNPSKPKMLPAN-AGPFDIVFENVTFGYD 442

Query: 443 TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
             P  +I +N +F +PAG    +VGPSG GKST+  L+   Y+   G+IL++G DI   +
Sbjct: 443 --PRRKILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYD 500

Query: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             SLRR IG+V Q+  L + TI +N+ +G  +   +E  R + K       + + P   +
Sbjct: 501 LDSLRRAIGVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLN 559

Query: 563 XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622
                          +KQR+AIAR L+K  +I+  DEATSALD  +E A+  T       
Sbjct: 560 --TIVGERGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDR 617

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            S T V IAHRL TI   + +IVL  +G   E G   EL
Sbjct: 618 GSKTSVYIAHRLRTIADADKIIVL-EEGRPREEGTHHEL 655

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 146/529 (27%), Positives = 243/529 (45%), Gaps = 37/529 (6%)

Query: 155  VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLMSRV 212
            +G+    G F NF +  +L   SE  +  LR++V++ +  K + +F  +  K  ++ + V
Sbjct: 793  LGVAAADGIF-NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALV 851

Query: 213  GNDAFVVSRSITHKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFGK 271
             ND   + RS+  +    + S         +  L    +L+    ++ P II  ++++G 
Sbjct: 852  LNDLRDL-RSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYGS 910

Query: 272  QIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFI 331
             ++ +    +     L     +    I+T++   AE +    ++ +  ++ Q+  + A  
Sbjct: 911  ILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIA 970

Query: 332  NGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSE 391
             G   +  ++I      I+  YG  LVM    +   +        +T  +   L S   +
Sbjct: 971  TGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPD 1030

Query: 392  LMQGVGAASRIF----------EINDKEPK----IKSTTGEAKFKPLNEVGGCEIEFKNV 437
            + +G  AAS I+          EI D   +    I  T  E +  P+       +  +N+
Sbjct: 1031 ISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPM-------LSIQNL 1083

Query: 438  SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497
            +F YP+ P+  I+KN+N  +  G  + IVG SG GKST+  LL   Y+   G I +DG D
Sbjct: 1084 TFAYPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTD 1143

Query: 498  IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557
            +   N   LRR+I +V+Q+P+L +GTIRDN+TYG   E  + EI    K    ++F+   
Sbjct: 1144 VNDWNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASL 1203

Query: 558  PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617
            P                   Q QR+ IARAL++KP ILILDE TSALD  S   I     
Sbjct: 1204 P----LGLGTRIDTNLLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK---- 1255

Query: 618  QIMKS--KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            +I+K    ++  + I H    + R  D I +  DG V+E G F  LY+N
Sbjct: 1256 EIVKKGPPALLTLVITHD-EQMMRCCDSIAVFKDGKVIEEGSFDTLYNN 1303

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 119/430 (27%), Positives = 189/430 (43%), Gaps = 28/430 (6%)

Query: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           S  LT  +    P I +    F + + M S+K  + T    ++     N  + V+ +  +
Sbjct: 199 SWSLTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQ 258

Query: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV------LTYGSYLVMHG 361
             E K+F  ++     +   + FI    F +A+  G L FL +        +GS ++  G
Sbjct: 259 PLERKKFQRII-----LSCNTFFIKSCLFVAAN-AGILRFLTLTMFVQGFWFGSTMIKQG 312

Query: 362 SMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG-EAK 420
            ++I D+          G+ +         L +G  A  +I  + +  PK       E  
Sbjct: 313 KLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELH 372

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
             PL +    ++ F NVSF YP+RP+  + +N + K PAG    IVG SG GKST++SLL
Sbjct: 373 QYPL-DYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLL 431

Query: 481 LHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE 540
           L  Y+   G I I+G++I  +  K L + I +V+Q   L + T+R NI  G TE     +
Sbjct: 432 LKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNAD 491

Query: 541 ---------IRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKK 591
                    I+   +       I   PD  +               Q+QR+A+ARA I+ 
Sbjct: 492 YSTNKNTNLIKDACRMALLDRLILDLPDGLE--TLIGSGGVTLSGGQQQRVAMARAFIRD 549

Query: 592 PNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGS 651
             IL LDEA SALD+     +        K K+  I++  H L  +   +D + L  +G 
Sbjct: 550 TPILFLDEAVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQVES-DDHLYLMQEGK 606

Query: 652 VVEMGKFKEL 661
           V+E G   EL
Sbjct: 607 VIESGTQSEL 616

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/343 (33%), Positives = 171/343 (49%), Gaps = 19/343 (5%)

Query: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
           +V +  AF+N    +  +LI      +++  G   ++ G++++GDL             +
Sbjct: 354 KVAQSLAFLN----SGQNLIFTSALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPL 409

Query: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL--NEVGGC--EIEFKNVS 438
             L S Y EL Q +     +F++      IK+       KPL   E G     I F+NV+
Sbjct: 410 NFLGSVYRELKQSLIDMEYLFQLKKNPIIIKNVE-----KPLMLAEKGHMPMTIRFENVT 464

Query: 439 FFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDI 498
           F Y  +   +I KN +F++ +G    IVGPSG GKSTI  LL   Y+   G+IL++G D 
Sbjct: 465 FGYDKQ--RKILKNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDA 522

Query: 499 ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFP 558
              +  SLR+ IG+V Q+  L + TI +N+ +G     S +EI  V  +      + K P
Sbjct: 523 REYDIDSLRKVIGVVPQDTPLFNDTIWENVRFGRI-GASDDEITQVINKAQLGPLLVKLP 581

Query: 559 DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 618
              +               +KQR+AIAR L+K  +I+  DEATSALD  +E A+  T  +
Sbjct: 582 QGRE--TIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLKTINE 639

Query: 619 IMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             K  S T V IAHRL TI   + +IVL  +G+V E GK  EL
Sbjct: 640 NFKKGSRTSVYIAHRLRTIADADKIIVL-QEGTVREEGKHSEL 681

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 131/503 (26%), Positives = 223/503 (44%), Gaps = 17/503 (3%)

Query: 167  FGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFK--VGDLMSRVGNDAFVVSRSIT 224
            F +   L    E  +  LR +  KNI +++L +F++ +    ++ S V ND   + R++ 
Sbjct: 791  FLKCFTLSKCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVSSLVINDLRDL-RALA 849

Query: 225  HKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDV 283
             +    V +         +  L    +L+    +++P  I  T  +G  ++      +  
Sbjct: 850  SEFLAAVTTLVVVSFCGLIWALASGWKLSLVCISLIPAFILFTGAYGGLLQKCEANYKSA 909

Query: 284  TGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIG 343
               +          I+T++    E   IK +  +  +    G++ A   G     ++ + 
Sbjct: 910  VASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALT 969

Query: 344  DLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIF 403
             +   I+L YG  LV+ G  S   +   +    +T      L +   E+ +G  AA+ +F
Sbjct: 970  LITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLF 1029

Query: 404  EINDKEPKIKSTTGEAKFKPLNEVGGCEIE----FKNVSFFYPTRPTNQIFKNLNFKVPA 459
             I D E +      E +    +   GC  E     K++ F Y       +++ LN  V A
Sbjct: 1030 RILDSETQFADANLEGESALTSR--GCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKA 1087

Query: 460  GSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPIL 519
            G  V +VG SG GKST+  L+   Y   SG I  DG D+      +LR++I +V+Q P L
Sbjct: 1088 GETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSL 1147

Query: 520  MSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
              G+I DN+TYGL+    + EIR + +     +F+   P                   Q 
Sbjct: 1148 FRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNP----LGLQSFIDTDVLSGGQL 1203

Query: 580  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRR 639
            QR+AI RAL++KP +L+LDE TSALD +  G I   F +   S+S T + + H    +R 
Sbjct: 1204 QRLAIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQSTTTLVLTHSEQMMRA 1261

Query: 640  FEDVIVLGNDGSVVEMGKFKELY 662
               ++   N G+++E G F+ LY
Sbjct: 1262 CNRILTFAN-GNIIEDGSFERLY 1283

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 128/536 (23%), Positives = 223/536 (41%), Gaps = 41/536 (7%)

Query: 149 STFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
           S  ++  GI  I  C+ +   V     + ER   RLR +++++ + K + ++D  +    
Sbjct: 75  SMAILATGIASIPLCWLS---VSAWMSLGERQAFRLRRKMLQSYLDKSMAWYDANE---- 127

Query: 209 MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL-------SRELTGALFAILPP 261
             ++  D   ++R +    +    S          +  L       S  LT  + A  P 
Sbjct: 128 --QISGDFTQLNRCVEELRSSSAESSAIVFQNVVTVAALLGSALYYSWSLTLIIMANSPL 185

Query: 262 IIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREI 321
           +I     F +++   +K+    T           +  + V+    +  E+ RF   +++ 
Sbjct: 186 VIGFAVFFSRKVEKYAKRENSETSSAADAMAWSLDAAKMVRLLGTQDRELARFEACVQKC 245

Query: 322 FQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDL-TAFMLYTEYTGN 380
            Q   + +  +   ++    +    F+    YG+  +  G +  GD+ T F        +
Sbjct: 246 RQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYGNSRINIGKLKPGDVVTCF-------SS 298

Query: 381 AIFGLSSFYSELMQ-------GVGAASRIFEINDKEP-KIKSTTGEAKFKPLNEVGG-CE 431
            +   S+  S L Q        VG    +  +N ++  + +    E  F+ L        
Sbjct: 299 CVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQKNKVEISFRRLPLCWERAS 358

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           I F+NV F YPTRP + + K ++   P+G    ++G SG GKSTI +LLL  Y   SG I
Sbjct: 359 ITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTI 418

Query: 492 LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRL--VAKQCF 549
            ++GQD+  +N   L R I +V+Q   L + T+ +N+T G       +EIRL    +   
Sbjct: 419 NVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVTIG-EAGVDDDEIRLKQACQMAM 477

Query: 550 CHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESE 609
             N I       +               ++QR+A+ARA  +   ILILDEA SA D   +
Sbjct: 478 LGNIIRDLAKGLE--TTIGCSGLDLSGGEQQRVALARAYFRNAPILILDEALSAQDRIHK 535

Query: 610 GAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
             +     +    K+  I++  H LS I   + V V+ +DG + E G    L  NP
Sbjct: 536 SLLMEAIRKWRADKTTIILT--HELSDILDTDYVYVM-SDGQIREHGYKSGLLSNP 588

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 122/431 (28%), Positives = 206/431 (47%), Gaps = 27/431 (6%)

Query: 245  LTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGF 304
            + +  +L+    AI+P ++  T ++G  +     + +    +L  +  E   G++T+Q  
Sbjct: 803  IAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSL 862

Query: 305  VAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMS 364
              ++   K+FN  ++ + + G   A   G      +++  L   I+  YG  LV+ G  +
Sbjct: 863  CLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYT 922

Query: 365  IGDL---TAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEI----NDK--EPKIKST 415
               L    A +L+T  T   +  L +   ++ +G  + S I +I    N +  EP    +
Sbjct: 923  HSKLFETIALLLFTIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLS 979

Query: 416  TGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKST 475
            T +  + P   V    IE  N+SF Y      +   N+N ++ +     IVG SG GKST
Sbjct: 980  TTKGIWNPNQPV----IEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKST 1035

Query: 476  IASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEE 535
            + +L+   Y+   G I I   DI   +TK L + + ++QQ P+L   TIR+N+ YGLTE 
Sbjct: 1036 LINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTET 1095

Query: 536  PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNIL 595
               E +  V +     +FI    +  D               Q QR+ +AR +++ P +L
Sbjct: 1096 VGDEHLLNVLEYVGLKSFIISLNNGLD----SKLDDSLLSGGQSQRLCMAREMLRNPKVL 1151

Query: 596  ILDEATSALDVESEGAINYTFGQIMKSKSMTIVSI--AHRLSTIRRFEDVIVLGNDGSVV 653
            ILDE TSALDV S   IN     I+ S+S+  V+I  +H+  TI+  + +  L  DG+V 
Sbjct: 1152 ILDECTSALDVTSAKKIN----DIIGSRSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVA 1206

Query: 654  EMGKFKELYDN 664
             MG ++EL +N
Sbjct: 1207 MMGTYEELMEN 1217

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 134/545 (24%), Positives = 227/545 (41%), Gaps = 39/545 (7%)

Query: 116 AIPKII-GTILDTLRNNYENLTSLSQIKILNI-PLSTFLMGVGITLIFGCFANFGRVVIL 173
           AI  I+ G I   L +N + +   ++ K L I  +S  ++G+G  L F   A +G +   
Sbjct: 41  AISSILFGRIFHLLDDNSDKVDYNTKRKQLVIRTMSILILGMG-NLPFNWLAIYGWM--- 96

Query: 174 RIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRS 233
            ++ ER    +R ++     +    +FD ++  D+M         + R I    +    +
Sbjct: 97  -MLGERQSYIIRKKLFHEYFNLPCSWFDKYR-SDIMGEFTQ----LHRCIEEVRSSSAEA 150

Query: 234 XXXXXXXXXLMLTL-------SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD 286
                     ++ L       S  LT  +F   P II C  +F K I   ++K    +  
Sbjct: 151 SAIMSQSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESEC 210

Query: 287 LTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLG 346
                      I  V+    +  EI  + + + +         +I    F SA++     
Sbjct: 211 AAERLAWMLKNIEFVRLHNGDDFEISMYTHYIAQ-----ANEYYIKASLFISANISILRL 265

Query: 347 -----FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASR 401
                F+    +GS ++  G ++I  +          G+ I         L +G  A  R
Sbjct: 266 LSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKR 325

Query: 402 IFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGS 461
           + ++ D+ P+       A    ++ +    I F NVSF YP R T+++F  +NF +    
Sbjct: 326 LLKMIDRTPR----ESLAFIDAISGIDLLPIVFNNVSFCYPERKTDKVFDKMNFIIKPNK 381

Query: 462 NVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMS 521
              ++GPSG GKST+  L+L HY+   G I++   DI ++N   +   I +V Q P L +
Sbjct: 382 MTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFN 441

Query: 522 GTIRDNI--TYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
            TIR+NI      T  PSK E+  + K     N I + PD  D               Q 
Sbjct: 442 DTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLD--TRIGSGGIKLSGGQA 499

Query: 580 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRR 639
           Q++A+ARA  +  +IL+LDE  SA+D+     +     +    K  T V I H L  IR 
Sbjct: 500 QKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRN 557

Query: 640 FEDVI 644
            ++++
Sbjct: 558 TDNIL 562

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 131/527 (24%), Positives = 242/527 (45%), Gaps = 32/527 (6%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF--DTFKVGDLM 209
            L+ + +++  GCF  F +  IL + SE  +  LR + +  I ++D+ +F  D  K  ++ 
Sbjct: 794  LVVICVSVTDGCF-TFLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEIS 852

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLS----RELTGALFAILPPIIWC 265
            + + ND     R + + V+  + +         + L  +     +L+    + +P  I  
Sbjct: 853  ALILNDL----RDLRYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGV 908

Query: 266  TSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVG 325
            T ++G  ++      +    +L     E   GI+TV+    E +   ++  +   +    
Sbjct: 909  TGIYGGVLQKYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQS 968

Query: 326  KESAFING--KFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLT---AFMLYTEYTGN 380
            +  A + G     ++A +IG     I+  YG  LV+ G  +  +L      +++T  T +
Sbjct: 969  RRRAVVTGFGVALSNALVIGVQA--ILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCS 1026

Query: 381  AI-FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCE--IEFKNV 437
            A+ + + SF     +G  AA+ +F I +      S   + + +P+ +       I  +++
Sbjct: 1027 ALMYEVPSF----SRGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDL 1082

Query: 438  SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497
            +F YP+    +++K L+  +  G N+ IVG SG GKST+  +L   Y      + ID  D
Sbjct: 1083 TFAYPSALDVEVYKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTD 1142

Query: 498  IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557
            I   N  SLR+ I +V+Q+     G+IRDN+ YGL    +  +I  V       +F+ + 
Sbjct: 1143 ICKWNLSSLRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKEL 1202

Query: 558  PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617
            P   +               Q QRI+I RAL+++P +LILDE TS+LD ++  AI    G
Sbjct: 1203 PQGLN----TRIDTNLISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVG 1258

Query: 618  QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
              +    +T + I H    ++    ++   N G + E G F+EL D+
Sbjct: 1259 SSL--YGITTIVITHNTQMMKSCNRILFFKN-GRISEEGTFQELSDS 1302

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 113/521 (21%), Positives = 211/521 (40%), Gaps = 41/521 (7%)

Query: 163 CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRS 222
           C+A     ++L    ER   R+R +++   + K + ++DT +       +  D   + R 
Sbjct: 92  CWATLSSWMLL---GERQGFRVRRRLLGAYLSKTMAWYDTNE------NLEGDFTQIHRG 142

Query: 223 ITHKVADGVRSXXXXXXXXXLMLTL-------SRELTGALFAILPPIIWCTSVFGKQIRM 275
           +    +    S          ++TL       S  LT  + A  P II    +F K +  
Sbjct: 143 VEELRSSAAESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEK 202

Query: 276 NSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKF 335
            ++     T     +        + ++ F  E+ E+++F+  +++  +      FIN   
Sbjct: 203 YTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKF-----FINLSK 257

Query: 336 FTSASLIGDLGFLIVL-----TYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYS 390
           + +A+     G  +++      +G+ ++  G ++ G +          G  +        
Sbjct: 258 YAAANQASLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIV 317

Query: 391 ELMQGVGAASRIFEINDKEP-KIKSTTGEAKFKPLNEVGGC--------EIEFKNVSFFY 441
            + +G  A  +I  + + E   ++   GE      + + G         +I F+NVSF Y
Sbjct: 318 IMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSY 377

Query: 442 PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATL 501
           P+RP      N++          IVG SG GKST+++LLL  Y+   G I +   DI   
Sbjct: 378 PSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRAT 437

Query: 502 NTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKE-EIRLVAKQCFCHNFITKFPDT 560
               L   I +V+Q   L + ++ +N+     ++   E  I+   +       +   PD 
Sbjct: 438 KDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPD- 496

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
                            Q+QR+A+ARA+++   +LILDE+ SALD+     +        
Sbjct: 497 -GLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRNWR 555

Query: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             K+  I++  H LS I   +D + L  DG V E G  ++L
Sbjct: 556 AGKTTIILT--HELSHILD-DDYLYLMEDGKVGEHGYKRDL 593

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 242/519 (46%), Gaps = 15/519 (2%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFD--TFKVGDLM 209
            L+ + I+ + G  + F +  IL   SE  + RLR   +  I  K L++F   T    +L 
Sbjct: 749  LIVISISAVDG-ISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELN 807

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLS-RELTGALFAILPPIIWCTSV 268
            S + ND   + R +  +    + +         +   +S  +L+    ++ P  I  + +
Sbjct: 808  SLMMNDLRDL-RGLASEFLSAITTLVFVASIGLIWALVSGWKLSLVCISLFPAFILFSGI 866

Query: 269  FGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKES 328
            +G  +++     +    +L     E    ++T++    +++    F   L ++  V K+ 
Sbjct: 867  YGSLLQVYETAYKTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKR 926

Query: 329  AFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSF 388
            +   G      + +  +   I+  +G  LV+ G  S+  +        ++      L + 
Sbjct: 927  SVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQ 986

Query: 389  YSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKP--LNEVGGCE-IEFKNVSFFYPTRP 445
              E+ +G  AA+ IF++ +    + ++  +        +  G  E I+  N+SF + + P
Sbjct: 987  VPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAP 1046

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKS 505
             N+IF +L+ ++     V IVG SG GKST++ LL   Y   SG++ I G DI   +  +
Sbjct: 1047 MNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYA 1106

Query: 506  LRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXX 565
            LRR I IV+Q+P    GT+R+N+ YGL    S  E+R V K     +F+   P+  +   
Sbjct: 1107 LRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLN--- 1163

Query: 566  XXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSM 625
                        Q QR++IAR L+++P I+ILDE TSALD  +  AI      ++  K++
Sbjct: 1164 -TRVHDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVL--KNV 1220

Query: 626  TIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            T++ I H    ++  + V+VL   G V E G + EL+++
Sbjct: 1221 TVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELFES 1258

 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 131/235 (55%), Gaps = 6/235 (2%)

Query: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
           +IEF++VSF YPTRP + + KN++ K+ +G+   IVG SG GKST+ASLLL  Y   +G+
Sbjct: 356 DIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGE 415

Query: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
           I     +I +L+   L   I +V+Q   L +GT++DN+T  + +  S  E++   +    
Sbjct: 416 IKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTI-VNKYASCTEVKQACQFALL 474

Query: 551 HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
           +  +   P+  D               Q+QR+A+ARA ++   +LILDE+ SALD+ S  
Sbjct: 475 NTVLLNLPNGID--TLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRE 532

Query: 611 AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            I        K K+  I++  H  + I+  ++ + L ++G+VVE G   +L +NP
Sbjct: 533 LIVEAIRHWRKGKTTIILT--HEYTQIKD-DEYVYLMSEGTVVESGFKYDLLENP 584

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  138 bits (348), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 227/510 (44%), Gaps = 27/510 (5%)

Query: 167  FGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFD--TFKVGDLMSRVGNDAFVVSRSIT 224
            F +  IL    E  +  LR    ++++ KD  +F        ++ S + ND   + R++ 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDLRDL-RALA 848

Query: 225  HKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDV 283
             +    + +         L  L    +L+    +++P  +  + ++G  ++    + +  
Sbjct: 849  SEFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARYKTC 908

Query: 284  TGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIG 343
              +L     +    ++T++    E N++ R   +L E+   G       G  F  AS   
Sbjct: 909  IAELENELYKAIRCMKTIKCLQME-NKVARSYEML-EVTSKGAARKRAMGTGFGVAS-SN 965

Query: 344  DLGFL---IVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAAS 400
             L F+   I+L +G  LV+ G  + G +   +    +T      L S   E+ +G  AA+
Sbjct: 966  ALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAAT 1025

Query: 401  RIFEINDKEPKIKSTTGEAKFKPLNEVGGCE----IEFKNVSFFYPTRPTNQIFKNLNFK 456
             +F++   E +  ++  + +  P+  +  C     I  K++ F Y       ++KNL+ K
Sbjct: 1026 YLFKLFGNEHEEGASVLKERHAPI--IKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLK 1083

Query: 457  VPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQE 516
            V  G  V ++G SG GKST+ SLL   Y   +G I IDG DI   + K+LR  I +V+Q+
Sbjct: 1084 VDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQK 1143

Query: 517  PILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXX 576
            P+  SG+I +N+TYGL  + S EE+  +        F+   P                  
Sbjct: 1144 PLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLH----SVIDTQLLSG 1199

Query: 577  XQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTIVSIAHRL 634
             Q QR+AI RAL++KP +L+LDE TSALD       ++   + +K      T + + H  
Sbjct: 1200 GQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSE 1255

Query: 635  STIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
              +R    ++   N G +VE G    L++ 
Sbjct: 1256 QMMRSCHRILTF-NKGEIVEEGSIDNLFNQ 1284

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
           +I F+NVSF YP+R  + + KNLN KVP G    IVG SG GKSTI++LLL  Y   SG 
Sbjct: 359 QISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGL 418

Query: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRL--VAKQC 548
           I ++  DI  +N + L R I +V+Q   L   +I++NI   LT +  +++ RL    +  
Sbjct: 419 IKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGRLSQACQAA 476

Query: 549 FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVES 608
                I       D               ++QR+A+ARA ++   ILILDEA SA D   
Sbjct: 477 MLEGVIRDLAKGLD--TIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMH 534

Query: 609 EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
           +  +        K ++  I++  H L+ I   +D ++L  DG+V+E G+  +L  +
Sbjct: 535 KDLLMEAIRFWRKGRTTIILT--HELNDILE-DDFVLLMEDGNVIERGQKSDLLSD 587

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  129 bits (324), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 138/509 (27%), Positives = 244/509 (47%), Gaps = 69/509 (13%)

Query: 192  IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLS-RE 250
            ++H  + FFD   VG +M+R   D   V + +   +   +           L+  ++ R 
Sbjct: 1082 VLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRF 1141

Query: 251  LTGALFAILPPIIWCTSVF-GKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQGFV 305
            LT A+      I++    F GK     S++L+ +         + F+    G+ T++ F 
Sbjct: 1142 LTVAV------IVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFG 1195

Query: 306  AERNEIKRFNNVLREIFQVGKES-AFINGKFFTSASL------IGDLGFLIVLTYGSYLV 358
             ER    RF  +L  + ++ + + AF    F+ S ++      +  +G  IVL  GS+++
Sbjct: 1196 DER----RF--ILENMNKIDQNNRAF----FYLSVTVKWFSFRVDMIGAFIVLASGSFIL 1245

Query: 359  MH-----GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIK 413
            ++       ++   LT  +L+T+        L   YS     + +  R+ E +  E +  
Sbjct: 1246 LNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLKEYSSIEQENY 1301

Query: 414  STTGEAKFKPLNEVGG---CEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPS 469
                E +   LNE       EIE +N+S  Y P  P   + +N++FKV   S + IVG +
Sbjct: 1302 LGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPP--VIRNVSFKVDPQSKIGIVGRT 1359

Query: 470  GRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
            G GKSTI + L      ++G I IDGQDI+ ++  +LRR I I+ Q+PIL +GTI+ N+ 
Sbjct: 1360 GAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVD 1419

Query: 530  -YGLTEE----PSKEEIRLVAKQCF--CHNFITKFPDTYDXXXXXXXXXXX----XXXXQ 578
             Y   +E     +  ++ L++   F    N   +F  T++                   +
Sbjct: 1420 PYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGE 1479

Query: 579  KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTIVSIAHRLST 636
            +Q + IAR+L+++P I++LDEATS++D +S+  I      I++S+    TI++IAHRL +
Sbjct: 1480 RQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQ----GIIRSEFNKSTILTIAHRLRS 1535

Query: 637  IRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +  ++ +IV+       + G+ KE YD P
Sbjct: 1536 VIDYDRIIVM-------DAGEVKE-YDRP 1556

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 94/392 (23%), Positives = 164/392 (41%), Gaps = 40/392 (10%)

Query: 293 EQFNGIRTVQGFVAERNEIKRFNNV----LREIFQVGKESAFINGKFFTSASLIGDLGFL 348
           E    IR V+ F  ERN I    ++    LR + +     +  +  +F + +L+  + F 
Sbjct: 532 ECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFA 591

Query: 349 IVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDK 408
           I  T+  +  ++  ++   L+ F L  +   + +  + SF ++    +   S    ++D 
Sbjct: 592 IC-TFVQHEDLNAPLAFTTLSLFTLL-KTPLDQLSNMLSFINQSKVSLKRISDFLRMDDT 649

Query: 409 EPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTN-QIFK--NLNFKVPAGSNVCI 465
           E   + T    K K         IEFKN +  +    ++   FK   LN K   G    I
Sbjct: 650 EKYNQLTISPDKNK---------IEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLI 700

Query: 466 VGPSGRGKSTIASLLLHHYNAVSGQILIDG----QDIATLNTKSLRRKIGIVQQEPILMS 521
           +G +G GKS +   LL   N +SG I++       D+   + + L        Q   L++
Sbjct: 701 LGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLN 759

Query: 522 GTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQR 581
            T+++NI +      +++    V   C     +   P                   QKQR
Sbjct: 760 DTVKNNIIFD--NFYNEDRYNKVIDACGLKRDLEILPA--GDLTEIGEKGITLSGGQKQR 815

Query: 582 IAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLS-TIR 638
           I++ARA+      ++LD+  SA+D  +   I  N   G +MK++  T + + H +S T+R
Sbjct: 816 ISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGPLMKNR--TCILVTHNVSLTLR 873

Query: 639 RFEDVIVL-----GNDGSVVEM---GKFKELY 662
                IVL      N G++ E+   G FKE Y
Sbjct: 874 NAHFAIVLENGKVKNQGTITELQSKGLFKEKY 905

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 137/549 (24%), Positives = 253/549 (46%), Gaps = 68/549 (12%)

Query: 148  LSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            LS +L G+G+   F    +  + +I  +   R   ++ + ++KN+++  L FFD+  +G 
Sbjct: 1100 LSIYL-GIGV---FQALCSSSKAIINFVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGR 1155

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTS 267
            +M+R   D   + + +T  +     S         ++  ++ +     F I+  I+    
Sbjct: 1156 IMNRFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYITPQ-----FLIVAAIVMLLF 1210

Query: 268  VFGKQIRMNS----KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAER----NEIKRFNNVL 318
             F     M+     K+L+ ++   + +   E   GI T++ F  ER    + +K+ ++  
Sbjct: 1211 YFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGITTIRAFSDERRFLVDNMKKIDDNN 1270

Query: 319  REIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFML--YTE 376
            R  F +   + +++ +       I  +G LIVL  GS+++++       L    L    +
Sbjct: 1271 RPFFYLWVCNRWLSYR-------IELIGALIVLAAGSFILLNIKSIDSGLAGISLGFAIQ 1323

Query: 377  YTGNAIFGLSSFYSELMQGVGAASRIFEIN--DKEPKIKSTTGEAKFKPLNEVGGCEIEF 434
            +T  A++ +   YS +   + +  R+ E    ++EP   S  G A   P       +IE 
Sbjct: 1324 FTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEP---SNVG-ALVPPCEWPQNGKIEV 1378

Query: 435  KNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
            K++S  Y      ++ KN+ F V +   V IVG +G GKSTI + L    +  +G I ID
Sbjct: 1379 KDLSLRYAA-GLPKVIKNVTFTVDSKCKVGIVGRTGAGKSTIITALFRFLDPETGYIKID 1437

Query: 495  GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
              DI T+  K LR+ I I+ Q+P L +GT++ N+      E S+ EI    K+    N +
Sbjct: 1438 DVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNL--DPYNEYSEAEIFEALKRV---NLV 1492

Query: 555  TK----FPDTYDXXXXXXXXX--------------XXXXXXQKQRIAIARALIKKPNILI 596
            +      P T D                             Q+Q I +AR+L++ P +++
Sbjct: 1493 SSEELGNPSTSDSTSVHSANMNKFLDLENEVSEGGSNLSQGQRQLICLARSLLRCPKVIL 1552

Query: 597  LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
            LDEAT+++D  S+  I  T  +  +  + TI++IAHRL +I  ++ ++V+       + G
Sbjct: 1553 LDEATASIDYNSDSKIQATIRE--EFSNSTILTIAHRLRSIIDYDKILVM-------DAG 1603

Query: 657  KFKELYDNP 665
            + KE YD+P
Sbjct: 1604 EVKE-YDHP 1611

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 137/626 (21%), Positives = 240/626 (38%), Gaps = 99/626 (15%)

Query: 151 FLMGVGITLIFGCFAN---FGRVVILR----IISERLVSRLRSQVV-------------- 189
           FLM +   L   C A     GR V +R    IISE     LR ++               
Sbjct: 403 FLMFLARILTAICAAQALFLGRRVCIRMKAIIISEIYSKALRRKISPNSTKEPTDVVDPQ 462

Query: 190 ----KNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSR--SITHKVADGVRSXXXXXXXXXL 243
               K  +  D E   T  +G +++ +  DAF VS   +  H   + +            
Sbjct: 463 ELNDKQHVDGDEESATTANLGAIINLMAVDAFKVSEICAYLHSFIEAIIMTIVALFLLYR 522

Query: 244 MLTLSRELTGALFAILPPIIW-CTSVFG----KQIRMNSKKLQDVTGDLTRVTEEQFNGI 298
           ++  S  +  A+     P+ +   S+ G    K + +  K++Q +         E F  I
Sbjct: 523 LIGWSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EAFQAI 574

Query: 299 RTVQGFVAERNEIKRFNNVLRE----------IFQVGKESAFINGKFFTSASLIGDLGFL 348
           R ++ F  E N  K   N   E          ++ +     FI     TSAS        
Sbjct: 575 RIIKFFSWEENFEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSAS-------- 626

Query: 349 IVLTYGSYLVMHGS-----MSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIF 403
               +  Y+ + G      ++   L+ F L      N +  LS   S ++Q   +  R+ 
Sbjct: 627 ----FAVYIYVQGQTLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQ 678

Query: 404 E-INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSN 462
           E +N++E K        K++ L  V   ++  +N +F +     +   KNL      G  
Sbjct: 679 EFLNEEETK--------KYEQLT-VSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKL 729

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPIL 519
             IVGP+G GK+++   LL     ++G++ +   + ++   +    +   I    Q   L
Sbjct: 730 NVIVGPTGSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWL 789

Query: 520 MSGTIRDNITYGLTEEPSKE-EIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXX 576
           ++ T+R+NI +     P  E     V   C    +F I    D  +              
Sbjct: 790 LNDTVRNNILFN---APYNENRYNAVISACGLKRDFEILSAGDQTE----IGEKGITLSG 842

Query: 577 XQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRL 634
            QKQR+++AR+L      L+LD+  SA+D  +   I  N   G +M+ ++  +VS  H +
Sbjct: 843 GQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNV 900

Query: 635 STIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFID 694
           +   +  D +++  +G V E G+  EL                    A+   ++      
Sbjct: 901 ALTLKNADWVIIMENGRVKEQGEPVELLQKGSLGDDSMVKSSILSRTASSVNISETN-SK 959

Query: 695 LQTNPEEKKEADNASEENGAKLDDSK 720
           + + P+   E+DNA+EE+    D SK
Sbjct: 960 ISSGPKAPAESDNANEESTTCGDRSK 985

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 129/517 (24%), Positives = 229/517 (44%), Gaps = 67/517 (12%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ + ++KN +H  L FFD+  +G +M+R   D   V + +   +               
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIV 1228

Query: 243  LMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTV 301
            L+  ++ +  G    I     +  +V+    R   K+   +T   + +   E   GI TV
Sbjct: 1229 LITLITPQFLGVAIFIAVFYWFVGAVYISGSR-ELKRFDSITKSPIYQHFSETLAGITTV 1287

Query: 302  QGFVAE----RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357
            + +  E    R  +++ +   +  F +     +++ ++ +  + I  +G  ++L  G + 
Sbjct: 1288 RAYGDESRFMRENLEKIDENNKPFFYM-----WVSNRWLSFRTQI--IGAFVILGAGGFS 1340

Query: 358  VMHGSMSIGDLTAFML-YTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN--DKEPKIKS 414
            + + +     L    L Y     +A   L  FY +    + +  RI E    D+EP  + 
Sbjct: 1341 IWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEG 1400

Query: 415  TTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473
            T       P N     +IE  +VS  Y P  P  ++ KN++F V + S V IVG +G GK
Sbjct: 1401 TVEPPADWPEN----GKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGK 1454

Query: 474  STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLT 533
            STI + L       +G I ID  DI +++ + LRR I I+ Q+P L +GTIR N+    T
Sbjct: 1455 STIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLD-PYT 1513

Query: 534  EEPSKEEIRLVAKQCFCHNFITK---------------------FPDTYDXXXXXXXXXX 572
            +   KE    +     C N +++                     F    D          
Sbjct: 1514 QYSDKE----IFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEGGS 1569

Query: 573  XXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT----FGQIMKSKSMTIV 628
                 Q+Q + +AR+L+ KP I++LDEAT+++D ES+  I  T    FG      + TI+
Sbjct: 1570 NISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFG------NSTIL 1623

Query: 629  SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +IAHRL ++  ++ ++V+       + G+ +E YD+P
Sbjct: 1624 TIAHRLRSVIDYDKILVM-------DAGEVEE-YDHP 1652

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 121/543 (22%), Positives = 212/543 (39%), Gaps = 96/543 (17%)

Query: 168 GRVVILR----IISERLVSRLRSQVVKNI-----------------IHKDLEFFDTFKVG 206
           GR + +R    IISE  +  LR Q++                    I  D E   +  VG
Sbjct: 481 GRRICIRMRSIIISEIYIKALRRQIITKTKKSTDEVDPEQLNEDSKIDGDEESTASANVG 540

Query: 207 DLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL--SRELTGAL-FAILPPII 263
            +++ +  DAF V+  I   +   + +         L+  L  S    GAL   +L P+ 
Sbjct: 541 AIINLIAVDAFKVAE-IGAYLHTFIGTIIMTFVSIYLLFNLLGSAAFIGALTIIVLIPVN 599

Query: 264 -----WCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVL 318
                W  ++  K ++   K++Q +         E F  IR ++ F  E+N    F N +
Sbjct: 600 YKIANWLGNLQQKNLKTTDKRIQKLN--------ETFQAIRIIKFFSWEKN----FENDI 647

Query: 319 REIFQ-----------VGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367
            +I +           V   S FI   FF S +++  L F       +Y +      +  
Sbjct: 648 HKIREEELYILLLRCLVWSFSTFI---FFISPTIVTSLSF-------AYYIFIQKQELTS 697

Query: 368 LTAFMLYTEYTGNAIFGL--------SSFYSELMQGVGAASRIFEINDKEPKIKSTTGEA 419
             AF      T  ++F L        ++  S ++Q   +  R+    D EP  K      
Sbjct: 698 PVAF------TALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQTFLD-EPDTK------ 744

Query: 420 KFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIAS 478
           K++ L   V   ++ FKN +  +     +   +NL+     G    ++GP+G GK+++  
Sbjct: 745 KYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLM 804

Query: 479 LLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEE 535
            LL       GQI I   D +    + +      I    Q   L++ T+R+NI +     
Sbjct: 805 ALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYN 864

Query: 536 PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNIL 595
             + +  +VA        I    D  +               QKQRI++ARAL      +
Sbjct: 865 KDRYDAAIVAAGLKRDFEILAAGDLTE----IGERGITLSGGQKQRISLARALYSNARHV 920

Query: 596 ILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
           +LD+  SA+D  +   I  N   G +M+ ++  +VS  H ++   +   ++V+  +G V 
Sbjct: 921 LLDDCLSAVDAHTAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVMLKNGRVA 978

Query: 654 EMG 656
           + G
Sbjct: 979 DQG 981

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 125/510 (24%), Positives = 233/510 (45%), Gaps = 64/510 (12%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            ++  ++H  + FFD+  +G +M+R   D      SI  ++   ++S           L L
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLLL 1184

Query: 248  SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDV----TGDLTRVTEEQFNGIRTVQG 303
               +T A F +   I+   S+ G      S++L+ +       + +   E   G+ T++ 
Sbjct: 1185 ISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRA 1244

Query: 304  FVAERNEIKRFNNVLRE----IFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVM 359
            F  E+  IK   +++ +     F +   + +++ +       I  +G L++ + G ++++
Sbjct: 1245 FGDEQRFIKENLSMIDQNSMPFFYLWVVNRWLSFR-------IDLIGALVIFSSGVFILL 1297

Query: 360  H-----GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-INDKEPKIK 413
            +       ++   LT  + +TE    A   L   YSEL   + +  R+ E +N ++  + 
Sbjct: 1298 NINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLI 1353

Query: 414  STTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRG 472
            +    A   P       ++E  N+S  Y P  P   + K++ F +     V IVG +G G
Sbjct: 1354 ADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAG 1411

Query: 473  KSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGL 532
            KSTI + L     A +G I +DG +IA ++ K LRR I I+ Q+P L +G+IR N+    
Sbjct: 1412 KSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNL--DP 1469

Query: 533  TEEPSKEEIRLVAK-----------------QCFCHNFITKFPDTYDXXXXXXXXXXXXX 575
             +E S EEI    K                 Q      + KF    +             
Sbjct: 1470 YDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKF---LNLESEIAEGGSNFS 1526

Query: 576  XXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLS 635
              Q+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  Q  +  + T+++IAHRL 
Sbjct: 1527 QGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHRLR 1584

Query: 636  TIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +I  ++ ++V+       + G+ KE +D+P
Sbjct: 1585 SIVDYDKILVM-------DAGEVKE-FDHP 1606

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 118/267 (44%), Gaps = 24/267 (8%)

Query: 407 DKEPKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCI 465
           D+  +   T    K+  L  +  G  + F+NV+  + +   + + +NL+ +   G    I
Sbjct: 680 DRVQRFLETEETDKYDQLTVDKNGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVI 739

Query: 466 VGPSGRGKSTIASLLLHHYNAVSGQILI-------DGQDIATLNTKSLRRKIGIVQQEPI 518
           VG +G GK++I   LL       G+I++       + Q  A +   S    I    Q   
Sbjct: 740 VGATGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAGVINDS----IAYCSQAAW 795

Query: 519 LMSGTIRDNITYGLTEEPSKEEIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXX 576
           L++ T+R+NI +    + ++ +   V + C    +F I K  D+ +              
Sbjct: 796 LLNDTVRNNILFNAPFDQARYDA--VVEACSLKRDFQILKAGDSTE----IGEKGITLSG 849

Query: 577 XQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRL 634
            QKQR+++ARAL      L+LD+  SA+D  +   I      G +M+ +  T + + H +
Sbjct: 850 GQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEGR--TCILVTHNI 907

Query: 635 STIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +   +  D +V+  DG V E G   EL
Sbjct: 908 ALTMKNADFVVMIEDGKVKEKGTPIEL 934

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 137/551 (24%), Positives = 240/551 (43%), Gaps = 64/551 (11%)

Query: 149  STFLMGVGITLIF-GCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            ++F MG+    +F G      +  +L  I  R    L  + V  I+H  + + DT  +G 
Sbjct: 948  TSFYMGLYSFFVFAGYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGR 1007

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGA---------LFAI 258
            +++R   D    + S+ +++ + +R          LML  +  + G           FAI
Sbjct: 1008 ILNRFTKD----TDSLDNELTESIR----------LMLFQTANIVGVCVMCIIYLPWFAI 1053

Query: 259  LPPIIWCT-SVFGKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQGFVAERNEIKR 313
              P ++   ++     +   ++++ +           FN    G+ T++ + +E   + +
Sbjct: 1054 AIPFLFIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAK 1113

Query: 314  FNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-GSMSIGDLTAFM 372
             + ++ ++ + G  S  +         L+     LI+         H  ++S+G L  ++
Sbjct: 1114 SDYLINKMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYV 1173

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEI 432
            L      N   G+    ++    + +A R+     + P   +        P N     +I
Sbjct: 1174 LQLPGLLN---GVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPPENWPSEGKI 1230

Query: 433  EFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
            EFK+V F Y P  P   + K+L+  + +G  + I G +G GKSTI S L        G+I
Sbjct: 1231 EFKHVDFSYRPGLPI--VLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEI 1288

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------ITYGLTEE 535
            LID  DI+ L    LRRK+ I+ Q+P+L  GTIR N                +  G  E 
Sbjct: 1289 LIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAIER 1348

Query: 536  PSKEEIR--LVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
             +  +I+   V K    H  + KF                    ++Q +A+ RAL+++  
Sbjct: 1349 AALNKIKNQKVDKDG-THADMFKF----HLDQLVEEEGANFSLGERQLLALTRALVRQAK 1403

Query: 594  ILILDEATSALDVESEGAINYTFGQIMKS-KSMTIVSIAHRLSTIRRFEDVIVLGNDGSV 652
            +LILDEATS++D E++G I     +I+K     TI+ IAHRL+TI  ++ ++VL   G V
Sbjct: 1404 VLILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEV 1459

Query: 653  VEMGKFKELYD 663
             E  K K L+D
Sbjct: 1460 AEFEKPKVLFD 1470

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 21/203 (10%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F ++   +  G  + +VGP G GK++  + L    N   G+I ++G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
             ++   P + + T+RDNI +G   +  K E   V + C     +   P           
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPA--GDSTEIGE 728

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIV 628
                   QK RI +AR + KK +I + D+  SA+D    +  ++  F  ++K+++  + 
Sbjct: 729 RGITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILA 788

Query: 629 SIAHRLSTIRRFEDVIVLGNDGS 651
           +  H+LS + R   VIVLG DGS
Sbjct: 789 T--HQLSLLERASRVIVLGTDGS 809

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 137/557 (24%), Positives = 243/557 (43%), Gaps = 74/557 (13%)

Query: 149  STFLMGVGITLIFGCFA----NFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFK 204
            ++F MG+    +FG +      F  + ++ I++ +    L  + VK I+H  + + DT  
Sbjct: 932  TSFYMGLYSFFVFGGYLFMNIQFTMLCMMGIMASKW---LNLKAVKRILHAPMSYLDTTP 988

Query: 205  VGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGA---------L 255
            +G +++R   D    + S+ +++ + +R          LM++    + G           
Sbjct: 989  LGRILNRFTKD----TDSLDNELTENIR----------LMMSQFANIIGVCVLCIVYLPW 1034

Query: 256  FAILPPIIWCTSVF--------GKQI-RMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVA 306
            FAI  P +    V         G++I R+ + +   V  +L  V      G+ T++ + +
Sbjct: 1035 FAIAIPFLLLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEV----LGGMDTIKAYKS 1090

Query: 307  ERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMS-I 365
            +   + + + ++ ++ +V      +         +I     LI+         H S S +
Sbjct: 1091 QDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISPSAV 1150

Query: 366  GDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN 425
            G L  ++L      N +       ++    + +A R+     + P+  +        P N
Sbjct: 1151 GVLLTYVLQLPGLLNTVL---RALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDN 1207

Query: 426  EVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
                 E+ F++VSF Y P  PT  + KN+N  +  G  + I G +G GKSTI + L    
Sbjct: 1208 WPTNGEVIFEDVSFAYRPGLPT--VLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 485  NAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------I 528
               SG+I IDG D   L    LRRK+ I+ Q+P+L  GTIR N                I
Sbjct: 1266 ELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLI 1325

Query: 529  TYGLTEEPSKEEIRLVA-KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARA 587
              G  E+   E+I+     +   +N + KF                    ++Q +A+ RA
Sbjct: 1326 RGGAIEKDDLEDIKHQKPDKNGSYNNMHKF----HLDQIVEEDGANFSLGERQVLALTRA 1381

Query: 588  LIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLG 647
            L+++  ILILDEATS++D E++G I        + +  TI+ IAHRL TI  ++ ++VL 
Sbjct: 1382 LVRQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL- 1438

Query: 648  NDGSVVEMGKFKELYDN 664
              G V E  K + L++N
Sbjct: 1439 EKGEVAEFDKPEILFNN 1455

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 101/215 (46%), Gaps = 26/215 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F NLNF++  G  + I GP G GKS++ + +       +G++ I+G              
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH------------- 663

Query: 510 IGIVQQEPILMSGTIRDNITYG--LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
             ++   P + + T+RDNI +G     E  KE IR+    C     I   P         
Sbjct: 664 -MLLCGYPWIQNATVRDNIIFGSPYDREKYKEVIRV----CSLQADIDILPA--GDMTEI 716

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMT 626
                     QK RI +AR++ K  +I + D+  SA+D    +  ++  F Q ++SK+  
Sbjct: 717 GERGITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRI 776

Query: 627 IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           + +  H+LS I + + VIVL  +GS V++G  +EL
Sbjct: 777 LAT--HQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 138/540 (25%), Positives = 239/540 (44%), Gaps = 54/540 (10%)

Query: 149  STFLMGVGITLIFGC-FANFGRVVILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVG 206
            + + + +  TL F    AN  + +IL I      S+ L S +  +I    + FF+T  +G
Sbjct: 982  AAYYLFIYFTLGFASSLANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIG 1041

Query: 207  DLMSRVGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPI 262
             +++R  ND +    ++ RS +    + +R            + +    T     ++ P+
Sbjct: 1042 RILNRFSNDVYKIDEILGRSFSQFFQNTIR--------VSFTIVVICSTTWQFIFLIIPM 1093

Query: 263  IWCTSVFGKQIRMNSKKLQDVTGD----LTRVTEEQFNGIRTVQGFVAERNEIKRFNNVL 318
             +    + +     S++L+ +       L    +E   G+ T++GF  +     RF ++ 
Sbjct: 1094 AFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQ----DRFIHIN 1149

Query: 319  REIFQVGKESAF--INGKFFTSASL--IGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLY 374
            +        + +  IN   + +  L  +G L  L   T   + + +GS++ G +   M Y
Sbjct: 1150 QSRVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIGLSMSY 1209

Query: 375  TEYTGNAIFGLSSFYSELMQGVGAASRIFEIN---DKEPKIKSTTGEAKFKPLNEVGGCE 431
                  ++  +     ++   + +  RI E +    + P I      ++  P        
Sbjct: 1210 ALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEEWP----SKGA 1265

Query: 432  IEFKNVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
            IEFKN S  Y  RP  + + KN+N K+     V IVG +G GKS++   L     A SG 
Sbjct: 1266 IEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGS 1323

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
            I IDG +I  L    LR K+ I+ Q+  +  G+IR+NI    T++ S++EI    +    
Sbjct: 1324 IEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNALEMAHL 1381

Query: 551  HNFITKF----PDTYDXXXXXXXXXXXXXXX---------QKQRIAIARALIKKPNILIL 597
               I K     P++ +                        Q+Q I +ARAL+   N+LIL
Sbjct: 1382 KPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLIL 1441

Query: 598  DEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGK 657
            DEAT+A+DVE++  I +T     K +  TI++IAHR++TI   + +IVL N G V E  K
Sbjct: 1442 DEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDK 1498

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 96/225 (42%), Gaps = 20/225 (8%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           N +F +  +P  ++  KN+NF+   G   CIVG  G GKS     +L     V G   I 
Sbjct: 619 NATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVKGFASIH 678

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G              +  V Q   +M+GT++DNI +G   +P   E  +  K C     +
Sbjct: 679 GN-------------VAYVSQLAWIMNGTVKDNIIFGHRYDPEFYEKTI--KACALTIDL 723

Query: 555 TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAIN 613
           +  PD                  QK R+++ARA+  + +I +LD+  +A+D   S+  I 
Sbjct: 724 SILPD--GDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQ 781

Query: 614 YTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKF 658
              G     KS T +   +++  +    D I L  +G + E G +
Sbjct: 782 NVLGAKGLLKSKTRILTTNKIPVL-SIADSITLLENGEITEQGTY 825

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 144/551 (26%), Positives = 239/551 (43%), Gaps = 79/551 (14%)

Query: 151  FLMGVGITLIF---GCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            FL+GV  ++I    G F+ F  V    +I ++L+ R        +++  L FFD   +G 
Sbjct: 1107 FLIGVTHSIISSTRGIFSFFAGVNTANLIFKKLLYR--------VVNSKLTFFDNTPIGR 1158

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTS 267
            +M+R   D  V+   +     DGV S         +++          F I+   I C+S
Sbjct: 1159 IMNRFSKDIQVLDSELA-PFLDGVFSCFIQAVTALMLIVF----ITPKFLIIAIFIICSS 1213

Query: 268  V-FGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAER---NEIKRFNNVLREIFQ 323
            +  G      S++L+           + F    T+ G V  R   NEIK     L+E   
Sbjct: 1214 ITIGYLYLCCSRELKRFESSSKSPVYQHFT--ETLSGLVTIRAFGNEIK----FLKENLD 1267

Query: 324  VGKESAFINGKFFTSASL-------IGDLGFLIVLTYGSYLVMHGS-----MSIGDLTAF 371
               E+   N  FF   S+       I  LG + V   G++++++       ++   LT  
Sbjct: 1268 FIDEN---NKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLNADKIDAGLAGISLTYA 1324

Query: 372  MLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCE 431
            + +TE+       +  FYS +   + +  R+ E  + E +  +  G         V G  
Sbjct: 1325 VTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPGAITPSENWPVQGA- 1379

Query: 432  IEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
            I F N S  Y P  P   + K LN K+  GS + +VG +G GKSTI S L    +  SG+
Sbjct: 1380 ITFANYSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTGAGKSTIISALFRFLDCSSGK 1437

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIR--LVAKQC 548
            ILID  DI+ +N + LR  + I+ Q+P L  GTIR N+     EE   ++I   LV    
Sbjct: 1438 ILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNL--DPNEEYENKDIYDALVKVHL 1495

Query: 549  FCHNFITKFPDTYDXXXXXXXXXXXXXXX--------------QKQRIAIARALIKKPNI 594
               +++      YD                             Q+Q I +AR+++    I
Sbjct: 1496 LTEDYLANL--NYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLICLARSILHCSKI 1553

Query: 595  LILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            ++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++  ++ ++VL + G  +E
Sbjct: 1554 VLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKILVL-DAGQALE 1610

Query: 655  MGKFKELYDNP 665
                   +D+P
Sbjct: 1611 -------FDHP 1614

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 95/385 (24%), Positives = 165/385 (42%), Gaps = 48/385 (12%)

Query: 293 EQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAF---ING-KFFTSASLIGDLGFL 348
           E F  IR ++ F  E N I++   +  +   V K ++    IN   ++ S ++I  L F 
Sbjct: 582 ETFQSIRIIKSFGWENNIIQKILGLRNKEISVLKRNSITWSINALVWYLSPTIITTLSF- 640

Query: 349 IVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGL--------SSFYSELMQGVGAAS 400
                 SY ++     +    AF      T  A+F L        S+  + L Q   +  
Sbjct: 641 ------SYYILVDKQDLTTPVAF------TALALFNLLKAPLDQLSNTINFLTQSKVSLD 688

Query: 401 RIFEINDKEPKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPA 459
           RI    +K   +K TT   KF+ L+ +     + F   +  +     +   +N+N +   
Sbjct: 689 RI----EKFLSVKETT---KFENLSVDSSQNRLAFSGATLGWCGNKKSFQLRNINAEFEM 741

Query: 460 GSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN----TKSLRRKIGIVQQ 515
           G    ++GP+G GK+++   LL   +  SG++ +   + +  N    + +L   I    Q
Sbjct: 742 GKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFNLIPESDNLLNSIAYCSQ 800

Query: 516 EPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXX 575
            P + + TIR+NI + +  +  + E  ++A        I    D                
Sbjct: 801 LPWIFNDTIRNNIIFDMGYDKDRYENVVIACGLERDFQILNLGDK----TIVGDKGSCLS 856

Query: 576 XXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF--GQIMKSKSMTIVSIAHR 633
             QKQRI++ARAL  K   LILD+  SA+D  S   I      G +M+ ++  +VS  H 
Sbjct: 857 GGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWIYNVCITGPLMQGRTCILVS--HN 914

Query: 634 LS-TIRRFEDVIVLGNDGSVVEMGK 657
           +S TI++   V ++ N G +V  G+
Sbjct: 915 VSLTIKKASKVFMIEN-GYIVASGR 938

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 143/575 (24%), Positives = 246/575 (42%), Gaps = 74/575 (12%)

Query: 120  IIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANF-GRVVILRIISE 178
            ++GT   +L ++   L+  ++ K  N P S F MG+    +F  F    G+  IL  +  
Sbjct: 904  VVGTTFCSLFSSVW-LSYWTENKFKNRPPS-FYMGLYSFFVFAAFIFMNGQFTILCAMGI 961

Query: 179  RLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXX 238
                 L  + VK I+H  + + DT  +G +++R   D    + S+ +++ + +R      
Sbjct: 962  MASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNELTESLR------ 1011

Query: 239  XXXXLMLTLSRELTGA---------LFAILPPIIWCTSVF--------GKQI-RMNSKKL 280
                LM +    + G           FAI  P +    V         G++I R+ + + 
Sbjct: 1012 ----LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQR 1067

Query: 281  QDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFIN---GKFFT 337
              V  +L  V      G+ T++ + ++   + + + ++ ++ + G     +    G F  
Sbjct: 1068 SFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLD 1123

Query: 338  SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
              ++      +I L   +      + S+G L  ++L      N I       ++    + 
Sbjct: 1124 MVAIA--FALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTIL---RAMTQTENDMN 1178

Query: 398  AASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFK 456
            +A R+     + P   S        P +     EI F+NV F Y P  P   + KNLN  
Sbjct: 1179 SAERLVTYATELPLEASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPI--VLKNLNLN 1236

Query: 457  VPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQE 516
            + +G  + I G +G GKSTI S L       +G+ILID  DI+ L    LRRK+ I+ Q+
Sbjct: 1237 IKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQD 1296

Query: 517  PILMSGTIRDN----------------ITYGLTEEPSKEEIRLVA-KQCFCHNFITKFPD 559
            P+L  GTIR N                +  G   +    E++L    +   H  + KF  
Sbjct: 1297 PVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKF-- 1354

Query: 560  TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQI 619
                              ++Q +A+ RAL+++  ILILDEATS++D E++G I      +
Sbjct: 1355 --HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRI--V 1410

Query: 620  MKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
             +    TI+ IAHRL TI  ++ ++VL   G V E
Sbjct: 1411 EEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAE 1444

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 100/214 (46%), Gaps = 24/214 (11%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FK+LNF +  G  + I GP G GKS++ + +        G++ ++G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEP-SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
             ++   P + + ++RDNI +G    P +KE+   V + C     +   P          
Sbjct: 652 --LMCGYPWIQNASVRDNIIFG---SPFNKEKYDEVVRVCSLKADLDILP--AGDMTEIG 704

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTI 627
                    QK RI +AR++ KK +I + D+  SA+D    +  ++     ++ +K+  +
Sbjct: 705 ERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRIL 764

Query: 628 VSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +  H+LS I R   VIVLG DG  V++G   EL
Sbjct: 765 AT--HQLSLIERASRVIVLGTDGQ-VDIGTVDEL 795

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 138/564 (24%), Positives = 250/564 (44%), Gaps = 52/564 (9%)

Query: 120  IIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANF-GRVVILRIISE 178
            ++GT   +L ++   L+  ++ K  N P S F MG+    +F  F    G+  IL ++  
Sbjct: 904  VVGTTFCSLFSSVW-LSYWTENKFKNRPPS-FYMGLYSFFVFAAFIFMNGQYTILCVMGI 961

Query: 179  RLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXX 238
                 L  + VK I+H  + + DT  +G +++R   D    + S+ +++ + +R      
Sbjct: 962  MASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLLTSQF 1017

Query: 239  XXXXLMLTLSRELTGALFAILPPIIWCTSVF--------GKQI-RMNSKKLQDVTGDLTR 289
                 +  +   +    FAI  P +    V         G++I R+ + +   V  +L  
Sbjct: 1018 ANIVGVCVMCI-VYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNE 1076

Query: 290  VTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFIN---GKFFTSASLIGDLG 346
            V      G+ T++ + ++   + + + ++ ++ + G     +    G F    +++  L 
Sbjct: 1077 V----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGVFLDMVAIVFALI 1132

Query: 347  FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN 406
              ++    ++ +   + S+G L  ++L      N I       ++    + +A R+    
Sbjct: 1133 VTLLCVTRAFPI--SAASVGVLLTYVLQLPGLLNTIL---RAMTQTENDMNSAERLVSYA 1187

Query: 407  DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCI 465
             + P            P +     EI  +NV F Y P  P   + KNLN  + +G  + I
Sbjct: 1188 TELPLEADYRKPEMTPPESWPSKGEIVLENVCFSYRPGLPV--VLKNLNLNIESGEKIGI 1245

Query: 466  VGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIR 525
             G +G GKSTI S L       +G+ILID  DI+ L    LRRK+ I+ Q+P+L  GTIR
Sbjct: 1246 CGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIR 1305

Query: 526  DNITYGLTEEPSKEEIR--LVAKQCFCHNFITKF----PD---------TYDXXXXXXXX 570
             N+     +E + +E+   LV       N +++     PD          +         
Sbjct: 1306 KNL--DPFDERTDDELWDALVRGGAIAKNDLSEAKLQKPDKNGTHGRMHKFHLDQAVEEE 1363

Query: 571  XXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSI 630
                   ++Q +A+ RAL+++  ILILDEATS++D E++G I      + +    TI+ I
Sbjct: 1364 GSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQARI--VEEFGDCTILCI 1421

Query: 631  AHRLSTIRRFEDVIVLGNDGSVVE 654
            AHRL TI  ++ ++VL   G V E
Sbjct: 1422 AHRLQTIVNYDRILVL-EKGEVAE 1444

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 98/215 (45%), Gaps = 26/215 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FK+LNF++  G  + I GP G GKS++ + +        G+I ++G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYG--LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
             ++   P + +  +RDNI +G    +E   E IR+    C     +   P         
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPFIKEKYNEVIRV----CSLKADLDILPA--GDMTEI 703

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMT 626
                     QK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K+  
Sbjct: 704 GERGITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRI 763

Query: 627 IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           + +  H+LS I R   VIVLG DG  V++G   EL
Sbjct: 764 LAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDEL 795

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 127/525 (24%), Positives = 233/525 (44%), Gaps = 32/525 (6%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVGDLM 209
            F +G+G  L     +   + V+L +      SR L   +  +++   + FF+T  +G ++
Sbjct: 981  FALGIGSAL-----STLVQTVVLWVFCTIHGSRYLHDAMASSVLRAPMSFFETTPIGRIL 1035

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
            +R  ND + V   +    +    +         ++ T + +    +  +LP  +      
Sbjct: 1036 NRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQF---ILVVLPLSVLYIYYQ 1092

Query: 270  GKQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGK 326
               +R +   ++L  VT   +    +E   G+ T++G+     + KRF ++ +       
Sbjct: 1093 QYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGY----GQQKRFAHINQARID-NN 1147

Query: 327  ESAF---INGKFFTSASL--IGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNA 381
             SAF   +N   + +  L  +G +  L   T   + +  G+++ G +   + Y      +
Sbjct: 1148 MSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLSYALQITQS 1207

Query: 382  IFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY 441
            +  +     E+   + +  RI E  + +P+  +   E+   P       +I F++ S  Y
Sbjct: 1208 LNWIVRMTVEVETNIVSVERIKEYAELKPEAPAII-ESSRPPKGWPSQGDIRFEHYSTRY 1266

Query: 442  PTRPTNQ-IFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
              RP  Q I +++N  + A   V IVG +G GKS++   L     A  G I IDG    T
Sbjct: 1267 --RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDT 1324

Query: 501  LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
            +    LR K+ I+ Q+  + +GT+R+N+    TEE + EEI    +       +    + 
Sbjct: 1325 IGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLKEHVMSMGND 1382

Query: 561  YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
                             Q+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     
Sbjct: 1383 -GLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIRTAF 1441

Query: 621  KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            K++  TI++IAHR++TI   + +IVL N+G V E    + L   P
Sbjct: 1442 KNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRP 1483

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 99/445 (22%), Positives = 185/445 (41%), Gaps = 79/445 (17%)

Query: 254 ALFAILPPIIWC-TSVFGKQIRMNS------KKLQDVT----GDLTRVTEEQFNGIRTVQ 302
           +L+++L P +W    +    I +NS      K LQ +      + TRV  E  N I++++
Sbjct: 430 SLYSLLGPCMWVGVIIMVVMIPINSIIMKYQKNLQKIQMKNKDERTRVISEILNNIKSLK 489

Query: 303 GFVAERNEIKRFNNV-----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357
            +  E    K+ + V     L+ + ++G   A  + +F     L+    F + +      
Sbjct: 490 LYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLVSCSTFAVFVMTQKGR 549

Query: 358 VMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI--FEIND-------- 407
            +   +    LT F L +         ++SF    ++   + +R+  F  N+        
Sbjct: 550 ALTTDLVFPALTLFNLLSFPLAVVPNAITSF----IEASVSVNRLHSFLTNEELQKDSVS 605

Query: 408 KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIV 466
           +EP + S  G+   K    VGG      + +F +  +P  ++  KN+NF+   G   CIV
Sbjct: 606 REPSVTSK-GDIAVK----VGG------DATFLWQRKPEYKVALKNINFQAKKGELTCIV 654

Query: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
           G  G GKS +   +L     V G   I G              +  V Q P +M+GT+++
Sbjct: 655 GRVGSGKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKE 701

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
           NI +G   +PS  E     K C  +  ++  P                   QK R+++AR
Sbjct: 702 NILFGHKYDPSFYE--KTVKACALNVDLSILPQ--GDQTLVGEKGISLSGGQKARLSLAR 757

Query: 587 ALIKKPNILILDEATSALDVE-SEGAINYTFG---------QIMKSKSMTIVSIAHRLST 636
           A+  + +  +LD+  +A+D   ++  ++   G         +++ +  +T++SIA     
Sbjct: 758 AVYSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIA----- 812

Query: 637 IRRFEDVIVLGNDGSVVEMGKFKEL 661
                D I L  +G +V+ G + E+
Sbjct: 813 -----DSIALLENGEIVQQGSYDEV 832

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 133/515 (25%), Positives = 227/515 (44%), Gaps = 61/515 (11%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ + ++  +IH  L FFDT  +G +M+R   D   V + +T  +     S         
Sbjct: 1193 KIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTII 1252

Query: 243  LMLTLSRELTGALFAILPPIIW-CTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRT 300
            L+  ++ +    + AIL  I++     F        K+L  +T   + +   E   G+ T
Sbjct: 1253 LISWITPQF--FVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTT 1310

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESA-----FINGKFFTSASLIGDLGFLIVLTYGS 355
            ++ F  E   +K        +F++ + +      ++  ++ +    I  +G  +V   G 
Sbjct: 1311 IRAFGDEMRFLKE------NLFKIDENNKPFFYLWVANRWLSFR--IDMIGSFVVFGAGV 1362

Query: 356  YLV-----MHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEP 410
            +++     +   M+   LT  + +TE        L  FYSE+   + +  RI E    E 
Sbjct: 1363 FILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERIKEYMSVEQ 1418

Query: 411  KIKSTTGE-AKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPS 469
            +      E  +  P       +IE  ++S  Y      ++ KN++F V   S V +VG +
Sbjct: 1419 EPYDIKDEIVRTPPTVWPDEGKIEVNDLSLRYAAN-LPRVIKNVSFTVEPNSKVGVVGRT 1477

Query: 470  GRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN-- 527
            G GKSTI + L    +  SG I ID  DI T+    LRR I I+ Q+P L +GT++ N  
Sbjct: 1478 GAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLD 1537

Query: 528  ---------ITYGLTE------EPSKEEIRLVAKQCFCH-NFITKFPDTYDXXXXXXXXX 571
                     I   LT       E    E   V+ Q   H N   +F    D         
Sbjct: 1538 PYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRF---LDLSNEITEGG 1594

Query: 572  XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-GQIMKSKSMTIVSI 630
                  Q+Q I +AR+L++ P IL+LDEAT+++D ES+  +  T  G+   S   TI++I
Sbjct: 1595 GNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGNS---TILTI 1651

Query: 631  AHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            AHRL ++  ++ ++V+ + G V+E       YD+P
Sbjct: 1652 AHRLRSVIDYDKILVM-DAGEVIE-------YDHP 1678

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 110/241 (45%), Gaps = 13/241 (5%)

Query: 429 GCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVS 488
           G ++ F N +  + T  +    +NLN     G    ++G +G GK+++   LL   +   
Sbjct: 756 GKKLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQ 815

Query: 489 GQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVA 545
           G+I++   + +   T N+      I    Q   L++ T+R+NI +  + + ++   ++V 
Sbjct: 816 GRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFDENRYH-KVVE 874

Query: 546 KQCFCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
                 +F I K  D  +               QKQRI++ARAL      L+LD+  SA+
Sbjct: 875 ACGLKRDFDILKAGDLTEIGEKGITLSGG----QKQRISLARALYSDSKHLLLDDCLSAV 930

Query: 605 DVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
           D  +   I  N   G +M  ++  +VS  H ++   R  +++V+  DG V + G    L+
Sbjct: 931 DSHTASWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQGDPLNLF 988

Query: 663 D 663
           D
Sbjct: 989 D 989

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 125/511 (24%), Positives = 224/511 (43%), Gaps = 61/511 (11%)

Query: 187  QVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLT 246
            +++  ++H  L FFD+  +G +M+R   D   + + +         S         L+  
Sbjct: 1133 KLLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITF 1192

Query: 247  LSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTVQGFV 305
            ++ +       I+  + +    F        K+L  +T   + +   E   G+ T++ F 
Sbjct: 1193 ITPQFLSVAI-IVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTIRAFG 1251

Query: 306  AE----RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLV--- 358
             E    R  + + +   R  F +   + +++ +       I  +G L+V   G +++   
Sbjct: 1252 DESRFLRENLLKIDENNRPFFYLWVANRWLSFR-------IDVIGALVVFGSGIFILTNI 1304

Query: 359  --MHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN--DKEPKIKS 414
              +   M+   LT  + +TE        L  FYSE+   + +  R+ E    ++EP  + 
Sbjct: 1305 NTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDEV 1360

Query: 415  TTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
               ++K  P +      IE  ++S  Y      ++ KN+ F V   + V +VG +G GKS
Sbjct: 1361 QVSDSKV-PADWPEEGRIEVSDLSLRYAAH-LPKVIKNVTFNVDPRAKVGVVGRTGAGKS 1418

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE 534
            TI + L     A +G I IDG DI ++N   LRR I I+ Q+P L SGTI+ N+     +
Sbjct: 1419 TIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNL--DPYD 1476

Query: 535  EPSKEE-------IRLVAKQ-------------CFCHNFITKFPDTYDXXXXXXXXXXXX 574
            E   EE       + LV ++                   I +F    D            
Sbjct: 1477 EYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRF---LDLESEIAEGGTNF 1533

Query: 575  XXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRL 634
               Q+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T     +    TI++IAHRL
Sbjct: 1534 SQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIAHRL 1591

Query: 635  STIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
             ++  ++ ++V+G        G+ KE YD+P
Sbjct: 1592 RSVIDYDKILVMG-------AGEVKE-YDHP 1614

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 106/234 (45%), Gaps = 17/234 (7%)

Query: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
           +I FKN +  +     +   +NLN     G    I+GP+G GK+++   LL   N + GQ
Sbjct: 700 QIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEGQ 759

Query: 491 ILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKE-EIRLVAK 546
           I++   + +    + +      I    Q   L++ T+R+NI +     P  E     V +
Sbjct: 760 IVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFN---SPYNETRYHNVVE 816

Query: 547 QC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
            C    +F I K  D  +               QKQRI++ARAL      ++LD+  SA+
Sbjct: 817 ACGLRRDFEILKAGDMTE----IGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAV 872

Query: 605 DVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
           D  +   +  N   G +M+ ++  +VS  H ++   R  D++V+  DG V + G
Sbjct: 873 DAHTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 122/509 (23%), Positives = 230/509 (45%), Gaps = 55/509 (10%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            R+  +++  ++H  L F D+  +G +M+R   D   V + +T  +               
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 243  LMLTLSRELTGALFAILPPIIW-CTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRT 300
            L+  ++ +      A+L  +++     F        K+++ +T   + +   E   G+ T
Sbjct: 1201 LITFITPQFL--FVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGVAT 1258

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH 360
            ++ F    +EI+   + L +I +  K   ++       A  I  +G LI+   G +++++
Sbjct: 1259 IRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFILLN 1315

Query: 361  -----GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KEPKIK 413
                   M+   LT  + +TE        L  FYS +   + +  R+ E  D  +EP  +
Sbjct: 1316 LNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNE 1371

Query: 414  STTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473
             T   +   P       +IE K++S  Y      ++ K ++F +   + V IVG +G GK
Sbjct: 1372 GTITTSTNWPTE----GKIEVKDLSLRYAEN-LPRVIKEVSFDIEPHNMVGIVGRTGAGK 1426

Query: 474  STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YGL 532
            STI + L       +G I IDG DI +++ ++LRR I I+ Q+P L +GTIR N+  +G 
Sbjct: 1427 STIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFG- 1485

Query: 533  TEEPSKEEIRLVAKQCFCHN----------------FITKFPDTYDXXXXXXXXXXXXXX 576
             + P +E  R++ +     +                 + KF    +              
Sbjct: 1486 -KYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKF---LNLENEITEGGNNLSQ 1541

Query: 577  XQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLST 636
             QKQ + +ARAL++ P +++LDEAT+++D  S+  I  T   +      T+++IAHRL +
Sbjct: 1542 GQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRS 1599

Query: 637  IRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +  ++ ++V+ + G V+E       YD P
Sbjct: 1600 VIDYDKILVM-DAGEVIE-------YDQP 1620

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 109/473 (23%), Positives = 196/473 (41%), Gaps = 45/473 (9%)

Query: 202 TFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL--SRELTGALFAI- 258
           T  +G +++ +  DAF VS  I   +   + +         L+  L     + G L  I 
Sbjct: 491 TSNIGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGILIVIG 549

Query: 259 -LPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV 317
            +P      S+ GK      KK   +T    +   E    IR ++ F  E N     + +
Sbjct: 550 MIPVNFKLVSLMGKY----QKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSEIDEI 605

Query: 318 LREIFQ--VGKESAFINGKF--FTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFML 373
                Q  + K  A+    F  F + +++    F + + Y    V+   ++   L  F L
Sbjct: 606 REAEIQMYINKAYAWAFSAFIWFLTPTIVTGASFTVYI-YVQKQVLTAPVAFTALALFQL 664

Query: 374 YTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIE 433
             +     +  LS+  S ++Q   +  R+    D+E   K    + K  P     G ++ 
Sbjct: 665 LKQ----PLDQLSNMLSYVIQSKVSLDRVQNFLDEEDTQK--YNQLKVAP----DGNKLA 714

Query: 434 FKNVSFFYPTRPTNQIFK----NLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489
           F+N +  +     NQ FK    ++NFK+  G    ++GP+G GK+++   LL     +SG
Sbjct: 715 FENATIAWSN--NNQDFKLKDLDINFKI--GKLNVVIGPTGSGKTSLLLALLGEMQLLSG 770

Query: 490 QILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE-IRLVA 545
           +I++   D +    +++  +   I    Q   L++ T+R+NI   L   P  E+  + V 
Sbjct: 771 RIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVI 827

Query: 546 KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD 605
             C        F D  D               QKQRI++ARAL      L+LD+  SA+D
Sbjct: 828 IACGLKRDFELF-DAGD-QTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVD 885

Query: 606 VESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
             +   I  N   G +M+ ++  +VS  H ++   +  +++V+  +G +   G
Sbjct: 886 SHTAAWIYDNCITGPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 130/504 (25%), Positives = 227/504 (45%), Gaps = 55/504 (10%)

Query: 192  IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSREL 251
            ++H  + FFD   VG +M+R   D       I  ++   +            +L L   +
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDI----EGIDQELIPYLEVTVFCLIQCSSILLLIVVI 1137

Query: 252  TGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQGFVAE 307
            T   F++   +       GK     S+ L+ +         + F+    G+ T++ F  E
Sbjct: 1138 TPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAFGDE 1197

Query: 308  RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-----GS 362
            +  I    N + +I Q  K   +++      A  +  +G  IVL  GS+++ +       
Sbjct: 1198 KRFI--LEN-MEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILFNIDNIDSG 1254

Query: 363  MSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFK 422
            ++   LT  +L+T+    +   L   YS     + +  R+ E +    +      E   +
Sbjct: 1255 LAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIVQEKYLGYDEDHIQ 1310

Query: 423  PLNEVGG---CEIEFKNVSFFYPTR-PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIAS 478
             LN+       +IE +N+S  Y +  P   + KN+ FKV   S V IVG +G GKSTI +
Sbjct: 1311 ALNDSSWPKHGKIEVENLSLRYASNLPL--VLKNVCFKVDPQSKVGIVGRTGAGKSTIIA 1368

Query: 479  LLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSK 538
             L      V+G I ID QDI+ ++  +LRR I I+ Q+P+L +GTI+ NI      +P  
Sbjct: 1369 ALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNI------DPHD 1422

Query: 539  E-EIRLVAKQCFCHNFIT--KFPDTYDXXXXXXXXXXXXXXX-------------QKQRI 582
            E + R + K     N I+  +F   ++                            ++Q +
Sbjct: 1423 EYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIVEGGLNLSQGERQLL 1482

Query: 583  AIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTIVSIAHRLSTIRRF 640
             IAR+L+++  I++LDEATS++D +S+  I      I++SK    TI++IAHRL ++  +
Sbjct: 1483 FIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHRLRSVIYY 1538

Query: 641  EDVIVLGNDGSVVEMGKFKELYDN 664
            + ++V+ + G + E G   EL  N
Sbjct: 1539 DKILVM-DAGEIKEYGHPYELLKN 1561

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 103/241 (42%), Gaps = 18/241 (7%)

Query: 431 EIEFKNVSFFYPTRPTNQIFK----NLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
           +IEFK  +  +     N I K    +LN     G    ++G +G GKS +   LL   + 
Sbjct: 663 KIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGELDL 721

Query: 487 VSGQILIDG----QDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIR 542
           VSG I+I G     D+   +   L        Q   L+S TI++NI +  + + S+   +
Sbjct: 722 VSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKSR--YK 778

Query: 543 LVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATS 602
            V   C  +  +   P                   QKQRI++ARA+      ++LD+  S
Sbjct: 779 KVIDACGLNRDLNILPA--GDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCLS 836

Query: 603 ALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660
           A+D  +   I  N   GQ+MK++  T + + H +    R     ++  DG V   G  KE
Sbjct: 837 AVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTIKE 894

Query: 661 L 661
           L
Sbjct: 895 L 895

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 134/557 (24%), Positives = 244/557 (43%), Gaps = 74/557 (13%)

Query: 149  STFLMGVGITLIFGC--FANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVG 206
            ++F MG+    +FG   F N  +  +L  +  R    L  + V+ I+H  + + DT  +G
Sbjct: 897  TSFYMGMYSFFVFGAYLFMNL-QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLG 955

Query: 207  DLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGAL---------FA 257
             +++R   D    + S+ +++ + +R          LML+    L G +         FA
Sbjct: 956  RILNRFTKD----TDSLDNELTESIR----------LMLSQVGNLIGVIVMCIVYLPWFA 1001

Query: 258  ILPPIIWCTSVF--------GKQIRMNSKKLQDVTGDLTRVT-EEQFNGIRTVQGFVAER 308
            I  P +    V         G++I    K+L+ V          E   G+ T++ + ++ 
Sbjct: 1002 IAVPFLLIIFVLICDHYQSTGREI----KRLEAVQRSFVYNNFNEVLGGMDTIKAYGSQE 1057

Query: 309  NEIKRFNNVLREIFQVGKESAFIN---GKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSI 365
              + + + ++ ++ + G     +         S +++  L   ++    ++ +  GS  +
Sbjct: 1058 RFLAKTDYLINKMNEAGYLIVAVQRWVAILLDSVAVVFALIITLLCVTRAFPISAGS--V 1115

Query: 366  GDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN 425
            G L  ++L      N I       ++    + +A R+     + P   +        P +
Sbjct: 1116 GVLLTYVLQLPGLLNTIL---RALTQTENDMNSAERLVTYATELPLEAAYRKPEVSPPES 1172

Query: 426  EVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
                 +I+F +V+F Y P  P   + KN+N K+  G  + I G +G GKSTI S L    
Sbjct: 1173 WPEKGDIDFIDVNFAYRPGLPV--VLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLN 1230

Query: 485  NAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------I 528
                G+I+IDG DI  +    LR+K+ I+ Q+P+L  GTIR N                I
Sbjct: 1231 ELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALI 1290

Query: 529  TYGLTEEPSKEEIRLVA-KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARA 587
              G+ E  +  +I+L    +   ++ + KF                    ++Q +A+ RA
Sbjct: 1291 RTGVVERENLNDIKLEKPDENNSYSNMHKF----HLDELVEEEGSNFSLGERQMLALTRA 1346

Query: 588  LIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLG 647
            L++   ILILDEATS++D E++G I      + +    TI+ IAHRL TI  ++ ++VL 
Sbjct: 1347 LVRNSKILILDEATSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL- 1403

Query: 648  NDGSVVEMGKFKELYDN 664
              G + E  K  EL+++
Sbjct: 1404 EKGVIAEYEKPWELFND 1420

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 97/213 (45%), Gaps = 22/213 (10%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F +LN ++  G  + + GP G GK+++ + +       SG++ ++G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
             ++   P +++ T+RDNI +G   E ++     + + C     +   P           
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPYEEAR--YNEIVEVCSLDADLKILPA--GDRTEIGE 682

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIV 628
                   QK RI +ARA+ K  +I + D+  SA+D    +  ++     I+K K+  + 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILA 742

Query: 629 SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  H+LS I R + +IV+G +GS  + G   EL
Sbjct: 743 T--HQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 143/584 (24%), Positives = 249/584 (42%), Gaps = 77/584 (13%)

Query: 120  IIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANF-GRVVILRIISE 178
            ++GT   +L ++   L+  ++ K  N P S F MG+    +F  F    G+  IL  +  
Sbjct: 904  VVGTTFCSLFSSVW-LSYWTENKFKNRPPS-FYMGLYSFFVFAAFIFMNGQFTILCAMGI 961

Query: 179  RLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXX 238
                 L  + V+ I+H  + + DT  +G +++R   D    + S+ +++ + +R      
Sbjct: 962  MASKCLNLRAVRRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNELTESLR------ 1011

Query: 239  XXXXLMLTLSRELTGA---------LFAILPPIIWCTSVF--------GKQI-RMNSKKL 280
                LM +    + G           FAI  P +    V         G++I R+ + + 
Sbjct: 1012 ----LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVVFVLIADHYQSSGREIKRLEAVQR 1067

Query: 281  QDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFIN---GKFFT 337
              V  +L  V      G+ T++ + ++   + + + ++ ++ + G     +    G F  
Sbjct: 1068 SFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLD 1123

Query: 338  SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
              ++      +I L   +      + S+G L  ++L      N I       ++    + 
Sbjct: 1124 MVAIA--FALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTIL---RAMTQTENDMN 1178

Query: 398  AASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFK 456
            +A R+     K P            P +     +I F+NV F Y P  P   + KN N  
Sbjct: 1179 SAERLVSYATKLPLEADYRKPEMTPPESWPSKGKIVFENVDFAYRPGLPI--VLKNFNLD 1236

Query: 457  VPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQE 516
            + +G  + I G +G GKSTI S L       +GQI ID  DI+ L    LR+K+ I+ Q+
Sbjct: 1237 IKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIPQD 1296

Query: 517  PILMSGTIRDNITYGLTEEPSKEEIR--LVAKQCFCHNFITKF----PD---------TY 561
            P+L  GTIR N+     +E + +E+   LV       N + +     PD          +
Sbjct: 1297 PVLFRGTIRKNL--DPFDERTDDELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKF 1354

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMK 621
                            ++Q +A+ RAL+++  ILILDEATS++D E++G I      + +
Sbjct: 1355 HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRI--VEE 1412

Query: 622  SKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
                TI+ IAHRL TI  ++ ++VL   G V E       YD P
Sbjct: 1413 FGDCTILCIAHRLKTIVNYDRILVL-EKGEVAE-------YDTP 1448

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 101/214 (47%), Gaps = 24/214 (11%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FK+LNF +  G  + I GP G GKS++ + +      V G+I ++G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEP-SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
             ++   P + + T+RDNI +G    P +KE+   V   C     +   P          
Sbjct: 652 --LMCGYPWIQNATVRDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPA--GDMTEIG 704

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTI 627
                    QK RI +AR++ KK +I + D+  SA+D    +  ++     ++ +K+  +
Sbjct: 705 ERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRIL 764

Query: 628 VSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +  H+LS I R   VIVLG DG  V++G  +EL
Sbjct: 765 AT--HQLSLIERASRVIVLGTDGK-VDIGTVEEL 795

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 123/541 (22%), Positives = 240/541 (44%), Gaps = 62/541 (11%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            FL+G+   L+        +V+I   +  +   ++   ++K ++H  L FFD+  +G +M+
Sbjct: 1113 FLIGIAQALLGSL-----KVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRIMN 1167

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFG 270
            R   D   + + +   V  G            L++T       ++  ++  + +    F 
Sbjct: 1168 RFSKDIEAIDQELA-PVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLIGYFY 1226

Query: 271  KQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTVQGFVAE----RNEIKRFNNVLREIFQVG 325
                   K+   +T   + +   E   G+ T++ F  E    +  + + +   R  F + 
Sbjct: 1227 LAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENNRPFFYLW 1286

Query: 326  KESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-----GSMSIGDLTAFMLYTEYTGN 380
              + +++ +       I  +G L+V   GS+++ +       M+   LT  + +TE    
Sbjct: 1287 VANRWLSFR-------IDMVGALVVFGSGSFIIWNIKNIDAGMAGISLTYAISFTE---- 1335

Query: 381  AIFGLSSFYSELMQGVGAASRIFEIN--DKEPKIKST-TGEAKFKPLNEVGGCEIEFKNV 437
                L   YS +   + +  R+ E    ++EP   +T T   ++    ++  C++  +  
Sbjct: 1336 GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSLR-- 1393

Query: 438  SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497
              +    P  ++ KN+ F V   + + IVG +G GKSTI + L    +  +G I ID  D
Sbjct: 1394 --YAEGLP--RVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNID 1449

Query: 498  IATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YG-LTEEPSKEEIRLV----------- 544
            I ++N   LRR I I+ Q+P L +GTI+ N+  YG  ++E     +R V           
Sbjct: 1450 ITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNI 1509

Query: 545  AKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
              +      + KF    +               Q+Q + +AR+L++ P I++LDEAT+++
Sbjct: 1510 ETESISSQNVNKF---LNLNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASI 1566

Query: 605  DVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            D  S+  I  T  +  +  S TI++IAHRL ++  ++ ++V+       + G+ KE YD+
Sbjct: 1567 DYNSDAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDH 1616

Query: 665  P 665
            P
Sbjct: 1617 P 1617

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 163/382 (42%), Gaps = 34/382 (8%)

Query: 293 EQFNGIRTVQGFVAERNEIKRFNNVLREIFQV--GKESAFINGKF--FTSASLIGDLGFL 348
           E    IR ++ F  E N  K  N+V  +  Q+   +  A++   F  F + SL+    F 
Sbjct: 577 ESLQAIRIIKFFSWEDNFEKSINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAFA 636

Query: 349 IVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDK 408
             + Y    V+   ++   L+ F L      N +  LS   S ++Q   +  RI +    
Sbjct: 637 FYI-YVQKEVLTTPIAFTALSLFTLLR----NPLDQLSDMLSFVIQSKVSLDRIRDF--- 688

Query: 409 EPKIKSTTGEAKFKPLNEV-GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVG 467
                  T  AK+  L     G ++EFKN +  + +   +   K+LN     G    ++G
Sbjct: 689 ----LLETDTAKYDQLTVAPQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIG 744

Query: 468 PSGRGKSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
           P+G GK+++   LL     + G+I++   D ++   ++       I    Q   L++ T+
Sbjct: 745 PTGSGKTSLLMALLGEMKIMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTV 804

Query: 525 RDNITYGLTEEPSKE-EIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQR 581
           R+NI +     P  E     V + C    +F I K  D  +               QKQR
Sbjct: 805 RNNILFN---SPYNEARYTSVIEACGLKRDFEILKAGDMTE----IGEKGITLSGGQKQR 857

Query: 582 IAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRR 639
           +++ARA+      ++LD+  SA+D  +   I  N   G +M  ++  +VS  H ++   +
Sbjct: 858 VSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLK 915

Query: 640 FEDVIVLGNDGSVVEMGKFKEL 661
             D++V+  DG V + G   EL
Sbjct: 916 NADLVVILEDGKVKDQGDPMEL 937

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  110 bits (274), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 133/263 (50%), Gaps = 36/263 (13%)

Query: 423 PLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH 482
           P N     ++E KN+S  Y    +++   N++FKV AG+ V IVG +G GKS+I + +  
Sbjct: 24  PANWPQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYR 82

Query: 483 HYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI-------------- 528
             +  +G I ID +DI  +  + LR  I  + Q+P L  GT+R N+              
Sbjct: 83  LSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGV 142

Query: 529 --TYGLTEEPSKEEIRLVAKQ----CFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRI 582
               GL EE   +E+ L+ +Q       H    +F    D               Q+Q +
Sbjct: 143 LSKVGLIEEC--DELCLIFEQEQPNFSSHKLRNRF---IDLNTVVKSGGSNLSQGQRQLL 197

Query: 583 AIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFED 642
            +AR+++   NI+++DEAT+++D  S+  I  T  + M  K+ TI++IAHRL ++  ++ 
Sbjct: 198 CLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDK 255

Query: 643 VIVLGNDGSVVEMGKFKELYDNP 665
           ++V+       EMG+ KE YD+P
Sbjct: 256 ILVM-------EMGRVKE-YDHP 270

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 126/250 (50%), Gaps = 27/250 (10%)

Query: 431  EIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489
            EI F+NV F Y P  PT  + KNL+  + +G  + I G +G GKSTI S L       SG
Sbjct: 1244 EIHFENVDFSYRPGLPT--VLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSG 1301

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------ITYGLT 533
            +++ID  DI+T+    LRRK+ I+ Q+P+L  GTIR N                +  G  
Sbjct: 1302 KMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAI 1361

Query: 534  EEPSKEEIRLVA-KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKP 592
            E+    EI+     +   H+ + KF                    ++Q +A+ RAL+++ 
Sbjct: 1362 EQKELNEIKAQKPDEKGNHSEMYKF----HLDQLVEEEGANFSLGERQLLALTRALVRQA 1417

Query: 593  NILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSV 652
             ILILDEATS++D E++G I      + +    TI+ IAHRL TI  ++ ++VL   G V
Sbjct: 1418 RILILDEATSSVDYETDGKIQARI--VEEFGHCTILCIAHRLKTILTYDRILVL-EKGEV 1474

Query: 653  VEMGKFKELY 662
             E    K L+
Sbjct: 1475 AEFDTPKTLF 1484

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 105/213 (49%), Gaps = 22/213 (10%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F +LNF++  G  + +VGP G GK+++ +      N VSG+I I+G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
             ++   P + + +++DNI +G     +K +   V + C   + +   P           
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPA--GDLTEIGE 750

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIV 628
                   QK RI +AR++ K+ +I + D+  SA+D    +  ++  F  ++K K+  + 
Sbjct: 751 RGITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILA 810

Query: 629 SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  H+LS + R   VIVLGNDGS  ++G  +EL
Sbjct: 811 T--HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 135/534 (25%), Positives = 223/534 (41%), Gaps = 44/534 (8%)

Query: 155  VGITLIFGCFA----NFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            VGI    G F+    N   +V+L   + R  ++L   + K ++   + FF+T  VG +++
Sbjct: 997  VGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIIN 1056

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALF--AILPPIIWCTSV 268
            R  +D   V  ++    A   RS         L   +S  +   L   A+L  I      
Sbjct: 1057 RFSSDVQAVDSTLQWVFAFFFRSILNYAVTVIL---ISYNMPWFLIVNAVLLIIYIYYQA 1113

Query: 269  FGKQIRMNSKKLQDV-TGDLTRVTEEQFNGIRTVQGFVA-ERNEIKRFNNVLREIFQVGK 326
            F   +    K+L  V T  +  +  E   G   +  F   +R +   FNNV    F +  
Sbjct: 1114 FYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAFKHFDRFDFINFNNVQ---FNINC 1170

Query: 327  ESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIGDLTAFMLYTEYTGNAI 382
               F +   + S  L   +G  IVL       S +     +S G +   M Y     +++
Sbjct: 1171 SFNFRSTNRWLSVRL-QTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSSL 1229

Query: 383  FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442
              +     ++   + +  RI+E  +  P+        + K      G EI FKN S  Y 
Sbjct: 1230 MWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEG-EIIFKNYSTKYK 1288

Query: 443  TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
            T+  +   K +N  +     + +VG +G GKST++  L     A  G I IDG DI+ + 
Sbjct: 1289 TK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMG 1347

Query: 503  TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             K LR  +GI+ Q+     GT+R N+     E+ S EE+    +       I +     D
Sbjct: 1348 LKDLRSHLGIIPQDAQAFEGTVRSNL--DPFEQYSTEELWASIELSHLKPHIVEMFRKED 1405

Query: 563  XXXXXXXXXXXXXXX-----------QKQRIAIARALIKKPNILILDEATSALDVESEGA 611
                                      Q+Q + ++RAL+    +L+LDEAT+A+D+E++  
Sbjct: 1406 NSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKI 1465

Query: 612  INYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            I  T    +K K  TI++IAHR+ T+   + +IVL       + G+ KE +D P
Sbjct: 1466 IQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-------DAGQVKE-FDTP 1509

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 102/221 (46%), Gaps = 17/221 (7%)

Query: 450 FKNLN-FKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRR 508
            +N+N F+   G   CIVG  G GKST+         A+ GQ+      +  L  K L R
Sbjct: 638 LENINGFQAKKGELTCIVGRVGSGKSTML-------RAILGQLPCVNASVGGLEPKVLIR 690

Query: 509 K--IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXX 566
              +    QEP +M+ +I+DNIT+G   + +     + A Q      I    D       
Sbjct: 691 ASTVAYCPQEPWIMNASIKDNITFGFRYDETYYNATIKACQLLPDLDILPERDN----TL 746

Query: 567 XXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMK-SKS 624
                      QK RI++ARA+  + ++ +LD+  SA+D E S+  +     + M   ++
Sbjct: 747 VGEKGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRN 806

Query: 625 MTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            T+V   + +S + R + + +L   GS+VE G F E+  +P
Sbjct: 807 KTVVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSP 846

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 134/533 (25%), Positives = 237/533 (44%), Gaps = 48/533 (9%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVGDLM 209
            F +G G  L     +   + VIL +      SR L   +   ++   + FF+T  +G ++
Sbjct: 995  FALGFGSAL-----STLIQTVILWVFCTIRGSRYLHDLMTDAVLKAPMSFFETTPIGRIL 1049

Query: 210  SRVGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWC 265
            +R  ND +    ++ R+ +    + V+          +M  +       +F I+P  ++ 
Sbjct: 1050 NRFSNDIYKIDSILGRTFSQFFVNAVK-------VVFVMAVICATTWQFIFVIIPLGVF- 1101

Query: 266  TSVFGKQIRMNSKKLQDVTGDLTRVT-----EEQFNGIRTVQGFVAERNEIKRFNNVLRE 320
              ++ +Q  + + +       +TR       +E   GI T++G+    N+ KRF ++  +
Sbjct: 1102 -YIYYQQYYLRTSRELRRLDSITRSPVYSHFQETLGGITTIRGY----NQEKRFGHI-NQ 1155

Query: 321  IFQVGKESAF---INGKFFTS--ASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYT 375
                   SAF   IN   + +    LIG +  L   T   + +  G+++ G +   + Y 
Sbjct: 1156 CRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVGLSLSYA 1215

Query: 376  EYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK 435
                  +  +     E+   + +  R+ E    E +      E +   +    G +I+F+
Sbjct: 1216 LQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEG-DIKFE 1274

Query: 436  NVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
            N S  Y  RP  + + KN+N  +     V IVG +G GKS++   L     A +G I+ID
Sbjct: 1275 NYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIID 1332

Query: 495  GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI--TYGLTEEPSKEEIRLVAKQCFCHN 552
            G  I  +    LR K+ I+ Q+  +  GT+R+NI  T   T+E   E  R++       +
Sbjct: 1333 GIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENIDPTNLFTDE---EIWRVLELSHLKEH 1389

Query: 553  FITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI 612
             ++   D  D               Q+Q + +ARAL+    IL+LDEAT+A+DVE++  +
Sbjct: 1390 VLSMGADGLD--VQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIV 1447

Query: 613  NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              T     K +  TI++IAHRL+TI   + +IVL + G +VE     EL   P
Sbjct: 1448 QETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKP 1497

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 99/228 (43%), Gaps = 20/228 (8%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           N +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L     V G   + 
Sbjct: 628 NATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSILGDLFRVKGFATVH 687

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G              +  V Q P +M+GT+++NI +G   +  +E      K C     +
Sbjct: 688 GN-------------VAYVSQVPWIMNGTVKENILFG--HKYDQEFYEKTIKACALTIDL 732

Query: 555 TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAIN 613
               D                  QK R+++ARA+  + +  +LD+  +A+D   S+  + 
Sbjct: 733 GILVD--GDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVE 790

Query: 614 YTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  G      S T V   +++S +    D I L  +G +V+ G ++E+
Sbjct: 791 HVLGPTGLLHSKTKVLCTNKISVL-SIADSITLLENGEIVQQGSYEEV 837

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 149/570 (26%), Positives = 246/570 (43%), Gaps = 104/570 (18%)

Query: 149  STFLMGVGITLIFGCFANF-GRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            ++F MG+    +FG +     +  I+  I      +L    V+ I+H  + F DT  +G 
Sbjct: 916  TSFYMGLYSFFVFGGYIFMTSQFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTTPLGR 975

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGA---------LFAI 258
            +++R   D    + S+ +++ + VR          LML     + G           FAI
Sbjct: 976  ILNRFTKD----TDSLDNELTENVR----------LMLAQFANIIGVCVMCIIYLPWFAI 1021

Query: 259  LPPIIWCTSVF--------GKQIR--------MNSKKLQDVTGDLTRV----TEEQFNGI 298
              P I    V         G++I+             L +V G +  +    +EE+F  +
Sbjct: 1022 AIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEERF--M 1079

Query: 299  RTVQGFVAERNE-------IKRFNNVLREI----FQVGKESAFINGKFFTSASLIGDLGF 347
                  + + NE       ++R+  VL ++    F +      +  +F  SAS +G    
Sbjct: 1080 AKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIAVCFALIIALLCVTRQFHISASSVG---- 1135

Query: 348  LIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND 407
             ++LTY    V+     +  +   +  TE   N++  L S+ +EL     AA R  E + 
Sbjct: 1136 -VLLTY----VLQLPGLLNTVLRALTQTENDMNSVERLVSYATEL--PTEAAYRKPE-SS 1187

Query: 408  KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIV 466
             +P   S   E K           I+F+ VSF Y P  P   + KNL+  +  G  + I 
Sbjct: 1188 PDP---SWPQEGK-----------IDFEEVSFAYRPGLPA--VLKNLSMSINGGEKIGIC 1231

Query: 467  GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
            G +G GKSTI S L       SG+I+IDG +I+ +    LRR + I+ Q+P+L  GTIR 
Sbjct: 1232 GRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRK 1291

Query: 527  NIT-YGLTEEPS------------KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXX 573
            N+  +G   +              KE +  V  Q    N   +    +            
Sbjct: 1292 NLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSN 1351

Query: 574  XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKS-MTIVSIAH 632
                ++Q +A+ARAL++   +LILDEATS++D E++  I     +I+++ S  TI+ IAH
Sbjct: 1352 FSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAH 1408

Query: 633  RLSTIRRFEDVIVLGNDGSVVEMGKFKELY 662
            RL TI  ++ ++VL   G + E      LY
Sbjct: 1409 RLKTILNYDRILVL-EKGEIAEFDSPYNLY 1437

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 95/213 (44%), Gaps = 22/213 (10%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FK++N ++  G  + I GP G GK+++ + +        G + I+G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
             ++   P + + T+RDNI +G   + SK    +V K C     +   P           
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSK--YNMVVKACCLDADLDILPA--GDMTEIGE 705

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI-NYTFGQIMKSKSMTIV 628
                   QK RI +AR + K  +I + D+  SA+D      I +     ++  K+  + 
Sbjct: 706 RGINLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLA 765

Query: 629 SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  H+LS +     VIVLGNDGS V++G  +EL
Sbjct: 766 T--HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 131/545 (24%), Positives = 231/545 (42%), Gaps = 72/545 (13%)

Query: 150  TFLMGVGITLIFGCFANF-GRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
            +F MG+    +F  F    G+  IL  +       L  + VK I+H  + + DT  +G +
Sbjct: 933  SFYMGLYSFFVFAAFIFMNGQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRI 992

Query: 209  MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGA---------LFAIL 259
            ++R   D    + S+ +++ + +R          LM +    + G           FAI 
Sbjct: 993  LNRFTKD----TDSLDNELTESLR----------LMTSQFANIVGVCVMCIVYLPWFAIA 1038

Query: 260  PPIIWCTSVF--------GKQI-RMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNE 310
             P +    V         G++I R+ + +   V  +L  V      G+ T++ + ++   
Sbjct: 1039 IPFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERF 1094

Query: 311  IKRFNNVLREIFQVGKESAFIN---GKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367
            + + + ++ ++ + G     +    G F    +++     +I L   +      + S+G 
Sbjct: 1095 LAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIV--FALIITLLCVTRAFPISAASVGV 1152

Query: 368  LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427
            +  ++L      N +       ++    + +A R+     + P            P +  
Sbjct: 1153 MLTYVLQLPGLLNTLL---RALTQTENDMNSAERLVSYATELPLEADYRKPEMAPPESWP 1209

Query: 428  GGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
               EI FKNV F Y P  P   + KNLN  + +G  + I G +G GKSTI S L      
Sbjct: 1210 SKGEIAFKNVDFSYRPGLPV--VLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNEL 1267

Query: 487  VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------ITY 530
              G+ILID  +I+ +    LRRK+ I+ Q+P+L  GTIR N                +  
Sbjct: 1268 SGGEILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTEDELWDALVRG 1327

Query: 531  GLTEEPSKEEIRLVA-KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
            G   +    E++L   ++   H  + KF                    ++Q +A+ RAL+
Sbjct: 1328 GAIAKNDLPEVKLQKPEENGTHGKMHKF----HLDQAVEEEGSNFSLGERQLLALTRALV 1383

Query: 590  KKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGND 649
            ++  ILILDEATS++D E++G I      + +    TI+ IAHRL TI  ++ ++VL   
Sbjct: 1384 RQSKILILDEATSSVDYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EK 1440

Query: 650  GSVVE 654
            G V E
Sbjct: 1441 GEVAE 1445

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 115/254 (45%), Gaps = 35/254 (13%)

Query: 413 KSTTGEAKFKPLNEV---GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPS 469
           K TT E K K L+ +        + K  SF        + FK+L+F++  G  + I GP 
Sbjct: 572 KPTTNENKAKKLDNMLKDQDAPEDLKKTSF--------KGFKDLDFEIKKGEFIMITGPI 623

Query: 470 GRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
           G GKS++ + +        G+I ++G D+             ++   P + + T++DNI 
Sbjct: 624 GTGKSSLLNAMAGSMRKTDGKIEVNG-DL-------------LMCGYPWIQNATVKDNII 669

Query: 530 YGLTEEP-SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARAL 588
           +G    P +KE+   V   C     +   P                   QK RI +AR++
Sbjct: 670 FG---SPFNKEKYDEVIHVCSLKADLDILPA--GDMTEIGERGITLSGGQKARINLARSV 724

Query: 589 IKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLG 647
            K+ +I + D+  SA+D    +  ++     ++++K+  + +  H+LS I +   VIVLG
Sbjct: 725 YKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKTRVLAT--HQLSLIEKASRVIVLG 782

Query: 648 NDGSVVEMGKFKEL 661
            DG  V++G   EL
Sbjct: 783 TDGD-VDIGTVDEL 795

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 130/532 (24%), Positives = 237/532 (44%), Gaps = 48/532 (9%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKN-IIHKDLEFFDTFKVGDLM 209
            F +G+G  L     A   + ++L +      S+    ++ N ++   + FF+T  +G ++
Sbjct: 997  FALGIGSAL-----ATLIQTIVLWVFCTIHASKYLHNLMANSVLRAPMAFFETTPIGRIL 1051

Query: 210  SRVGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWC 265
            +R  ND +    ++ R+ +    + V+            +T+    T     I+ P+  C
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFFVNAVK--------VIFTITVICATTWQFIFIIIPLGVC 1103

Query: 266  TSVFGKQIRMNSKKLQDVTGDLTRVT-----EEQFNGIRTVQGFVAERNEIKRFNNVLRE 320
               + +     S++L+ +   +TR       +E   G+ TV+G+    ++ KRF+++  +
Sbjct: 1104 YIYYQQYYLRTSRELRRLDS-ITRSPIYSHFQETLGGLATVRGY----SQQKRFSHI-NQ 1157

Query: 321  IFQVGKESAF---INGKFFTSA--SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYT 375
                   SAF   IN   + +    LIG +  L   T   + +  G+++ G     + Y 
Sbjct: 1158 CRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMAGISLSYA 1217

Query: 376  EYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK 435
                  +  +     E+   + +  RI E  D + +   T  E    P       +I+F 
Sbjct: 1218 LQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTI-EGHMPPKEWPSQGDIKFN 1276

Query: 436  NVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
            N S  Y  RP  + + K++N  +     + IVG +G GKS++   L     A +G I+ID
Sbjct: 1277 NYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVID 1334

Query: 495  GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI--TYGLTEEPSKEEIRLVAKQCFCHN 552
            G  I  +    LR ++ I+ Q+  +  G++R+NI  T   T+E     + L   +    +
Sbjct: 1335 GIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQYTDEAIWRALELSHLK---EH 1391

Query: 553  FITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI 612
             ++   D  D               Q+Q + +ARA++    ILILDEAT+A+DVE++  +
Sbjct: 1392 VLSMSNDGLD--AQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVV 1449

Query: 613  NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
              T     K +  TI++IAHRL+TI   + +IVL N G+V E     +L  N
Sbjct: 1450 QETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSN 1498

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 98/238 (41%), Gaps = 40/238 (16%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           + +F +  +P  ++  KN+NF+   G   C+VG  G GK+ + S +L     V G   + 
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKGFATVH 691

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G              +  V Q P +M+GT+ +NI +G      K ++    K        
Sbjct: 692 GS-------------VAYVSQVPWIMNGTVMENILFG-----HKYDVEFYEKTIKACALT 733

Query: 555 TKFPDTYD-XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD-------- 605
                  D                QK R+++ARA+  + +  +LD+  +A+D        
Sbjct: 734 IDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLI 793

Query: 606 --VESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             V     + +T  +++ +  ++ +SIA          D + L ++G +++ G + E+
Sbjct: 794 EHVLGPNGLLHTKTRLLATNKVSALSIA----------DSVALLDNGEIIQKGTYDEI 841

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 124/510 (24%), Positives = 232/510 (45%), Gaps = 67/510 (13%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            +++ ++H  L FFD+  +G +M+R   D   V + +T        S         L+  +
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 248  SRE--LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGF 304
            + +  +   + A+L   I    + G +     K+L  ++   + +   E   G+ T++ F
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSR---ELKRLDSISRSPIYQHFSETLVGVTTIRAF 1298

Query: 305  VAE----RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH 360
              E    +  + + +   R  F +   + ++       A  I  +G L+V   G +++++
Sbjct: 1299 GDESRFIQENLHKIDENNRPFFYLWVANRWL-------AMRIDLIGSLVVFGAGVFILLN 1351

Query: 361  -----GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE--INDKEPKIK 413
                   M+   LT  + +TE        L   YS +   + +  R+ E  + ++EP  +
Sbjct: 1352 IDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQ 1407

Query: 414  STTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRG 472
                     P +      +E  +VS  Y P  P  ++ KN++F V   S V +VG +G G
Sbjct: 1408 PIMT----PPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAG 1461

Query: 473  KSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGL 532
            KSTI + L    +  +G I ID  DI+ ++ + LRR I I+ Q+P L +GTI+ N+    
Sbjct: 1462 KSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNL--DP 1519

Query: 533  TEEPSKEEI-------RLVAKQCFCHNFI----------TKFPDTYDXXXXXXXXXXXXX 575
             +E S E+I        LV+++    + I           KF    D             
Sbjct: 1520 YDEYSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKF---LDLNSEINEGGGNLS 1576

Query: 576  XXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLS 635
              Q+Q + +AR+L++ P I++LDEAT+++D +S+  I  T  +  +    TI++IAHRL 
Sbjct: 1577 QGQRQLVCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLR 1634

Query: 636  TIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            ++  ++ ++V+       + G+ KE YD+P
Sbjct: 1635 SVIDYDKILVM-------DQGEVKE-YDHP 1656

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 119/531 (22%), Positives = 214/531 (40%), Gaps = 69/531 (12%)

Query: 167 FGRVVILR----IISERLVSRLRSQVVKNIIHKDLEFFD------------------TFK 204
           FGR V ++    IISE     LR QV  N   +  +  D                  +  
Sbjct: 467 FGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQELNEEEHRDGDEESGTSAN 526

Query: 205 VGDLMSRVGNDAFVVSR--SITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPI 262
           +G +++ +  DAF VS   +  H   + V            +L LS  +   L  +L P+
Sbjct: 527 LGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIGALLIVVLMPV 586

Query: 263 -----IWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV 317
                 W   +  K +    K++Q++         E F  IR ++ F  E N  K    +
Sbjct: 587 NFRLVTWLGQLQKKSLSYTDKRIQNLN--------EAFQAIRIIKFFSWEDNFEKGIQAI 638

Query: 318 ----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFML 373
               L+ + Q     A  +  ++ + +++    F   + Y     +   ++   L+ F L
Sbjct: 639 RDVELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYI-YVQKQTLTTPVAFTALSLFSL 697

Query: 374 YTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV-GGCEI 432
                   +  LS   S ++Q   +  RI E  + EP         K+  L+   GG ++
Sbjct: 698 LR----TPLDQLSDMLSFVIQSKVSLDRIQEFLE-EPDTD------KYNQLSVAPGGQKL 746

Query: 433 EFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQIL 492
            F+N +  + +   +   +NLN     G    ++GP+G GK++I   LL     ++G I+
Sbjct: 747 GFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIV 806

Query: 493 I---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQC- 548
           +   D + +  ++   +   I    Q   L++ T+R+NI +      S+     V + C 
Sbjct: 807 VPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFN--SPYSEARYNDVIEACG 864

Query: 549 FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE 607
              +F I    D  +               QKQRI++AR+L      L+LD+  SA+D  
Sbjct: 865 LKRDFEILSAGDMTE----IGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSH 920

Query: 608 SEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
           +   I  N   G +M+ +  T + I+H ++   R  +++VL  +G V E G
Sbjct: 921 TASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 121/234 (51%), Gaps = 26/234 (11%)

Query: 431  EIEFKNVSFFYPT-RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489
            EI F +V F Y +  P   + K LN  + +G  + I G +G GKSTI S L       SG
Sbjct: 1192 EIRFLDVDFAYRSGLPV--VLKGLNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTSG 1249

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------ITYGLT 533
            +ILID  DI+TL    LRRK+ I+ Q+P+L  GTIR N                I  G  
Sbjct: 1250 KILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSNYDDSLLWDALIRSGAI 1309

Query: 534  EEPSKEEIRL-VAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKP 592
            E+ S E+++  +  +   H  + KF                    ++Q +A+ RAL+++ 
Sbjct: 1310 EKESVEKVKSEMVNEEGTHTDMHKF----HLDQLVEEEGSNFSLGERQVLALTRALVRQS 1365

Query: 593  NILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVL 646
             ILILDEATS++D E++G I      + +  + TI+ IAHRL TI +++ ++VL
Sbjct: 1366 KILILDEATSSVDYETDGKIQKRI--VEEFDNCTILCIAHRLKTILQYDRILVL 1417

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 98/214 (45%), Gaps = 24/214 (11%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F NL+F++  G  + I GP G GKS++ +      N   G+I ++G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPS-KEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
             +    P + + T++DNI +G    P  KE+   V + C     +   P          
Sbjct: 636 --LFCGYPWIQNATVKDNILFG---SPFIKEKYENVLRVCSLDADLKVLPA--GDKTEIG 688

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTI 627
                    QK RI +ARA+ K  +I + D+  SA+D    +  ++     +++ K+  +
Sbjct: 689 ERGINLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRIL 748

Query: 628 VSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +  H+LS I + + VIVLG DGS  ++G   EL
Sbjct: 749 AT--HQLSLIEKADRVIVLGTDGS-FDIGTVDEL 779

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 128/237 (54%), Gaps = 27/237 (11%)

Query: 428  GGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
            GG EI F +V   Y P  P   + KN++F +   S V IVG +G GKST+   L      
Sbjct: 1234 GGAEISFDHVYVRYAPHLP--DVLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIEL 1291

Query: 487  VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YGLTEEPSKEEIRLVA 545
             +G I I G DIA+LN ++LRR++ ++ Q+P L SGTI+ NI  +G     S +E+   A
Sbjct: 1292 TNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFA 1348

Query: 546  KQCFCHNFITKFPDTYDXXXXXXXXXXX------XXXXQKQRIAIARALIKKPNILILDE 599
            ++      I  F  T D                     Q+Q + +ARAL++K  ILILDE
Sbjct: 1349 RR------IGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDE 1402

Query: 600  ATSALDVESEGAINYTFGQIMK--SKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            AT+++D E++  I     Q+++  S    ++++AHR+STI  ++ VIVL  D  +V+
Sbjct: 1403 ATASIDHETDATIQ----QVVRDFSSGGIVITVAHRMSTIIDYDQVIVL--DSGIVK 1453

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 105/236 (44%), Gaps = 19/236 (8%)

Query: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
           E+ F+N S  +    T  + KNL           I+GPSG GKS++   LL   + + G 
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
           I +    +        R       Q P + + T+++NI +  + + + +  + V   C  
Sbjct: 694 IRVPRGYM-----HDDRCSFAFCSQTPWITNATVKENIVF--SSQFNTKRYQEVLHACGL 746

Query: 551 HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
              I +  +  +               Q+QR+A+ARA+      L+LD+  SA+D    G
Sbjct: 747 EEDILEMQEGDE--TVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PG 801

Query: 611 AINYTF-----GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              + F     G +MK K  T +   H ++ +++  D+I+L ++G V ++GK ++ 
Sbjct: 802 MAVWIFQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDF 855

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 139/568 (24%), Positives = 245/568 (43%), Gaps = 57/568 (10%)

Query: 128  LRNNYENLTSLSQIKILNIPLST-----FLMGVGITLIFGCFANFGRVVILRIISERLVS 182
            LR   EN +S+S  K     L T     FL+   I  +   F   G+V +  +       
Sbjct: 1000 LRYWLENGSSVSVFKRFYGILQTHSTLYFLLFYAIIGLISSFLTAGKVWVAMLSGTNATK 1059

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ S+++ +I    L F D   VG +M+R   D  ++ + +         S         
Sbjct: 1060 KIFSKLLSSIFEAKLRFHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWIVI 1119

Query: 243  LMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDV----TGDLTRVTEEQFNGI 298
            L+  ++      +FAI  P+       G      S++L+ +       + ++  E   G+
Sbjct: 1120 LIGYVTPRFL--IFAI--PLCGLYYFVGALYLRASRELKRIDNINVSPIHQLFTEAIKGV 1175

Query: 299  RTVQGFVAER----NEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG 354
             T++    ER    + ++  +      F +   + +I  +     +L+     L+++   
Sbjct: 1176 VTIRALADERRFITHTLEAIDGSNAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARA 1235

Query: 355  SYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKS 414
             YL   G   I    AF  +TE T   I  + S    LM  V       E+    P   S
Sbjct: 1236 PYLDA-GLAGILLSNAFS-FTE-TAQWIIKVFSGVELLMSSVERIKEYIEV----PLEFS 1288

Query: 415  TTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
             + ++   P++     EIEFKN+S  Y    +++   N++FKV  G+ V IVG +G GKS
Sbjct: 1289 KSNDSATSPVDWPQTGEIEFKNLSLRYSPH-SSKALDNVSFKVRTGTKVGIVGRTGAGKS 1347

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI------ 528
            +I + +    +  SG I+ID +DI  ++ + LR  I  + Q P L  GTIR N+      
Sbjct: 1348 SIIAAIYRLSDWESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQY 1407

Query: 529  ----------TYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTY-DXXXXXXXXXXXXXXX 577
                        GL E    E + LV  +    +F    P+ + D               
Sbjct: 1408 SDKQVFDALAKVGLIER--NEVLCLVTDRQQSSSFS---PNKFSDLNSVVRSGGSNLSQG 1462

Query: 578  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
            Q+Q + +AR+++    I+++DEAT+++D  S+  I  T  + M++   TI++IAHRL ++
Sbjct: 1463 QRQLLCLARSMLGSRKIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSV 1520

Query: 638  RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              +  ++V+       +MG+ KE YD+P
Sbjct: 1521 IDYNKILVM-------DMGRVKE-YDHP 1540

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 140/586 (23%), Positives = 253/586 (43%), Gaps = 69/586 (11%)

Query: 114 GMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVIL 173
            + +P+I+G + D    ++  ++    + +++  ++T   G G+ L          ++I 
Sbjct: 338 ALLMPRILGYVDDPESQSWNLMSLFVTLMLISKIIATTCRGQGLFLGEKGTMQLRTILIS 397

Query: 174 RIISERL---------VSRLRSQVVKNII--HKDLEFFDTFKVGDLMSRVGN-------- 214
           RI S+ L          S+  +    NI+   +D E+ +T  V +  SR  N        
Sbjct: 398 RIYSKTLRRTILKGSKTSQQENATKLNILASDEDHEYSET-DVNEAASRKDNSVNNIMSV 456

Query: 215 DAFVVSRSIT--HKVADGVRSXXXXXXXXXLMLTLSREL-TGALFAILPPIIWCTSVFGK 271
           DAF VS +++  +   + V            +L  S    T AL A++P   WC + +GK
Sbjct: 457 DAFKVSEAMSTFYLACEAVFMTITALVTLYSLLGWSAFAGTFALIAMIPLNFWCATFYGK 516

Query: 272 ----QIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKE 327
               Q+ +  K+  D++        E  N IR ++    E+   ++  N+     ++ ++
Sbjct: 517 YQADQLLLTDKRTSDIS--------EALNSIRVIKVLAWEKLFYQKIMNIREGEIRILRK 568

Query: 328 SAFINGKFFTSASLIGDLG--FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIF-- 383
            A I   FF +  LI   G   + V+T+  ++          LT  + +T  +  AI   
Sbjct: 569 KATI---FFLN-HLIWFFGPTLVSVVTFAVFIKFQKQT----LTPSVAFTALSLFAILRT 620

Query: 384 ---GLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
               ++S  S L+Q   +  RI +  D+       +  +K++ L +    ++ FK+ +  
Sbjct: 621 PMDQIASTISLLVQSFISLKRIEDYLDE-------SETSKYEILTQ-SKSKVGFKDANME 672

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQIL---IDGQD 497
           +    T+   KN++ +    S   I+GP+G GKS++   LL   N  SGQI    +D +D
Sbjct: 673 WDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQIYVPSVDSRD 732

Query: 498 IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557
              +    +   +    Q P L+SGTI DNI +G  E P++     V K C     +   
Sbjct: 733 DLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKACCLEKDVKAM 790

Query: 558 PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYT 615
             +                 Q+QR+A+ARA+      L+LD+  SA+D E+   I     
Sbjct: 791 --SAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETALNIYEKCL 848

Query: 616 FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            G IMK ++  I S  H +S I +  + +V+ ++G V   GK  +L
Sbjct: 849 CGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL 892

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 128/508 (25%), Positives = 229/508 (45%), Gaps = 61/508 (12%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            V+K +++  L FFD+  +G +M+R   D   V + +T  V     S         L+  +
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 248  SRE-LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFV 305
            +   L  A+F  +  + +    F        K+ + V+   + +   E   GI T++ F 
Sbjct: 1198 TPGFLVVAIF--IGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAFG 1255

Query: 306  AERNEIKRFN-NVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH---- 360
             ER    RF    L++I +  K   ++       A  I  +G  +V   G +++++    
Sbjct: 1256 DER----RFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKKL 1311

Query: 361  -GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE--INDKEPKIKSTTG 417
               ++   LT  + +TE        L   YS +   + +  R+ E  + ++EP     + 
Sbjct: 1312 DSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEP-----SN 1362

Query: 418  EAKFKP-LNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTI 476
            +  F P +      +IE  ++S  Y T    ++ KN++F V     V IVG +G GKSTI
Sbjct: 1363 DGAFNPPIEWPDQGKIEVNDLSLRYATN-LPRVIKNVSFTVDPKCKVGIVGRTGAGKSTI 1421

Query: 477  ASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP 536
             + L    +  +G I ID  DI ++  K LR+ I I+ Q+P L SGT++ N+     +E 
Sbjct: 1422 ITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNL--DPYDEY 1479

Query: 537  SKEEIRLVAKQCFCHNFIT-----KFPDTYDXXXXXXXXX--------------XXXXXX 577
            + E+I    K+    N +T       PD+ D                             
Sbjct: 1480 TDEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQG 1536

Query: 578  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
            Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I
Sbjct: 1537 QRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSI 1594

Query: 638  RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              ++ ++V+       + G+ +E YD+P
Sbjct: 1595 IDYDKILVM-------DAGEVRE-YDHP 1614

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 123/531 (23%), Positives = 221/531 (41%), Gaps = 70/531 (13%)

Query: 167 FGRVVILR----IISERLVSRLRSQVVKNIIHKDLEFFD-----------------TFKV 205
           FGR V +R    IISE     LR ++  N      +  D                 T  +
Sbjct: 416 FGRRVCIRMKAIIISEIYTKALRRKISPNSSKVSTDEIDPQALNETEEIDGDEESTTANL 475

Query: 206 GDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWC 265
           G +++ +  DAF VS     ++   + +         + LTL  +L G    I   +I C
Sbjct: 476 GGIINLMAVDAFKVS-----EICAYLHAFVEATIMTIVALTLLYKLLGWAAVIGAILIVC 530

Query: 266 TSVFGKQIRMNSKKLQD----VTGDLTRVTEEQFNGIRTVQGFVAERN---EIKRF-NNV 317
                 ++     KLQ     VT    +   E F  IR ++ F  E N   +IK      
Sbjct: 531 MLPLNFKLANLIGKLQKDNLGVTDKRIQKLNETFQSIRIIKFFSWEENFERDIKAIRTEE 590

Query: 318 LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDL--TAFMLYT 375
           L+ + +     A ++  +F + S++  + F        Y+ + G +    +  TA  L+T
Sbjct: 591 LKILLKRSIVWALMSLVWFITPSIVTSVSF------AFYIYVQGEVLTTPIAFTALSLFT 644

Query: 376 EYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK 435
               N +  LS   S ++Q   +  R+ E  D+E          K+  L  +   +I F+
Sbjct: 645 -LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEET-------EKYNQLT-ISRNKIAFE 695

Query: 436 NVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILI-- 493
           N +F +  +  +   KNLN +   G    ++G +G GK+++   LL   + + G++ +  
Sbjct: 696 NATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYVPS 755

Query: 494 -DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKE-EIRLVAKQC-FC 550
            D ++   + +  +   I    Q   L++ T+R+NI +     P  E   + V + C   
Sbjct: 756 LDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFN---SPYNETRYKAVVEACGLK 812

Query: 551 HNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESE 609
            +F I    D  +               QKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 813 RDFEILSAGDQTE----IGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTA 868

Query: 610 GAI--NYTFGQIMKSKSMTIVSIAHRLS-TIRRFEDVIVLGNDGSVVEMGK 657
             I  N   G +M+ ++  +VS  H ++ T++  E V+VL N G + + G+
Sbjct: 869 LWIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVLDN-GRIKDQGE 916

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 131/513 (25%), Positives = 233/513 (45%), Gaps = 77/513 (15%)

Query: 192  IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSREL 251
            ++H  + FFD   +G +M+R   D   V + +T  +   +           L+  ++   
Sbjct: 1088 VLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITIITPH- 1146

Query: 252  TGALFAILPPIIWCTSVF-GKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQGFVA 306
                F I+  +++    F G      S++L+ +         + F+    G+ T++ F  
Sbjct: 1147 ----FLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGD 1202

Query: 307  ERNEIKRFNNVLREIFQVGKES-AF----INGKFFTSASLIGDLGFLIVLTYGSYLVMH- 360
            E    KRF  +L  + ++ + + AF    +  K+F  A  +  +G  IVL  GS+++++ 
Sbjct: 1203 E----KRF--ILENLDKIDQNNRAFFYLSVAVKWF--AFRVDIIGAFIVLASGSFILINI 1254

Query: 361  GSMSIG----DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTT 416
            G++  G     LT  +L+T+        L   YS     + +  R+ E +  E +     
Sbjct: 1255 GNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDY 1310

Query: 417  GEAKFKPLNEVGGCE---IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473
             +   + L +    E   IE  N+S  Y +     + KN++F +   S V IVG +G GK
Sbjct: 1311 NKDHIQELQQSSWPEHGQIEVDNLSLRYASNLP-PVIKNVSFTIEPQSKVGIVGRTGAGK 1369

Query: 474  STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLT 533
            STI + L       +G I IDG DI+ ++  +LRR I I+ Q+PIL +GTI+ N+     
Sbjct: 1370 STIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNV----- 1424

Query: 534  EEPSKE-----------EIRLV------AKQCFCHNFITKFPDTYDXXXXXXXXXXXXXX 576
             +P  E           ++ L+      A Q    +  T      +              
Sbjct: 1425 -DPCDEYDNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFVNLQTEITEGGQNISQ 1483

Query: 577  XQKQRIAIARALIKKPNILILDEATSALDVES----EGAINYTFGQIMKSKSMTIVSIAH 632
             ++Q + IAR+L+++P I++LDEATS++D ES    +G I   F +       TI++IAH
Sbjct: 1484 GERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNK------STILTIAH 1537

Query: 633  RLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            RL ++  ++ V+V+       + G+ KE YD+P
Sbjct: 1538 RLRSVIDYDRVLVM-------DAGEIKE-YDHP 1562

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 108/442 (24%), Positives = 179/442 (40%), Gaps = 45/442 (10%)

Query: 293 EQFNGIRTVQGFVAERN---EIKRF-NNVLREIFQVGKESAFINGKFFTSASLIGDLGFL 348
           E    IR V+ F  E N   +IK    N LR +FQ     A  +  +F + +L+  + F 
Sbjct: 534 ECLQNIRIVKYFAWENNISKDIKSIRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTFA 593

Query: 349 IVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEI--- 405
           I + +  +  ++  ++   L+ F L        +  LS+  S + Q + +  RI +    
Sbjct: 594 IYI-FVQHQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQSIVSLDRIVKFINE 648

Query: 406 NDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQ-IFK--NLNFKVPAGSN 462
           +D E   + T    + K         IEFKN +  +     +  IFK   LN     G  
Sbjct: 649 DDTEKYNQLTVSPDENK---------IEFKNATLTWNENDKDSTIFKLCGLNITFQIGKL 699

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG----QDIATLNTKSLRRKIGIVQQEPI 518
             I+G +G GKS +   LL   + +SG I + G     D+   +   L        Q   
Sbjct: 700 NLILGSTGSGKSALLMGLLGELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAW 758

Query: 519 LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
           L++ T+++NI + G  ++   +E   V   C     +   P                   
Sbjct: 759 LLNDTVKNNIIFNGAYDDVRYKE---VIDACGLKRDLEILPA--GDSTEIGEKGITLSGG 813

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLS 635
           QKQRI++ARA+      ++LD+  SA+D  +   I  N   G IM+++  T + + H +S
Sbjct: 814 QKQRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVS 871

Query: 636 -TIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFID 694
            TIR     ++L N G V   G  K+L                     T + VN     D
Sbjct: 872 LTIREAYFAVILEN-GKVKNQGTIKQL--EKTGIFKEEIAQMSYKGDRTEKSVNETS--D 926

Query: 695 LQTNPEEKKEADNASEENGAKL 716
           LQ +  +K +    ++E+G  L
Sbjct: 927 LQESDSQKTKGVTENKESGEDL 948

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 133/531 (25%), Positives = 236/531 (44%), Gaps = 56/531 (10%)

Query: 161  FGCFANFG---RVVILRIISE-RLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDA 216
             GCF+      + +IL +    R    L + +   ++   + FF+T  +G +++R  ND 
Sbjct: 996  LGCFSALSTLIQTIILWVYCTIRGSKYLHNLMTVAVLRAPMTFFETTPIGRILNRFSNDV 1055

Query: 217  F----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPP---IIWCTSVF 269
            +    V+ R+ +    + V+           ++ +       +F I+P     I+    F
Sbjct: 1056 YKVDSVLGRTFSQFFVNAVKVSFT-------IIVICFTTWQFIFIIIPLGVFYIYYQQYF 1108

Query: 270  GKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTVQGFVAER-----NEIKRFNNVLREIFQ 323
             +  R   ++L  +T   +    +E   GI T++G+  +      N+ +  NN+      
Sbjct: 1109 LRTSR-ELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRFTHINQCRVDNNM------ 1161

Query: 324  VGKESAF---INGKFFTSASL--IGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYT 378
                SAF   +N   + +  L  IG L  L   T   + +  G+++ G +   + Y    
Sbjct: 1162 ----SAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVGLSLSYALQI 1217

Query: 379  GNAIFGLSSFYSELMQGVGAASRIFEIND---KEPKIKSTTGEAKFKPLNEVGGCEIEFK 435
              ++  +     E+   + +  RI E +D   + P +      A+  P       +I+F+
Sbjct: 1218 TQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWP----DEGDIKFE 1273

Query: 436  NVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
            + S  Y  RP  + I K++N  +     V IVG +G GKS++   L     A SG+I+ID
Sbjct: 1274 HYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSGRIVID 1331

Query: 495  GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
               I  +    LR K+ I+ Q+  +  GT+R+NI    T E + E+I  V       + I
Sbjct: 1332 NVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLALSHLKDHI 1389

Query: 555  TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 614
                D                  Q+Q + +ARAL+    IL+LDEAT+A+DVE++  I  
Sbjct: 1390 ISMGDE-GLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVIQE 1448

Query: 615  TFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            T     K +  TI++IAHR++TI   + +IVL N G++ E    ++L +NP
Sbjct: 1449 TIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENP 1496

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 82/413 (19%), Positives = 161/413 (38%), Gaps = 71/413 (17%)

Query: 278 KKLQD----VTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV-----LREIFQVGKES 328
           KKLQ        + TRV  E  N I++++ +  E    ++  NV     L+ + ++G   
Sbjct: 467 KKLQKSQMTYKDERTRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYM 526

Query: 329 AFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSF 388
           A ++ +F     L+         T+ +++         DL        +    +F L  F
Sbjct: 527 ALMSFQFNVVPFLVS------CCTFAAFIYTENRPLTTDLV-------FPALTLFNLLHF 573

Query: 389 --------YSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSF 439
                    + +++   +  R+F     E   K      +   +  +G   I    + +F
Sbjct: 574 PLMVIPNVLTMIIETSVSIGRLFSFLTNEELQKDAV--QRLPKVTNIGDVAINVGDDATF 631

Query: 440 FYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDI 498
            +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L     V G   I G   
Sbjct: 632 LWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIHGN-- 689

Query: 499 ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFP 558
                      +  V Q   +M+GT+++NI +G   +  ++  +   K C     +    
Sbjct: 690 -----------VAYVSQVAWIMNGTVKENILFG--HKYDEDFYQKTIKACALTIDLAVLM 736

Query: 559 DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD----------VES 608
           D                  QK R+++ARA+  + +  +LD+  +A+D          V  
Sbjct: 737 D--GDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLG 794

Query: 609 EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
              + +T  +++ +  ++++SIA          D + L  +G +V+ G + E+
Sbjct: 795 PNGLLHTKTKVLATNKVSVLSIA----------DSVSLLENGEIVQQGTYDEI 837

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 133/554 (24%), Positives = 235/554 (42%), Gaps = 72/554 (12%)

Query: 151  FLMGVGITLIFGCFA-NFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLM 209
            F MG+ I  + G  A  F + + + ++       L  + ++ ++H  + F D   +G +M
Sbjct: 910  FYMGLYILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVM 969

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGA---------LFAILP 260
            +R   D   +   IT  V               L++     LTG           FAI  
Sbjct: 970  NRFTKDTDTLDNEITESV--------------RLLIFQIANLTGIIILCIIYIPWFAIAM 1015

Query: 261  PIIWCTSVF--------GKQI-RMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEI 311
            P +    VF        G++I RM++ +   V  +   V      G+ T++ + +E+  +
Sbjct: 1016 PFLVFLYVFVADHYQASGREIKRMDAVQRSFVYNNFNEV----LGGMDTIKAYRSEQRFL 1071

Query: 312  KRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSM-SIGDLTA 370
             + + ++ ++ + G     I      S  ++  +  LI+         H S  S+G +  
Sbjct: 1072 MKSDFLINKMNEAGYLVTSIQRWVAISLDMLAVIFALIIALLCVTRQFHVSAGSVGVMVT 1131

Query: 371  FMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFK------PL 424
            ++L      NA+    +   +    + +A R+       P       EAK++      P 
Sbjct: 1132 YVLQLPGLLNALLRSQT---QTENDLNSAERLVNYAYDLPI------EAKYRILETQPPE 1182

Query: 425  NEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH 483
                   I+F+NVS  Y P  P     KN++  + +   + I G +G GKSTI S L   
Sbjct: 1183 QWPSEGRIKFENVSLAYRPELPV--ALKNVSIDIGSNEKIGICGRTGAGKSTIMSALYRL 1240

Query: 484  YNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT--YGLTEEP----- 536
                +G+I ID  DI+TL    LR K+ I+ Q+P+L  G IR N+      T+E      
Sbjct: 1241 VELKTGKITIDDIDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDAL 1300

Query: 537  ------SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIK 590
                   ++++  +  Q    N ++     +                ++Q +A+ RAL++
Sbjct: 1301 VRGGAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVR 1360

Query: 591  KPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDG 650
               ILILDEATS++D  ++  I      + +  + TI+ IAHRL TI  +  ++VL + G
Sbjct: 1361 GSKILILDEATSSVDYATDAKIQSRI--VEEFSNCTILCIAHRLKTILAYNRILVL-DQG 1417

Query: 651  SVVEMGKFKELYDN 664
             VVE    K+LY++
Sbjct: 1418 QVVEFDTPKKLYND 1431

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 93/214 (43%), Gaps = 24/214 (11%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F  LNF V     + I GP G GKS++ + L       SG + I G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEP-SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
             ++   P + + T++DNI +G    P  K + + V + C     +   P          
Sbjct: 640 --LLCGYPWVQNATVKDNILFG---SPFDKPKYQKVIEICSLQADLDILPA--GDRTEIG 692

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTI 627
                    QK RIA+AR++ K  +I + D+  SA+D    +  ++      +K K+  +
Sbjct: 693 ERGITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRIL 752

Query: 628 VSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +  H+LS I +   VI LG DGS  ++G   EL
Sbjct: 753 AT--HQLSLIDKASRVIFLGLDGS-FDIGTVPEL 783

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 123/514 (23%), Positives = 228/514 (44%), Gaps = 60/514 (11%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ + ++  ++H  L FFD    G +M+R   D   + + +T  +     S         
Sbjct: 1136 KIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVI 1195

Query: 243  LMLTLSRELTGALFAILPPIIWC-TSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRT 300
            L+  ++ +      AI+  I++     F        K+ + ++   + +   E   G+ T
Sbjct: 1196 LITFITPQFLSV--AIVVSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSETLVGVTT 1253

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLV-- 358
            ++ F    +E +     L++I +  K   ++       A  I  +G L++   G +++  
Sbjct: 1254 IRAF---GDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILSN 1310

Query: 359  ---MHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKST 415
               +   M+   LT  + +TE        L   YSE+   + +  R+ E  + E +  + 
Sbjct: 1311 IDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNQ 1366

Query: 416  TGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
              E    P       +IE  ++S  Y P  P  ++ KN++F V A S V IVG +G GKS
Sbjct: 1367 HKEVP--PPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKVGIVGRTGAGKS 1422

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE 534
            TI + L       +G I ID  DI+ ++ + LRR I I+ Q+P L SGTI+ N+      
Sbjct: 1423 TIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSGTIKTNL------ 1476

Query: 535  EPSKE-----------EIRLVAKQCFCHNFITKFP-DT-----------YDXXXXXXXXX 571
            +P  E            + LV+++      + +   DT            D         
Sbjct: 1477 DPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFLDLESEVSEGG 1536

Query: 572  XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIA 631
                  Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IA
Sbjct: 1537 SNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIA 1594

Query: 632  HRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            HRL ++  ++ ++V+       + G+ KE YD+P
Sbjct: 1595 HRLRSVIDYDKILVM-------DAGEVKE-YDHP 1620

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 121/543 (22%), Positives = 223/543 (41%), Gaps = 62/543 (11%)

Query: 152 LMGVGITLIFGCFAN---FGRVVILR----IISERLVSRLRSQVVKN------------- 191
           +M VG  L+  C A    FGR V +R    IISE     LR ++  N             
Sbjct: 399 IMFVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPAAEDPQAIN 458

Query: 192 ---IIHKDLEFFDTFKVGDLMSRVGNDAFVVSR--SITHKVADGVRSXXXXXXXXXLMLT 246
               I+ D E   +  +G +++ +  DAF VS      H   +              +L 
Sbjct: 459 DQKSINGDEESTSSANLGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALVLLYRLLG 518

Query: 247 LSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVA 306
           L+  L   +   + P+        K I    KK   VT +  +   E F  IR ++ F  
Sbjct: 519 LAAILGVLIIVAMLPL---NYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSW 575

Query: 307 ERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV--LTYGSYLVMHGSMS 364
           E N    F N ++ I +       +    ++ +S +  +   IV   ++  Y+ + G + 
Sbjct: 576 EEN----FENDIKAIRESELALLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVL 631

Query: 365 IG--DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-INDKEPKIKSTTGEAKF 421
                 TA  L+T    + +  LS   S ++Q   +  R+ + +N+K+ +        K+
Sbjct: 632 TTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDTE--------KY 682

Query: 422 KPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
             L  +  G    F+N +  +     +   K+LN +   G    ++GP+G GK+++   L
Sbjct: 683 DQLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMAL 742

Query: 481 LHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
           L     ++G++++   D +    +        I    Q   L++ T+++NI +    + +
Sbjct: 743 LGEMYLLNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFN--SQFN 800

Query: 538 KEEIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNIL 595
           +   + V + C    +F I K  D  +               QKQR+++ARAL      +
Sbjct: 801 ETRYKAVVEACGLKRDFEILKAGDLTE----IGEKGITLSGGQKQRVSLARALYSNARHV 856

Query: 596 ILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
           +LD+  SA+D  +   I  N   G +M+ ++  +VS  H ++   R  +++VL  DG V 
Sbjct: 857 LLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVK 914

Query: 654 EMG 656
           + G
Sbjct: 915 DQG 917

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 135/551 (24%), Positives = 230/551 (41%), Gaps = 66/551 (11%)

Query: 149  STFLMGVGITLIF-GCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            S F +G+ I  +F   F    +  IL  I       L  + VK ++H  + F DT  +G 
Sbjct: 892  SGFYIGLYIFFVFVNYFFMSLQFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGR 951

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXL------MLTLSRELTGALFAILPP 261
            +++R   D   +   +T  V   V           +         ++    G +F I+  
Sbjct: 952  VLNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVAD 1011

Query: 262  IIWCTSVFGKQIRMNSKKLQDVTGDLTRVT-EEQFNGIRTVQGFVAERNEIKRFNNVLRE 320
                +   G++I    K+L+ V          E  +G+ T++ + +E   + + + ++  
Sbjct: 1012 HYQSS---GREI----KRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINR 1064

Query: 321  IFQVGKESAFINGKFFTSASLIG-DLGFLIVLTYGSYLVMHGSMSIGDLTAFMLY----- 374
            + + G     +      S  +I      +I L   +      + S+G L  ++L      
Sbjct: 1065 MSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQLPGLL 1124

Query: 375  ---------TEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLN 425
                      E   N++  + ++ +EL Q   AA R  E+  +EP            P N
Sbjct: 1125 NGLLRAMTQAENDMNSVERIVNYATELPQE--AAYRKPEMTPQEPW-----------PSN 1171

Query: 426  EVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
                 E+ F NVS  Y P  P   + K ++  +  G  + I G +G GKSTI S L    
Sbjct: 1172 ----GEVVFDNVSLSYRPGLPL--VLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLC 1225

Query: 485  NAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YGLTEEP------- 536
                G++LIDG D + L    LRRK+ I+ Q+P+L  G+IR N+  +G  E+        
Sbjct: 1226 ELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALV 1285

Query: 537  -----SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKK 591
                   EE+  V  Q    +  +     +                ++Q +A+ RAL+++
Sbjct: 1286 RSGTIEAEEVEKVKNQHRDESGSSTGLHKFHLDQEVEDDGTNFSLGERQLLALTRALVRQ 1345

Query: 592  PNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGS 651
              ILILDEATS++D E++  I     Q  +    TI+ IAHRL TI  ++ ++VL N G+
Sbjct: 1346 SKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVLDN-GT 1402

Query: 652  VVEMGKFKELY 662
            V E    + L+
Sbjct: 1403 VKEFDTPRSLF 1413

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 96/215 (44%), Gaps = 26/215 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FKNLNF++  G  V I G  G GKS++ + L        G I  +G         SL   
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL--- 618

Query: 510 IGIVQQEPILMSGTIRDNITYG--LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
             ++   P + + T+RDNI +G    +   KE IR+ A Q      I    D  +     
Sbjct: 619 --LLCGYPWIQNTTVRDNILFGSSFDDVRYKEVIRVCALQADLD--ILPAGDFTE----I 670

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMT 626
                     QK RI +AR++ K  +I + D+  SA+D    +  ++     ++  K+  
Sbjct: 671 GERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGKTRI 730

Query: 627 IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           + +  H+LS I R   VI LG  GS  ++G  +EL
Sbjct: 731 LAT--HQLSLIERASRVIFLGAGGS-FDIGTVEEL 762

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 138/560 (24%), Positives = 234/560 (41%), Gaps = 86/560 (15%)

Query: 150  TFLMGVGITLIFGCFANF-GRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
            +F MG+    +FG +     +  IL  I       L  Q +K IIH  + F DT  +G +
Sbjct: 933  SFYMGLYSFFVFGAYIFMTSQFTILCYIGIGASKNLNIQALKRIIHTPMSFMDTTPIGRI 992

Query: 209  MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSR--ELTGA---------LFA 257
            ++R   D    + S+ +++ + VR            LT+S+   + G           FA
Sbjct: 993  LNRFTKD----TDSLDNELIENVR------------LTVSQFANIVGVCVMCIVYLPWFA 1036

Query: 258  ILPPIIWCTSVF--------GKQIRMNSKKLQDVTGDLTRVT-EEQFNGIRTVQGFVAER 308
            I  P +    VF        G++I    K+L+ +          E   G+ T++ + +E 
Sbjct: 1037 IAVPFLVFIFVFIQNHYQSAGREI----KRLEAIQRSFVYNNFNEILGGMDTIKFYKSEE 1092

Query: 309  NEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-GSMSIGD 367
              I + + ++ ++ + G  +  +         +I     LI+         H  + S+G 
Sbjct: 1093 RYIAKSDYLIDKMNEAGYLTVCVQRWVAILVDMIAVAFALIITLLCVTRQFHISASSVGV 1152

Query: 368  LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG---EAKFK-- 422
            L  ++L           L   ++ L++ V       ++N  E  +   T    EA++   
Sbjct: 1153 LLTYVL----------QLPGLFNTLLRAVSQVEN--DMNSTERLVSYATDLPLEAQYHKP 1200

Query: 423  ----PLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477
                P +      I+F+NV F Y P  P   + KN+N ++     + I G +G GKSTI 
Sbjct: 1201 ETAPPESWPEEGTIKFENVDFAYRPGLPI--VLKNINLQINGTEKIGICGRTGAGKSTIM 1258

Query: 478  SLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT--YGLTEE 535
            + L       SG ILID  DI  L    LR+K+ I+ Q+P+L  G IR N+   +  T+E
Sbjct: 1259 TALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDE 1318

Query: 536  P-----------SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAI 584
                        + E++     Q    +  +     +                ++Q +A+
Sbjct: 1319 ELWDVLVRGGAIAPEDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILAL 1378

Query: 585  ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVI 644
             RAL++   ILILDEATS++D E++  I             TI+ IAHRL TI  ++ ++
Sbjct: 1379 TRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRIL 1436

Query: 645  VLGNDGSVVE----MGKFKE 660
            VL + G V E    M  FK+
Sbjct: 1437 VLEH-GEVAEFDTPMNLFKD 1455

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 99/208 (47%), Gaps = 22/208 (10%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F NLNF++  G  V I GP G GK+++ +         SG I I+G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
             ++   P + + T+RDNI +G   E  K   + V + C   + +   P           
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEEDK--YKEVLRACSLESDLDILPA--GDKTEIGE 713

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIV 628
                   QK RI +AR + K+ +I +LD+  SA+D    +  ++    +++ +K+  + 
Sbjct: 714 RGITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLA 773

Query: 629 SIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
           +  H+LS I +   +IVLGNDGS VE+G
Sbjct: 774 T--HQLSLIDKASRIIVLGNDGS-VEIG 798

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 131/528 (24%), Positives = 237/528 (44%), Gaps = 67/528 (12%)

Query: 171  VILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVAD 229
            VIL  IS    SR + + ++K +++  L FFD+   G +M+R   D   +   +      
Sbjct: 1145 VILSYISGLKASRKIFTLLLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEG 1204

Query: 230  GVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF--GKQIRMNSKKLQDVTGDL 287
               S         L+  ++      +F     +I C S +  G    + S++LQ      
Sbjct: 1205 AFASLVQCITTILLIGYIT-----PVFLFFAIVI-CVSYYIVGYFYLVGSRELQRFESIT 1258

Query: 288  TRVTEEQFN----GIRTVQGFVAER----NEIKRFNNVLREIFQVGKESAFINGKFFTSA 339
                 + F+    G+ T++ F  ER    + + + +   R  F +     ++  ++   A
Sbjct: 1259 KSPIHQHFSETLVGVTTIRAFGDERRFLADNLSKVDTHNRPFFYL-----WVTNRWL--A 1311

Query: 340  SLIGDLGFLIVLTYGSYLVMH-GSMSIGDLTAFMLYT-EYTGNAIFGLSSFYSELMQGVG 397
              I  +G  ++L  G +++++  S+  G     ++Y   +T  A++ L   YS +   + 
Sbjct: 1312 FRIDFIGAFVILASGIFILLNVNSLDAGLAGISLIYAISFTEGALW-LVRLYSNVEMTMN 1370

Query: 398  AASRIFEIN--DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNF 455
            +  R+ E    ++EP    +TG  +  P     G +IE  N+S  Y +    ++ KN+ F
Sbjct: 1371 SVERLKEYMKIEQEP----STGLYEPPPEWPDRG-KIEVNNLSLRYASN-LPKVIKNVTF 1424

Query: 456  KVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQ 515
             V   S V IVG +G GKSTI + L    +  +G I +D  DI ++  K LR+ I I+ Q
Sbjct: 1425 TVEPQSKVGIVGRTGAGKSTIITALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQ 1484

Query: 516  EPILMSGTIRDNI----TYG--------------LTEEPSKEEIRLVAKQCFCHNFITKF 557
            +P+L +GTI+ N+     Y               + EE +  +I   +      N + KF
Sbjct: 1485 DPVLFAGTIKSNLDPYSEYADDRIFEALKRVNLIVQEELTPTDIPSSSSSLSFEN-VNKF 1543

Query: 558  PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617
                D               Q+Q + +AR+L++ P  ++LDEAT+++D  S+  I  T  
Sbjct: 1544 ---LDLTSEITEGGSNLSQGQRQLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIR 1600

Query: 618  QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +  +    TI++IAHRL +I  ++ V+       V++ G+  E YD+P
Sbjct: 1601 E--EFSGSTILTIAHRLRSIIDYDKVL-------VIDSGELAE-YDHP 1638

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 97/219 (44%), Gaps = 11/219 (5%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG---QDIATLNTKSL 506
            KNLN     G    IVGP+G GK+++   LL   N   G+I +     ++   ++   +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 507 RRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXX 566
              IG   Q   L++ T+R+NI +    E ++    + A        I    D  +    
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEANRYNAVIHACGLTRDLEILNAGDQTE---- 845

Query: 567 XXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKS 624
                      QKQR+++ARA+  +   ++LD+  SA+D  +   I  +   G +M+ ++
Sbjct: 846 VGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRT 905

Query: 625 MTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
             +VS  H  +   +  D +V+  +  V   G+  EL++
Sbjct: 906 CVLVS--HNTALTLKNADWVVILENAKVTAQGEPLELFN 942

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 133/518 (25%), Positives = 233/518 (44%), Gaps = 80/518 (15%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            ++K +++  L FFD+  +G +M+R   D   V + +T  V     S         L+  L
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVS---------LVQCL 1183

Query: 248  SRELTGALFAILPPIIWCTSVF--------GKQIRMNSKKLQDVTGDLTRVTEEQFN--- 296
            S   T  L A + P  +  ++F        G      S++L+           + F+   
Sbjct: 1184 S---TVILIAYITPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETL 1240

Query: 297  -GIRTVQGFVAERNEIKRF-NNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG 354
             GI T++ F  ER    RF    L +I +  K   ++       A  I  +G  ++   G
Sbjct: 1241 VGITTIRAFGDER----RFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAG 1296

Query: 355  SYLVMH-GSMSIGDLTAFMLYT-EYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KEP 410
             +++++  S+  G     + Y   +T  A++ L   YS +   + +  R+ E  +  +EP
Sbjct: 1297 IFVLLNIKSLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVERLKEYMEVEQEP 1355

Query: 411  KIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPS 469
              +ST       P       +IE  ++S  Y P+ P  ++ KN+ F V     V IVG +
Sbjct: 1356 HYQSTHNPPPEWP----SQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRT 1409

Query: 470  GRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
            G GKSTI + L    +  SG I ID  DI ++  K LR+ I I+ Q+P L +GT++ N+ 
Sbjct: 1410 GAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNL- 1468

Query: 530  YGLTEEPSKEEIRLVAKQCFCHNFITK---------FPDTYDXXXXXXXXX--------- 571
                +E S ++I    K+    N +T+          PD                     
Sbjct: 1469 -DPYDEYSDKQIFEALKRV---NLVTQEELDHAANPSPDNASAVSENVNKFLFLENEISE 1524

Query: 572  --XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSK--SMTI 627
                    Q+Q + +AR+L++ P +++LDEAT+++D +S+  I     Q ++S+    TI
Sbjct: 1525 GGSNLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQ----QTIRSEFSDSTI 1580

Query: 628  VSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            ++IAHRL +I  ++ ++V+       + G+ KE YD+P
Sbjct: 1581 LTIAHRLRSIIDYDKILVM-------DAGEVKE-YDHP 1610

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 105/480 (21%), Positives = 196/480 (40%), Gaps = 47/480 (9%)

Query: 202 TFKVGDLMSRVGNDAFVVSR--SITHKVADGVRSXXXXXXXXXLMLTLSRELTGALF--A 257
           T  +G +++ +  DAF VS   +  H   + +            +L  S  + GAL   A
Sbjct: 469 TANLGAIINLMAVDAFKVSEICAYLHSFVEALVMTIVALTLLYKLLGWS-AIIGALLIVA 527

Query: 258 ILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV 317
           ILP      ++ GK      K+    T    +   E F  IR ++ F  E N  K   ++
Sbjct: 528 ILPLNFRLATLIGKL----QKETLSFTDKRIQKLNETFQAIRIIKFFSWEENFEKDIQSI 583

Query: 318 ----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSM--SIGDLTAF 371
               L+ + +     A     +F + +++  + F        Y+ + G +  +    TA 
Sbjct: 584 RDQELKMLVKRSVAWALTAFVWFITPTIVTSVSF------AFYIYVQGEVLTTPVAFTAL 637

Query: 372 MLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCE 431
            L+T    N +  LS   S ++Q   +  R+        +      E +      V   +
Sbjct: 638 SLFT-LLRNPLDMLSDMLSYVIQSKVSLDRV--------QEFLEEEETEKYEQITVHRNK 688

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           I F+N +F +  +  +   KN+N     G    ++GP+G GK+++   LL   + + G++
Sbjct: 689 IGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKV 748

Query: 492 L---IDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKE-EIRLVAKQ 547
               +D ++   +    +   I    Q   L++ T+++NI +     P  E     V + 
Sbjct: 749 YAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEA 805

Query: 548 C-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD 605
           C    +F I    D  +               QKQR+++ARAL      L+LD+  SA+D
Sbjct: 806 CGLKRDFEILSAGDQTE----IGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVD 861

Query: 606 VESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
             +   I  N   G +M+ ++  +VS  H ++   +  + +V   +G V + G+  ELY+
Sbjct: 862 SHTALWIYENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELYN 919

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 124/517 (23%), Positives = 224/517 (43%), Gaps = 66/517 (12%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ + ++  ++H  + FFD    G +M+R   D   + + +T  +     S         
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVI 1195

Query: 243  LMLTLSRELTGALFAILPPIIWC-TSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRT 300
            L+  ++ +      AI+  I++     F        K+ + ++   + +   E   G+ T
Sbjct: 1196 LITFITPQFLSV--AIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTT 1253

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLV-- 358
            ++ F    +E +     L +I +  K   ++       A  I  +G L++   G +++  
Sbjct: 1254 IRAF---GDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFN 1310

Query: 359  ---MHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKST 415
               +   M+   LT  + +TE        L   YSE+   + +  R+ E  + E +  + 
Sbjct: 1311 INNLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNE 1366

Query: 416  TGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
              E    P       +IE  ++S  Y P  P  ++ KN++F V A S + IVG +G GKS
Sbjct: 1367 HKE--IPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKS 1422

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN------- 527
            TI + L       +G I ID  DI+ ++ + LRR I I+ Q+P L SGTI+ N       
Sbjct: 1423 TIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEF 1482

Query: 528  -------------------ITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
                               +  G T E S E     A      N + KF    D      
Sbjct: 1483 SDRQIFEALKRVNLISEEQLQQGATRETSNE-----ASSTNSEN-VNKF---LDLSSEIS 1533

Query: 569  XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIV 628
                     Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI+
Sbjct: 1534 EGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTIL 1591

Query: 629  SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +IAHRL ++  ++ ++V+       + G+ KE YD+P
Sbjct: 1592 TIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP 1620

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 128/557 (22%), Positives = 226/557 (40%), Gaps = 90/557 (16%)

Query: 152 LMGVGITLIFGCFAN---FGRVVILR----IISERLVSRLRSQVVKN------------- 191
           +M VG  L+  C A    FGR V +R    IISE     LR ++  N             
Sbjct: 399 VMFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEIN 458

Query: 192 ---IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLS 248
               I+ D E   +  +G +++ +  DAF VS     ++   + S         + L L 
Sbjct: 459 DQKSINGDEESTSSANLGAIINLMAIDAFKVS-----EICGYLHSFLEAFVMTVVALALL 513

Query: 249 RELTG--------ALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRT 300
             L G         + A+LP          K I    KK   VT +  +   E F  IR 
Sbjct: 514 YRLLGFAAIVGVLIIVAMLP----LNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRI 569

Query: 301 VQGFVAERNEIKRFNNV---------LREIFQVGKESAFINGKFFTSASLIGDLGFLIVL 351
           ++ F  E N  K  N +         +R I  V   S+F+   +F + +++    F    
Sbjct: 570 IKYFSWEENFEKDINTIRENELSLLLMRSI--VWSISSFL---WFVTPTIVTAASF---- 620

Query: 352 TYGSYLVMHGSMSIG--DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-INDK 408
               Y+ + G +       TA  L+T    + +  LS   S ++Q   +  R+ + +N+ 
Sbjct: 621 --AYYIYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEN 677

Query: 409 EPKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVG 467
           + K        K+  L  +  G    F+N +  +     +   K+LN +   G    ++G
Sbjct: 678 DTK--------KYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIG 729

Query: 468 PSGRGKSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524
           P+G GK+++   LL     ++G++++   + +    ++       I    Q   L++ T+
Sbjct: 730 PTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTV 789

Query: 525 RDNITYGLTEEPSKE-EIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQR 581
           ++NI +     P  E   + V + C    +F I K  D  +               QKQR
Sbjct: 790 KNNILFN---SPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGG----QKQR 842

Query: 582 IAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRR 639
           +++ARAL      ++LD+  SA+D  +   I  N   G +M+ ++  +VS  H ++   R
Sbjct: 843 VSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLR 900

Query: 640 FEDVIVLGNDGSVVEMG 656
             +++VL  DG V + G
Sbjct: 901 NAELVVLLEDGRVKDQG 917

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 140/530 (26%), Positives = 238/530 (44%), Gaps = 50/530 (9%)

Query: 162  GCFANFGRVVILRII-SERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVS 220
            G F N  R + + +  S R   +L +++ K I+   + FF+T   G +++R  +D   V 
Sbjct: 1005 GAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVD 1064

Query: 221  RSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKL 280
             ++ +  +   RS         +++T +  L   L A L  I      F   +    K+L
Sbjct: 1065 TTLQNVFSLFFRSILDYIITV-ILVTFNMPLFFLLNAGLLVIYLYYQSFYIVLSRELKRL 1123

Query: 281  QDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKF---F 336
              ++   +  +  E  +G  T+  +     +I+RF+++  E  Q    + F N +    +
Sbjct: 1124 TSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQFSI-NCFFNYRSSNRW 1178

Query: 337  TSASLIGDLGFLIVLTYG----SYLVMHGSMSIGDLTAFMLYT-EYTGNAIFGLSSFYSE 391
             S  L   +G LIVL+ G    S L     +S G +   M Y  + T + I+ + S  S 
Sbjct: 1179 LSVRL-QSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRS--SV 1235

Query: 392  LMQ-GVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIF 450
            L++  + +  RI E  D  P+      E +    N     +IEFKN S  Y     + + 
Sbjct: 1236 LIETNIVSVERIVEYCDISPEAPEVKEEHRLDD-NWPNQGQIEFKNYSTSY-RENLDPVL 1293

Query: 451  KNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKI 510
            K++N  +  G  + +VG +G GKST++  L       +G I ID  DI ++  + LR  I
Sbjct: 1294 KHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHI 1353

Query: 511  GIVQQEPILMSGTIR-----------DNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
             I+ Q+     GTIR           D++ + +     K  +  +AK+    N  +++ D
Sbjct: 1354 AIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEI---NDDSEYSD 1410

Query: 560  TYDXXX----XXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 615
                                  QKQ + +ARAL+ K  IL+LDEAT+++DVE++  I  T
Sbjct: 1411 RSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQET 1470

Query: 616  FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              +    +  TI++IAHRL T+   + +IVL  DG     G+ KE +D P
Sbjct: 1471 IRKEFADR--TILTIAHRLDTVFDSDRIIVL--DG-----GEVKE-FDKP 1510

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 97/215 (45%), Gaps = 16/215 (7%)

Query: 454 NFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIV 513
           NF+VP  S +C+VG  G GKSTI   +L     +SG       D  +   +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 514 QQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXX 573
            QE  +M+ +++DNI +G   +  +   +   K C     I   PD              
Sbjct: 694 PQEAWIMNASVKDNILFG--HKYDEAFYKATIKACQLLPDIKVLPD--GDETMVGEKGIV 749

Query: 574 XXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---IMKSKSMTIVS 629
               QK R+++ARA+  + ++ +LD+  SA+D E  +  I     +   ++K KS  IV 
Sbjct: 750 LSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IVL 807

Query: 630 IAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
             + +S ++    + +L N  S+ + G + ++ +N
Sbjct: 808 ATNTISVLKHSTKIYLLENK-SIAQEGNYDDIMNN 841

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 121/512 (23%), Positives = 228/512 (44%), Gaps = 70/512 (13%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            ++  ++H  L FFD+  +G +M+R   D     + +T  +     S         L+  +
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 248  SREL--TGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGF 304
            + +      L A+L   +    + G +     K+L+ ++   + +   E   G+ T++ F
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSR---ELKRLESISRSPIYQHFSETLVGVTTIRAF 1244

Query: 305  VAE----RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH 360
              E    R  +++ +   R  F +   + +++ +       I  +G L++   G +++++
Sbjct: 1245 GDESRFMRENLQKIDENNRPFFYLWVANRWLSFR-------IDMIGALVIFGAGIFVLLN 1297

Query: 361  ------GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KEPKI 412
                  G   I  LT  + +TE        L   YS +   + +  R+ E  D  +EP  
Sbjct: 1298 IDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYD 1352

Query: 413  KSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGR 471
            +S        P+       IE  ++S  Y P  P  ++ KN++F V   S V IVG +G 
Sbjct: 1353 QSILT----PPVEWPQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGA 1406

Query: 472  GKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYG 531
            GKSTI + L    +  +G I ID  DI +++ + LRR I I+ Q+P L +GTI+ N+   
Sbjct: 1407 GKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNL--D 1464

Query: 532  LTEEPSKEEIRLVAKQCFCHNFITK------------------FPDTYDXXXXXXXXXXX 573
              +E + ++I    K+    N +T+                       D           
Sbjct: 1465 PYDEYTDQQIFEALKRV---NLVTQEELDRRPTSESSSVSSENINKFLDLSSEISEGGGN 1521

Query: 574  XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR 633
                Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +       TI++IAHR
Sbjct: 1522 ISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHR 1579

Query: 634  LSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            L ++  ++ ++V+       + G+ KE +D+P
Sbjct: 1580 LRSVIDYDKILVM-------DAGEVKE-FDHP 1603

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 107/492 (21%), Positives = 196/492 (39%), Gaps = 63/492 (12%)

Query: 193 IHKDLEFFDTFKVGDLMSRVGNDAFVVSR--SITHKVADGVRSXXXXXXXXXLMLTLSRE 250
           I+ D E   +  +G +++ +  DAF VS   +  H   + V            +L  +  
Sbjct: 465 INGDEESTTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVVMALVAFVLLYHLLGFAAI 524

Query: 251 LTGALFAILPPI-----IWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFV 305
           +  AL   + P+      W   +  + + +  K++Q +         E F  IR ++ F 
Sbjct: 525 VGAALIVAMMPLNFKLATWLGHLQKETLSVTDKRIQKLN--------EAFQAIRIIKFFS 576

Query: 306 AERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSI 365
            E N    F   +R++    +E+     KF    SL+           GS  V + + +I
Sbjct: 577 WENN----FEKDIRDV----RETEL---KFLMKRSLVWA---------GSSFVWYITPTI 616

Query: 366 GDLTAFMLYTEYTGNAI-----FGLSSFYSELMQGVGAASRI--FEINDKEP--KIKSTT 416
               AF  Y    G  +     F   S +S L   +   S +  F I  K    +++   
Sbjct: 617 VTSCAFWFYIYIQGEVLTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFL 676

Query: 417 GEAKFKPLNEVGGCE----IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRG 472
            E   +  N++   +    I F+N +  +     +   KNLN     G    I+GP+G G
Sbjct: 677 EEKDTEKYNQLSTAKDKKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSG 736

Query: 473 KSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
           K+++   LL   + VSG+I++   D +    +    +   +    Q   L++ T+++NI 
Sbjct: 737 KTSLLMALLGEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNIL 796

Query: 530 YGLTEEPSKEEIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARA 587
           +       + E   V + C    +F I    D  +               QKQRI++AR+
Sbjct: 797 FNSPYNEGRYEA--VVEACGLKRDFSILSAGDLTE----IGERGITLSGGQKQRISLARS 850

Query: 588 LIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIV 645
           L      ++LD+  SA+D  +   I  N   G +M+ ++  +VS  H  +   R  +++V
Sbjct: 851 LYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVV 908

Query: 646 LGNDGSVVEMGK 657
              +G V   G+
Sbjct: 909 TMENGQVKNQGE 920

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 129/512 (25%), Positives = 235/512 (45%), Gaps = 39/512 (7%)

Query: 169  RVVILRIISERLVSRLRSQVVKN-IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKV 227
            + VIL +      SR    ++ N ++   + FF+T  +G +++R  ND + V   +    
Sbjct: 1012 QTVILWVFCTIQGSRYLHTLMTNAVLRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTF 1071

Query: 228  ADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDL 287
            +    +         ++   + +    +F I+P  ++   ++ +Q  + + +       +
Sbjct: 1072 SQFFVNAVKVSFTIGVICVTTWQF---IFVIVPLGVF--YIYYQQYYLRTSRELRRLDSI 1126

Query: 288  TRVT-----EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAF---INGKFFTSA 339
            TR       +E   GI T++G+     + KRF+ +  +       SAF   +N   + + 
Sbjct: 1127 TRSPVYSHFQETLGGIVTIRGY----GQQKRFSQI-NQCRVDNNMSAFYPSVNANRWLAY 1181

Query: 340  --SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVG 397
               LIG +  L   T     +  G+++ G +   + Y      ++  +     E+   + 
Sbjct: 1182 RLELIGSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIV 1241

Query: 398  AASRIFEIND---KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPT-NQIFKNL 453
            +  RI E  D   + P+I       +  P  E G  +I+F++ S  Y  RP  + + K++
Sbjct: 1242 SVERIKEYADLKSEAPEIIEDHRPQETWP--EEG--DIKFEHYSTRY--RPELDLVLKDI 1295

Query: 454  NFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIV 513
            NF +     + IVG +G GKS++   L     A  G I+ID  DI+ +    LR K+ I+
Sbjct: 1296 NFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSII 1355

Query: 514  QQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI-TKFPDTYDXXXXXXXXXX 572
             Q+  +  GTIR+NI    T + + E+I  V +     + I T   D  D          
Sbjct: 1356 PQDSQVFEGTIRENI--DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLD--TKLNEGGS 1411

Query: 573  XXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
                 Q+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T     K +  TI++IAH
Sbjct: 1412 NLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAH 1469

Query: 633  RLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            R++TI   + ++VL N GS+ E  + K+L +N
Sbjct: 1470 RINTIMDNDRIMVLDN-GSIKEFDEPKKLLEN 1500

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 86/405 (21%), Positives = 161/405 (39%), Gaps = 55/405 (13%)

Query: 278 KKLQ----DVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV-----LREIFQVGKES 328
           KKLQ        + TRV  E  N I++++ +  E     +  NV     L+ + ++G   
Sbjct: 469 KKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYM 528

Query: 329 AFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSF 388
           A ++ +F     L+    F  V  Y     +   +    LT F L        +  + + 
Sbjct: 529 ALMSFQFNVVPFLVSCSTF-AVFVYTEDRPLTTDLVFPALTLFNL----LHFPLMVIPNV 583

Query: 389 YSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSFFYPTRPTN 447
            + L++   +  R+F     E   K +    +   + E+G   I    + +F +  +P  
Sbjct: 584 LTALIECSVSVGRLFSFLTNEELQKDSV--QRLPKVTEIGDVAINVGDDATFLWQRKPEY 641

Query: 448 QI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSL 506
           ++  KN+NF+   G   CIVG  G GKS +   +L     V G   I G           
Sbjct: 642 KVALKNVNFQAKKGELTCIVGRVGSGKSALIQSILGDLFRVKGFATIHGN---------- 691

Query: 507 RRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXX 566
              +  V Q   +M+GT++DNI +G   +   E      K C     ++   D       
Sbjct: 692 ---VAYVSQVAWIMNGTVKDNILFG--HKYDAEFYEKTIKACALTIDLSVLVD--GDQTL 744

Query: 567 XXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD----------VESEGAINYTF 616
                      QK R+++ARA+  + +  +LD+  +A+D          V     + +T 
Sbjct: 745 VGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK 804

Query: 617 GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +++ +  ++++S+A          D + L  +G +V+ G + E+
Sbjct: 805 TKVLATNKVSVLSVA----------DSVSLLENGEIVQQGSYDEI 839

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 131/551 (23%), Positives = 237/551 (43%), Gaps = 62/551 (11%)

Query: 141  IKILNIPLSTFLMGVGITLI-FGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEF 199
            I  L I L+  L+G G T++ F    N  R             ++ + ++  ++H  + F
Sbjct: 1106 ILYLIIGLAQSLLGAGKTILNFAAGINASR-------------KIFNMILNKVLHSKIRF 1152

Query: 200  FDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAIL 259
            FD    G +M+R   D   + + +T  +     S         L+  ++ +      AI+
Sbjct: 1153 FDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLS--IAIV 1210

Query: 260  PPIIWC-TSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV 317
              I++     F        K+ + ++   + +   E   G+ T++ F    +E +     
Sbjct: 1211 VSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAF---GDEGRFMQEN 1267

Query: 318  LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-----GSMSIGDLTAFM 372
            L++I +  K   ++       A  I  +G L++   G +++ +       M+   LT  +
Sbjct: 1268 LQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNIDHIDSGMAGISLTYAI 1327

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEI 432
             +TE        L   YSE+   + +  R+ E    E +  +   E    P       +I
Sbjct: 1328 SFTE----GALWLVRLYSEVEMNMNSVERVKEYMKIEQEPYNQHKEVP--PSQWPQDGKI 1381

Query: 433  EFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
            E  ++S  Y P  P  ++  N++F V A S + IVG +G GKSTI + L       +G I
Sbjct: 1382 EVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHI 1439

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YG----------------LTE 534
             ID  DI+ ++ + LRR I I+ Q+P L SGTI+ N+  Y                 ++E
Sbjct: 1440 KIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISE 1499

Query: 535  EPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNI 594
            E S +     A      N         D               Q+Q + +AR+L++ P I
Sbjct: 1500 EQSHQGAVREADNDTSSNSSENINKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKI 1559

Query: 595  LILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            ++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL ++  ++ ++V+       +
Sbjct: 1560 ILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------D 1610

Query: 655  MGKFKELYDNP 665
             G+ KE YD+P
Sbjct: 1611 AGEVKE-YDHP 1620

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 129/558 (23%), Positives = 220/558 (39%), Gaps = 94/558 (16%)

Query: 153 MGVGITLIFGCFAN---FGRVVILR----IISERLVSRLRSQVVKN-------------- 191
           M VG  L+  C A    FGR V +R    IISE     LR  +  N              
Sbjct: 400 MFVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRMISTNKAKPTNEDPQEIND 459

Query: 192 --IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSR 249
              I+ D E   +  +G +++ +  DAF VS     ++   + S         + L L  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVS-----EICGYLHSFLEAFVMTVVALALLY 514

Query: 250 ELTG--------ALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTV 301
            L G         + A+LP          K I    KK   VT +  +   E F  IR +
Sbjct: 515 HLLGFAAIVGVLIIVAMLP----LNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRII 570

Query: 302 QGFVAERNEIKRFNNVLRE-----------IFQVGKESAFINGKFFTSASLIGDLGFLIV 350
           + F  E N  K  N + RE           I+ +     F+     T+AS          
Sbjct: 571 KYFSWEENFEKEINTI-RENELSLLLMRSIIWSISSFVWFVTPTIVTAAS---------- 619

Query: 351 LTYGSYLVMHGSMSIG--DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-IND 407
             +  Y+ + G +       TA  L+T    + +  LS   S ++Q   +  R+ + +N+
Sbjct: 620 --FAYYIYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNE 676

Query: 408 KEPKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466
           K+ K        K+  L  +  G     +N +  +     +   K+LN +   G    ++
Sbjct: 677 KDTK--------KYDQLTIDPNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVI 728

Query: 467 GPSGRGKSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGT 523
           GP+G GK+++   LL     ++G+I++   + +    ++       I    Q   L++ T
Sbjct: 729 GPTGSGKTSLLMALLGEMYLLNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDT 788

Query: 524 IRDNITYGLTEEPSKE-EIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQ 580
           I+ NI +     P  E   + V + C    +F I K  D  +               QKQ
Sbjct: 789 IKHNILFN---SPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGIALSGG----QKQ 841

Query: 581 RIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIR 638
           R+++ARAL      ++LD+  SA+D  +   I  N   G +M+ ++  +VS  H ++   
Sbjct: 842 RVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTL 899

Query: 639 RFEDVIVLGNDGSVVEMG 656
           R  +++VL  DG + + G
Sbjct: 900 RNAELVVLLEDGRIKDQG 917

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 134/517 (25%), Positives = 226/517 (43%), Gaps = 78/517 (15%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            ++K +++  L FFD+  +G +M+R   D   V + +T  V     S         L+   
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILI--- 976

Query: 248  SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQG 303
               +T   F +   I     + G      S++L+           + F+    GI T++ 
Sbjct: 977  -AYITPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRA 1035

Query: 304  FVAERNEIKRF-NNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-G 361
            F  ER    RF    L +I +  K   ++       A  I  +G  ++   G +++++  
Sbjct: 1036 FGDER----RFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIK 1091

Query: 362  SMSIGDLTAFMLYT-EYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KEPKIKSTTGE 418
            S+  G     + Y   +T  A++ L   YS +   + +  R+ E  +  +EP  +ST   
Sbjct: 1092 SLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHTP 1150

Query: 419  AKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477
                P       +IE  ++S  Y P+ P  ++ KN++F V     V IVG +G GKSTI 
Sbjct: 1151 PPEWP----SQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTII 1204

Query: 478  SLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI----TYG-- 531
            + L    +  SG I ID  DI ++  K LR+ I I+ Q+P L +GT++ N+     Y   
Sbjct: 1205 TALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDG 1264

Query: 532  -----------LTEE---------PSKEEIRL--VAKQCFCHNFITKFPDTYDXXXXXXX 569
                       LTEE         P    I    V K     N IT+             
Sbjct: 1265 QIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEITE------------- 1311

Query: 570  XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-GQIMKSKSMTIV 628
                    Q+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  G+   S   TI+
Sbjct: 1312 GGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TIL 1368

Query: 629  SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            +IAHRL +I  ++ ++V+       + G+ KE YD+P
Sbjct: 1369 TIAHRLRSIIDYDKILVM-------DAGEVKE-YDHP 1397

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 127/546 (23%), Positives = 221/546 (40%), Gaps = 90/546 (16%)

Query: 167 FGRVVILR----IISERLVSRLRSQVVKNII--------------HKDL---EFFDTFKV 205
           FGR V +R    IISE     LR +   N                 KD+   E   T  +
Sbjct: 199 FGRRVCIRMKAIIISEIYTKALRRKTSPNKSKSPTDEVDPQTLNEQKDIDADEESSTANL 258

Query: 206 GDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTG--ALFAILPPII 263
           G +++ +  DAF VS     ++   + S         + LTL  +L G  A+  +L  I+
Sbjct: 259 GAIINLMAVDAFKVS-----EICAYLHSFVEALVMTIVALTLLYKLLGWSAIVGVLLIIV 313

Query: 264 WCTSVFGKQIRMNSKKLQDVTGDLTRVT-----------EEQFNGIRTVQGFVAERNEIK 312
                F         KL ++ G+L + T            E F  IR ++ F  E N  K
Sbjct: 314 ILPLNF---------KLANLLGNLQKETLSFTDKRIQKLNETFQAIRIIKFFSWEENFEK 364

Query: 313 RFNNVL-REIFQVGKES---AFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIG-- 366
              N+  +E+  + K S   A     +F + S++  + F       +Y+ + G +     
Sbjct: 365 DIQNIRDQELKMLVKRSIVWALTAFVWFVTPSIVTTVSF------ATYIYIQGEVLTTPV 418

Query: 367 DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRI--FEINDKEPKIKSTTGEAKFKPL 424
             TA  L+T    N +  LS   S ++Q   +  R+  F   D+  K    T   K    
Sbjct: 419 AFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRVQVFLEEDETEKYDQITVSRK---- 473

Query: 425 NEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
                  I F+N +F +  +  +   KN++ +   G    ++GP+G GK+++   LL   
Sbjct: 474 ------RIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEM 527

Query: 485 NAVSGQIL---IDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKE-E 540
           + + G++    +D ++   +    +   I    Q   L++ T+++NI +     P  E  
Sbjct: 528 DLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFS---SPFNEAR 584

Query: 541 IRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILD 598
              V + C    +F I    D  +               QKQR+++ARAL      L+LD
Sbjct: 585 YDAVVEACGLKRDFEILSAGDQTE----IGEKGITLSGGQKQRVSLARALYSSSRHLLLD 640

Query: 599 EATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
           +  SA+D  +   I  N   G +M+ ++  +VS  H ++   +  D +V   +G V + G
Sbjct: 641 DCLSAVDSHTALWIYENCITGPLMEGRTCILVS--HNVALTLKNADWVVFMENGKVKDQG 698

Query: 657 KFKELY 662
           +  EL+
Sbjct: 699 EPLELF 704

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 132/512 (25%), Positives = 227/512 (44%), Gaps = 61/512 (11%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ S ++   +H +L FFD+  +G +M+R   D   V + +   +   +           
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTIL 1198

Query: 243  LMLTLSRELTGALFAILPP-IIWCTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRT 300
            L+  ++ E    + AIL   + +   V         K+   +T   + +   E   G+ T
Sbjct: 1199 LITYITPEFL--IIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLVGVTT 1256

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFF-------TSASLIGDLGFLIVLTY 353
            V+ +  E     RF   +RE  ++  E+   N  FF         A  I  +G L++   
Sbjct: 1257 VRAYGDE----ARF---MRENLKMIDEN---NKPFFYLWVSNRWLAFRIDVVGALVIFGS 1306

Query: 354  GSYLVMHGSMSIGDLTAFML--YTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KE 409
            G +++++       L    L     +T +A++ L   YS L   + +  R+ E  +  +E
Sbjct: 1307 GVFVLLNIDKIDSGLAGISLSFAISFTESALW-LVRHYSNLEMNMNSVERLMEYMEVEQE 1365

Query: 410  PKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGP 468
            P   S+       P  E G  +IE  +VS  Y P  P  ++ KN  F V     V IVG 
Sbjct: 1366 PYKSSSLDVPSSWP--EEG--KIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGR 1419

Query: 469  SGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI 528
            +G GKSTI + L    +  +G I ID  DI+T+  K LRR I I+ Q+P L SGTI+ N+
Sbjct: 1420 TGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNL 1479

Query: 529  T-YGLTEEP----SKEEIRLVA----------KQCFCHNFITKFPDTYDXXXXXXXXXXX 573
              Y    E     + + + LV           +Q        KF +  +           
Sbjct: 1480 DPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNVNN---EISEGGSN 1536

Query: 574  XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR 633
                Q+Q + +AR+L++ P +++LDEAT+++D  S+  I  T     +    TI++IAHR
Sbjct: 1537 LSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHR 1594

Query: 634  LSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            L T+  ++ ++V+       + G+ KE +D+P
Sbjct: 1595 LRTVIDYDKILVM-------DAGEVKE-FDHP 1618

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 131/563 (23%), Positives = 229/563 (40%), Gaps = 86/563 (15%)

Query: 148 LSTFLMGVGITLIFGCFAN---FGRVVILR----IISE-------RLVSRLRSQVVKNI- 192
           L  FLM     ++  C      FGR V +R    ++SE       R +S  +S  +K++ 
Sbjct: 398 LYVFLMFFCRVIVAACSGQALFFGRRVCVRMRSILVSEIYSKALKRKISNDKSASLKDLN 457

Query: 193 --------IHKDLEFFD------TFKVGDLMSRVGNDAFVVSR--SITHKVADGVRSXXX 236
                   I  DLE  D      +  +G +++ +  D F V+   +  H   + V     
Sbjct: 458 EQEEVDPQIENDLENIDGDEESKSSNLGSIINLMAVDTFKVADICAYLHHFVEAVVMTIV 517

Query: 237 XXXXXXLMLTLSRELTGALF-AILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQF 295
                  +L ++  +  +L  A+LP      S+ GK      KK  +VT    +   E F
Sbjct: 518 ALILLFKLLGVAAIVGASLIIALLPLNFKLASLLGKY----QKKSLEVTDKRIQKLNEAF 573

Query: 296 NGIRTVQGFVAERNEIKRFNNV----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVL 351
             IR ++ F  E N  K    V    LR I       A  +  +F + +++    F    
Sbjct: 574 QAIRIIKFFSWEDNFEKDILEVRERELRMILIRSIVWAISSFVWFVTPTIVTGASF---- 629

Query: 352 TYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGL--------SSFYSELMQGVGAASRIF 403
           TY  Y+ + G +         +   +T  ++F L        S   S ++Q   +  RI 
Sbjct: 630 TY--YVYVQGEV-------LTIPVAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLDRIQ 680

Query: 404 EINDKEPKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSN 462
           E  ++E          K++ L  +    +I FKN +  +     +   +N++     G  
Sbjct: 681 EFLEEEDT-------KKYEQLTVDKYQNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKL 733

Query: 463 VCIVGPSGRGKSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPIL 519
             I+GP+G GK+++   LL   + + G+I++   D ++   L+   L   I    Q   L
Sbjct: 734 NVIIGPTGSGKTSLLMALLGEMDLIDGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWL 793

Query: 520 MSGTIRDNITYGLTEEPSKEEIR--LVAKQCFCHNF-ITKFPDTYDXXXXXXXXXXXXXX 576
           ++ T+R+NI +     P  EE    +V       +F I    D  +              
Sbjct: 794 LNDTVRNNILFN---SPYCEERYNAVVEASGLKRDFEILNAGDMTE----IGERGITLSG 846

Query: 577 XQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRL 634
            QKQR+++ARAL      L+LD+  SA+D  +   I  N   G +M++++  +VS  H +
Sbjct: 847 GQKQRVSLARALYSNSKHLLLDDCLSAVDSHTATWIYDNCISGPLMENRTCILVS--HNI 904

Query: 635 STIRRFEDVIVLGNDGSVVEMGK 657
           +   R  D +V   +G +VE G+
Sbjct: 905 ALTLRNADYVVKLENGKIVEHGE 927

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 124/506 (24%), Positives = 228/506 (45%), Gaps = 62/506 (12%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            ++  ++H  L FFD+  +G +M+R   D   + + +T  V   V +         L+  +
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLIATVLLITYI 1195

Query: 248  SRE-LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTVQGFV 305
            +   +  AL  IL  + +   V+        K+ +  T   + +   E   G+ T++ + 
Sbjct: 1196 TNGFIVVALLVIL--LYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRAY- 1252

Query: 306  AERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH----- 360
               +EI+     L +I +  K   ++          I  +G L++   G  ++M+     
Sbjct: 1253 --GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVLMNINKID 1310

Query: 361  GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KEPKIKSTTGE 418
              ++   LT  + +TE   +A++ + S YS +   + +  R+ E  D  +EP        
Sbjct: 1311 SGLAGISLTYAITFTE---SALWLVRS-YSNVEINMNSVERVKEYMDIEQEPYSAGIVNV 1366

Query: 419  AKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477
             K  P       +IE  ++S  Y P+ P  ++ KN++F V     V +VG +G GKSTI 
Sbjct: 1367 DKSWP----SEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKSTII 1420

Query: 478  SLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
            + L    +  +G I ID  DI T++ K LR+ I I+ Q+P L +GTI+ N+      +P 
Sbjct: 1421 TALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL------DPY 1474

Query: 538  KE-----------EIRLVAKQCFCHNF-------ITKFPDTYDXXXXXXXXXXXXXXXQK 579
             E            + L+       +        + KF    +               Q+
Sbjct: 1475 NEYNDDQIFKALRRVNLIVDGNLNSDVTSVSSENVNKF---LNLQSEISEGGSNLSQGQR 1531

Query: 580  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRR 639
            Q + +AR+L++ PNI++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++  
Sbjct: 1532 QLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVID 1589

Query: 640  FEDVIVLGNDGSVVEMGKFKELYDNP 665
            ++ ++V+       + G+ KE YD+P
Sbjct: 1590 YDKILVM-------DAGEVKE-YDHP 1607

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 111/236 (47%), Gaps = 17/236 (7%)

Query: 429 GCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVS 488
           G +I  +NV+  +  +  +   +NLN     G    ++GP+G GK+++   LL   + + 
Sbjct: 695 GNKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLE 754

Query: 489 GQILIDGQD---IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVA 545
           G+I +   D     T ++  L   +    Q   L++ T+++NI +    E ++E    V 
Sbjct: 755 GKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN--AEYNEERYLAVI 812

Query: 546 KQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSA 603
             C    +F I    D  +               QKQRI++ARAL      ++LD+  SA
Sbjct: 813 SACALKRDFEILAAGDLTE----IGERGITLSGGQKQRISLARALYSSSKHILLDDCLSA 868

Query: 604 LDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLS-TIRRFEDVIVLGNDGSVVEMG 656
           +D  +   I  N   G +M++++  +VS  H ++ T++  E VI++ N G +  +G
Sbjct: 869 VDSHTAAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMIDN-GKISHIG 921

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 128/527 (24%), Positives = 229/527 (43%), Gaps = 38/527 (7%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKN-IIHKDLEFFDTFKVGDLM 209
            F +G+G  L     A   + +IL +      S+    ++ N ++   + FF+T  +G ++
Sbjct: 997  FALGIGSAL-----ATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
            +R  ND + V   +    +    +         ++   + +    +F I+P  ++   ++
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQF---IFIIIPLGVF--YIY 1106

Query: 270  GKQIRMNSKKLQDVTGDLTRVT-----EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQV 324
             +Q  + + +       +TR       +E   G+ TV+G+    ++ KRF+++  +    
Sbjct: 1107 YQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY----SQQKRFSHI-NQCRID 1161

Query: 325  GKESAF---INGKFFTSA--SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTG 379
               SAF   IN   + +    LIG +  L   T   + +  G+++ G +   + Y     
Sbjct: 1162 NNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQIT 1221

Query: 380  NAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSF 439
              +  +     E+   + +  RI E  D + +      E    P       +I F N S 
Sbjct: 1222 QTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLII-EGHRPPKQWPAQGDIRFNNYST 1280

Query: 440  FYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDI 498
             Y  RP  + + K +N  +     V IVG +G GKS++   L     A  G I+IDG  I
Sbjct: 1281 RY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSI 1338

Query: 499  ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEI-RLVAKQCFCHNFITKF 557
              +    LR K+ I+ Q+  +  GT+R+NI      + S E I R +       + ++  
Sbjct: 1339 NEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPINQYSDEAIWRALELSHLKEHVLSMS 1396

Query: 558  PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617
             D  D               Q+Q + +ARA++    IL+LDEAT+A+DVE++  +  T  
Sbjct: 1397 NDGLD--AQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIR 1454

Query: 618  QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
               K +  TI++IAHRL+TI   + +IVL N G V E     +L  N
Sbjct: 1455 TAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDTPGQLLSN 1498

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/408 (21%), Positives = 164/408 (40%), Gaps = 54/408 (13%)

Query: 271 KQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERN-----EIKRFNNVLREIFQVG 325
           K+++ +  K +D   + TRV  E  N I++++ +  E+      E  R N  L+ + ++G
Sbjct: 471 KKLQKSQMKYKD---ERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLG 527

Query: 326 KESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGL 385
              A  + +F     L+    F  V  Y     +   +    LT F L +         L
Sbjct: 528 CYMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVL 586

Query: 386 SSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSFFYPTR 444
           +SF  E    +G     F   + +P         +   +  +G   I    + +F +  +
Sbjct: 587 NSFI-EASVSIGRLFSFFTNEELQPD-----SVQRLPNVENIGDIAINIGDDATFLWQRK 640

Query: 445 PTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNT 503
           P  ++  KN++F+   G+  CIVG  G GK+ + S +L     V G   + G        
Sbjct: 641 PEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG-------- 692

Query: 504 KSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
                 I  V Q P +M+GT+++NI +G   +   E      K C     +    D    
Sbjct: 693 -----CIAYVSQVPWIMNGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMD--GD 743

Query: 564 XXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD----------VESEGAIN 613
                         QK R+++ARA+  + +  +LD+  +A+D          V     + 
Sbjct: 744 KTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLL 803

Query: 614 YTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +T  +I+ +  ++ +SIA          D I L ++G +++ G + ++
Sbjct: 804 HTKTRILATNKVSALSIA----------DSIALLDNGEIIQQGAYSDI 841

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 129/538 (23%), Positives = 234/538 (43%), Gaps = 54/538 (10%)

Query: 153  MGVGITLIFGCFANFGRVVILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
             G G+T     FA   + V+L +      S+ L S +V +I+   + FF+T  +G +++R
Sbjct: 1004 FGFGVT---SAFATLCQTVVLWVFCTIHGSKYLHSSMVSSILRAPMTFFETTPIGRILNR 1060

Query: 212  VGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTS 267
              ND +    V+ RS +    + V+           +L +       +  ++P  +    
Sbjct: 1061 FSNDVYKIDEVLGRSFSQFFVNAVKVSFT-------ILVICWNTWQFILLVIPMGVLYLY 1113

Query: 268  VFGKQIRMNS--KKLQDVTGD-LTRVTEEQFNGIRTVQGFVAERNEIK----RFNNVLRE 320
                 +R +   ++L  +T   +    +E   G+ T++G+  ++  I     R +N +  
Sbjct: 1114 YQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLATIRGYEQQKRFIHINQARVDNNMSA 1173

Query: 321  IFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH---GSMSIGDLTAFMLYTEY 377
             +     + ++       A  +  LG LI+    S  ++    G+++ G +   + Y   
Sbjct: 1174 YYPSINSNRWL-------AYRLEFLGSLIIFGAASLSILKLRDGTLTAGMIGLSLSYALQ 1226

Query: 378  TGNAIFGLSSFYSELMQGVGAASRI---FEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF 434
               ++  +     E+   + +  RI    E+  + P I      ++  P  E G   I+F
Sbjct: 1227 VTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENWP--ERGA--IKF 1282

Query: 435  KNVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILI 493
            +N S  Y  RP  + + KN++  +     V IVG +G GKS++   L     A  G I++
Sbjct: 1283 ENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIV 1340

Query: 494  DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNF 553
            DG +I+ +    LR K+ I+ Q+  +  GTIR+NI    T   + E+I    +       
Sbjct: 1341 DGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNIYTDEQIWNALELSHLKQH 1398

Query: 554  ITKF-------PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDV 606
            I +         +                  Q+Q + +ARAL+    ILILDEAT+A+DV
Sbjct: 1399 ILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAVDV 1458

Query: 607  ESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            E++  I  T     K +  TI++IAHRL+TI   + ++VL + G V E    + L  N
Sbjct: 1459 ETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGEVAEFDTPQNLLKN 1513

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 94/411 (22%), Positives = 172/411 (41%), Gaps = 54/411 (13%)

Query: 271 KQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV-----LREIFQVG 325
           KQ++    K +D   + TRV  E  N I++++ +  E+   ++  +V     L+ + ++G
Sbjct: 471 KQLQKVQMKYKD---ERTRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIG 527

Query: 326 KESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGL 385
             +A  N +F     L+    F  V  Y     +   +    LT F L T      +  L
Sbjct: 528 VFNAMTNFQFNLVPFLVSCSTF-AVFVYIEDKPLTTDLVFPALTLFNLLT----FPLAAL 582

Query: 386 SSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSFFYPTR 444
               +  ++   + SR+F     E     T    +  P+ + G   +    N +F +  +
Sbjct: 583 PIVITAFIEASVSMSRLFSFMTNEEL--QTDAIQRLPPVKKQGDIAVNIGDNATFLWKRK 640

Query: 445 PTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNT 503
           P  ++  KN+ F+   G   CIVG  G GKS     +L     V G   I G        
Sbjct: 641 PEYKVALKNIEFQAKKGELACIVGKVGSGKSAFIQSILGDLFRVKGFATIHGN------- 693

Query: 504 KSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
                 +  V Q P +M+GT++DNI +G   + ++E      + C     ++  PD    
Sbjct: 694 ------VAYVSQLPWIMNGTVKDNILFG--HKYNQEFYEKTLRACALTIDLSILPD--GD 743

Query: 564 XXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFG----- 617
                         QK R+++ARA+  + ++ +LD+  +A+D   S+  I +  G     
Sbjct: 744 QTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLL 803

Query: 618 ----QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
               +++ +  ++++SIA          D I L +DG +V+ G + E+ DN
Sbjct: 804 HTKTRVLATNKISVLSIA----------DNITLLDDGEIVQQGTYNEVTDN 844

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 130/543 (23%), Positives = 222/543 (40%), Gaps = 54/543 (9%)

Query: 151  FLMGVGITLIF-GCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLM 209
            F MG+    +F   F    +  ++  I      RL  + V+ ++H  + F DT  +G ++
Sbjct: 942  FYMGMYTFFVFFNYFVTTSQFSLICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPIGRVL 1001

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSV- 268
            +R   D   V   +T  V   V           + +     +    FAI  P +    V 
Sbjct: 1002 NRFTKDTDTVDTELTESVRLFVFQLSNIVGVIVMCI-----IYLPWFAIAVPFLMLVFVG 1056

Query: 269  FGKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQGFVAERNEIKRFNNVLREIFQV 324
                 + +S++++ +           FN    G+ T++ +  ER  + + + +  ++ + 
Sbjct: 1057 VADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTKSDFLTNKMNEA 1116

Query: 325  GKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH-GSMSIGDLTAFMLYTEYTGNAIF 383
            G     I      +  +I     LIV         H  + S+G L  ++L          
Sbjct: 1117 GYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQFHISAASVGVLLTYVL---------- 1166

Query: 384  GLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG---EAKFK------PLNEVGGCEIEF 434
             L    + L++ +       ++N  E  I   T    EA ++      P        IEF
Sbjct: 1167 QLPGLLNMLLRAMTQGEN--DMNSTERLISYATELPLEAAYRRPEMSPPAEWPTDGRIEF 1224

Query: 435  KNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILI 493
             +VS  Y P  P   + K++   V AG  + I G +G GKSTI S L        G I I
Sbjct: 1225 DHVSLAYRPGLPL--VLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSITI 1282

Query: 494  DGQDIATLNTKSLRRKIGIVQQEPILMSGTIR-----------DNITYGLTEEPSKEEIR 542
            DG DI+TL    LR K+ I+ Q+P++  G +R           D + + L    +     
Sbjct: 1283 DGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHALVRGGAIPAES 1342

Query: 543  LVAKQCFCHNFITKFPDT--YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEA 600
            L   +   H       +   +                ++Q +A+ RAL+++  ILILDEA
Sbjct: 1343 LATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRALVRQSKILILDEA 1402

Query: 601  TSALDVESEGAINYTFGQIMKSKS-MTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFK 659
            TS++D E++  I     +I+++ S  TI+ IAHRL+TI  ++ ++VL + G V E     
Sbjct: 1403 TSSVDYETDAKIQ---TRIVEAFSNCTILCIAHRLNTILDYDRILVL-DQGRVCEFDTPA 1458

Query: 660  ELY 662
             LY
Sbjct: 1459 ALY 1461

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 88/216 (40%), Gaps = 28/216 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F NLN ++  G  V + G  G GKS++   L        G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDG-------------- 648

Query: 510 IGIVQQEPILMSGTIRDNITYG--LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
             ++   P + + T+RDNI +G    E    E IR+    C     +   P         
Sbjct: 649 TMLLCGYPWIQNATVRDNILFGSPYNEARYNEIIRV----CSLQADLELLPA--GDRTEI 702

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSM 625
                     QK RI +ARA+ KK +I + D+  SA+D      I      G++  S   
Sbjct: 703 GERGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS--- 759

Query: 626 TIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           T V   H+LS I R   VI +  DGS V++G  +EL
Sbjct: 760 TRVLATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 119/508 (23%), Positives = 224/508 (44%), Gaps = 48/508 (9%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++ + ++  ++H  + FFD    G +M+R   D   + + +T  +     S         
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVI 1195

Query: 243  LMLTLSRELTGALFAILPPIIWC-TSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRT 300
            L+  ++ +      AI+  I++     F        K+ + ++   + +   E   G+ T
Sbjct: 1196 LITFITPQFLSV--AIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTT 1253

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLV-- 358
            ++ F    +E +     L++I +  K   ++       A  I  +G L++   G +++  
Sbjct: 1254 IRAF---GDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFN 1310

Query: 359  ---MHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKST 415
               +   M+   LT  + +TE        L   Y+E+   + +  R+ E  + E +  + 
Sbjct: 1311 INHLDSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERVKEYMEIEQEPYNQ 1366

Query: 416  TGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
              E    P       +IE  ++S  Y P  P  ++ KN++F V A S + IVG +G GKS
Sbjct: 1367 HKEVP--PPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKS 1422

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YG-- 531
            TI + L       +G I ID  DI+ ++ + LRR I I+ Q+P L SGTI+ N+  Y   
Sbjct: 1423 TIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEF 1482

Query: 532  --------------LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
                          ++EE S++     A                D               
Sbjct: 1483 SDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKFLDLSSEVSEGGSNLSQG 1542

Query: 578  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
            Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL ++
Sbjct: 1543 QRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRK--EFQGSTILTIAHRLRSV 1600

Query: 638  RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              ++ ++V+       + G+ KE YD+P
Sbjct: 1601 IDYDKILVM-------DAGEVKE-YDHP 1620

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 130/556 (23%), Positives = 226/556 (40%), Gaps = 90/556 (16%)

Query: 153 MGVGITLIFGCFAN---FGRVVILR----IISERLVSRLRSQVVKN-------------- 191
           M VG  L+  C A    FGR V +R    IISE     LR ++  N              
Sbjct: 400 MFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPINEDPQEIND 459

Query: 192 --IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSR 249
              I+ D E   +  +G +++ +  DAF VS     ++   + S         + L L  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVS-----EICGYLHSFLEAFVMTVVALVLLY 514

Query: 250 ELTG--------ALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTV 301
            L G         + A+LP          K I    KK   VT +  +   E F  IR +
Sbjct: 515 RLLGFAAIVGVLIIVAMLP----LNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRII 570

Query: 302 QGFVAERNEIKRFNNV---------LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLT 352
           + F  E N  K  N +         +R I  V   S+F+   +F + +++    F     
Sbjct: 571 KYFSWEENFEKDINAIRENELSLLLMRSI--VWSISSFV---WFVTPTIVTAASF----- 620

Query: 353 YGSYLVMHGSMSIG--DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-INDKE 409
              Y+ + G +       TA  L+T    + +  LS   S ++Q   +  R+ + +N+K+
Sbjct: 621 -AYYIYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKD 678

Query: 410 PKIKSTTGEAKFKPLN-EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGP 468
            K        K+  L  +  G    F+N +  +     +   K+LN +   G    ++GP
Sbjct: 679 TK--------KYDQLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGP 730

Query: 469 SGRGKSTIASLLLHHYNAVSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIR 525
           +G GK+++   LL     +SG++++   + +    ++       I    Q   L++ T++
Sbjct: 731 TGSGKTSLLMALLGEMYLLSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVK 790

Query: 526 DNITYGLTEEPSKE-EIRLVAKQC-FCHNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRI 582
           +NI +     P  E   + V + C    +F I K  D  +               QKQR+
Sbjct: 791 NNILFN---SPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGG----QKQRV 843

Query: 583 AIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRF 640
           ++ARAL      ++LD+  SA+D  +   I  N   G +M+ ++  +VS  H ++   R 
Sbjct: 844 SLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRN 901

Query: 641 EDVIVLGNDGSVVEMG 656
            +++VL  DG V + G
Sbjct: 902 AELVVLLEDGRVKDQG 917

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 129/525 (24%), Positives = 232/525 (44%), Gaps = 32/525 (6%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKD-LEFFDTFKVGDLM 209
            FL+GVG        +   + VIL +      SR    ++ + + K  + FF+T  +G ++
Sbjct: 982  FLLGVG-----SAISTLIQTVILWVYCTIHGSRYLHNIMADAVFKAPMSFFETTPIGRIL 1036

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
            +R  ND F V   +    A    +         ++   + +    +  ILP         
Sbjct: 1037 NRFSNDIFKVDELLGRTFAQFFVNAIKVSFTIIVICFSTWQF---ILVILPMGTLYIYYQ 1093

Query: 270  GKQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGK 326
               +R +   ++L  VT   +    +E   GI T++G+    N+ KRF ++ +       
Sbjct: 1094 QYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGY----NQQKRFVHINQARVDNNM 1149

Query: 327  ESAF--INGKFFTSASLIGDLGFLIVLTYGSYLVM---HGSMSIGDLTAFMLYTEYTGNA 381
             + +  +N   + +  L   +G +I+L   S  V+    G+++ G +   + Y      +
Sbjct: 1150 SAYYPSVNANRWLAFRL-EFIGSVIILAASSLSVLRLKQGALTPGMIGLSVSYALQITQS 1208

Query: 382  IFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY 441
            +  +     E+   + +  RI E  + E +  +   E+     +      I+F+N S  Y
Sbjct: 1209 LNWIVRMTVEVETNIVSVERIKEYANLESEAPAVI-ESNRPSEDWPSQGSIKFENYSARY 1267

Query: 442  PTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
              RP  ++  K++N  +     + IVG +G GKS++   L     A SG+I IDG  I +
Sbjct: 1268 --RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIEAASGRIYIDGLPIDS 1325

Query: 501  LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
            +  + LR  + I+ Q+  L  GTIR+NI    T E + E+I    +     + +      
Sbjct: 1326 IGLRDLRHHLSIIPQDSQLFEGTIRENI--DPTNEYTDEQIWRALELSHLKDHVKGLGKE 1383

Query: 561  YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
             +               Q+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     
Sbjct: 1384 -ELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDQVIQETIRTAF 1442

Query: 621  KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            K++  TI++IAHR++TI   + ++VL + G V E      L  NP
Sbjct: 1443 KNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNP 1484

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 101/237 (42%), Gaps = 38/237 (16%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           + +F +  +P  ++  KN+NF    G   C+VG  G GKS +   +L     V G   + 
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAILGDLFRVKGFASVH 680

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G              I  V Q P +M+GT++DNI +G   + S   + L  K C     +
Sbjct: 681 GS-------------IAYVSQVPWIMNGTVKDNILFGHKYDESFYTMTL--KACALIVDL 725

Query: 555 TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAIN 613
              P                   QK R+++ARA+  + +  +LD+  +A+D   ++  + 
Sbjct: 726 AVLPK--GDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVE 783

Query: 614 YTFG---------QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  G         +++ +  +T++SIA          D I L  +G +++ G + ++
Sbjct: 784 HVLGPNGLLASKTKVLATNKITVLSIA----------DHIALLENGEIIQQGSYDDV 830

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 130/503 (25%), Positives = 231/503 (45%), Gaps = 60/503 (11%)

Query: 192  IIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSREL 251
            ++H ++ FFD   VG +M+R   D   V + +   +   +           L+  ++   
Sbjct: 1083 VLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSIIFLITIITPRF 1142

Query: 252  TGALFAILPPIIW---CTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTVQGFVAE 307
                  +L    +   C    G+++    K++  +T   + +   E   G+ T++ F  E
Sbjct: 1143 LVVAVVVLVLYYFVGKCYLSAGREL----KRIDSITKSPIFQYFSETLAGVCTIRAFGDE 1198

Query: 308  RNEIKRFNNVLREIFQVGKES-AF----INGKFFTSASLIGDLGFLIVLTYGSYLVMHGS 362
                KRF  +L  + ++ + + AF    +  K+F  A  +  +G  IVL  GS+++++  
Sbjct: 1199 ----KRF--ILENMDKIDQNNRAFFYLSVAVKWF--AFRVDIIGAFIVLGSGSFILLN-- 1248

Query: 363  MSIGDLTAFMLYTEYTGNAIF-----GLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG 417
              IGD+ + +     T + +F      L   YS     + +  R+ E +  E   +    
Sbjct: 1249 --IGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGIE---QENYN 1303

Query: 418  EAKFKPLNEVGGCE---IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
            E   + L      E   IE  N+S  Y +     + KN++F V   + + IVG +G GKS
Sbjct: 1304 ENHIQALQNSLWPEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIVGRTGAGKS 1362

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YGLT 533
            TI + L      V+G I IDG DI+ ++  +LRR I I+ Q+PIL +GTI+ N+  Y   
Sbjct: 1363 TIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDPYDEY 1422

Query: 534  EE----PSKEEIRLVAKQCF------CHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIA 583
            +E        ++ L++ +          NF        +               +KQ + 
Sbjct: 1423 DERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVEGGLNLSQGEKQLLF 1482

Query: 584  IARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSM-TIVSIAHRLSTIRRFED 642
            IAR+L+++P I++LDEATS++D +S+  I    G I    S  TI++IAHRL ++  ++ 
Sbjct: 1483 IARSLLREPKIILLDEATSSIDYDSDHLIQ---GIIRNEFSRSTILTIAHRLRSVIDYDK 1539

Query: 643  VIVLGNDGSVVEMGKFKELYDNP 665
            V+V+       + G+ KE YD+P
Sbjct: 1540 VLVM-------DAGEVKE-YDHP 1554

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 98/220 (44%), Gaps = 23/220 (10%)

Query: 452 NLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD-----IATLNTKSL 506
           N+NF++  G    I+G +G GKS +   LL     +SG I++ G +     I  LN   L
Sbjct: 687 NINFRI--GKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPDLN--GL 742

Query: 507 RRKIGIVQQEPILMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXX 565
                   Q   L++GT+R+NI + G+ +E   +    V   C     +   P       
Sbjct: 743 TNSFAYCSQSAWLLNGTVRNNIIFNGVYDENRYKN---VIDACGLKRDLEILPA--GDST 797

Query: 566 XXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF---GQIMKS 622
                       QKQRI++ARA+      ++LD+  SA+D  +   I Y     G +MK+
Sbjct: 798 EIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKN 856

Query: 623 KSMTIVSIAHRLS-TIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  T + + H +S  IR+    ++L N G V   G   EL
Sbjct: 857 R--TCILVTHNISLAIRKAYFAVILEN-GKVKSQGTITEL 893

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 120/514 (23%), Positives = 223/514 (43%), Gaps = 30/514 (5%)

Query: 155  VGITLIFGCFANFGRVV---ILRIISERLVS-RLRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            +G+  +FG  A+   ++   IL I      S  L   ++  ++   + FF+T  +G +++
Sbjct: 970  LGVYFMFGLGASLSTLIQSAILWIYCSIHASVYLHESMLAAVLRAPMSFFETTPIGRILN 1029

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFG 270
            R  ND + V   +    +    +         ++   + + T   F ++P  +       
Sbjct: 1030 RFSNDIYKVDELLARTFSQFFANTTRVSFTIIVICVTTWQFT---FFVIPLAMLYIYYQQ 1086

Query: 271  KQIRMNS--KKLQDVTGDLTRVT-EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKE 327
              ++ +   ++L  VT        +E  NG+ +++G+     ++ RF ++ +        
Sbjct: 1087 YYLKTSRELRRLDSVTKSPVYAHFQETLNGVSSIRGY----GQLDRFIHINQARINNNTS 1142

Query: 328  SAF----INGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIF 383
            + +    +N         IG        T   + +  GS++ G +   + Y      ++ 
Sbjct: 1143 AYYPSMNVNRWLAYRLEFIGSCIIFFAATLSVFRLASGSLTSGMVGLSLSYALQITQSLN 1202

Query: 384  GLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPT 443
             +     E+   + +  RI E  + EP+       +         G EI+F+N S  Y  
Sbjct: 1203 WIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWPKDG-EIKFENYSTRY-- 1259

Query: 444  RP-TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502
            RP  + I + +N  +     V IVG +G GKS++A  L     A  G I IDG  I T+ 
Sbjct: 1260 RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIG 1319

Query: 503  TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF-PDTY 561
               LR+K+ I+ Q+  +  GT+RDNI    T++ + E+I    +     + +     D  
Sbjct: 1320 LTDLRKKLSIIPQDSQVFEGTVRDNI--DPTKQYTDEQIWKALELSHLADHVKGMGSDGL 1377

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMK 621
            D               Q+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T      
Sbjct: 1378 D--TPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVETDKVIQDTIRSSFN 1435

Query: 622  SKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEM 655
             +  TI++IAHR++TI   + ++VL + G+V E 
Sbjct: 1436 DR--TILTIAHRINTIMDSDKIVVL-DKGTVAEF 1466

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 96/459 (20%), Positives = 180/459 (39%), Gaps = 107/459 (23%)

Query: 254 ALFAILPPIIWC-----------TSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQ 302
           +L  +L P IW             S   + ++   K+      + TR+  E  N I++++
Sbjct: 420 SLHRLLGPCIWVGVVLLLFTLPLNSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLK 479

Query: 303 GFVAERNEIKRFNNV-----LREIFQVGKESAFINGKF---------------------- 335
            +  E    ++ + V     L+ + ++G  +AF N ++                      
Sbjct: 480 LYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVFVLTQKGR 539

Query: 336 -------FTSASLIGDLGF-LIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSS 387
                  F + +L   L F L VL       +  S++IG LT F+   E   +AI     
Sbjct: 540 PLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAIGRLTNFLTAEELQRDAI----- 594

Query: 388 FYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK-NVSFFYPTRPT 446
                               +EP +K+             GG  +    N +F +  +P 
Sbjct: 595 -------------------TREPAVKAP------------GGVAVALADNATFLWQRKPE 623

Query: 447 NQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKS 505
            ++  KN+NF+       CI+G  G GKS +   +L     V+G  ++ G          
Sbjct: 624 YKVALKNINFRAKKSELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGN--------- 674

Query: 506 LRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXX 565
               +  V Q   +M+GT+RDNI +G   +   +  +   K C     ++  PD      
Sbjct: 675 ----VAYVSQVAWIMNGTVRDNILFG--HKYDAKFYQQTIKACALTVDLSILPD--GDNT 726

Query: 566 XXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ--IMKS 622
                       QK R+++ARA+  + +  +LD+  +A+D   ++  +   FG   ++KS
Sbjct: 727 FVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKS 786

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           K+  + +  ++++ +    D IVL  +G +V+ G F E+
Sbjct: 787 KARVLTT--NKITAL-EIADHIVLLENGEIVQQGTFSEV 822

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 131/527 (24%), Positives = 232/527 (44%), Gaps = 43/527 (8%)

Query: 155  VGITLIFG---CFANFGRVVILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            +GI L  G     +   + +IL +      SR L S +  +++   + FF+T  +G +++
Sbjct: 994  LGIYLALGLSSALSTLIQTIILWVFCTIRGSRYLHSIMAASVLRAPMVFFETTPIGRILN 1053

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFG 270
            R  ND + V   +    A    +         ++   + +    +F ILP I+       
Sbjct: 1054 RFSNDIYKVDELLGRTFAQFFVNVTKVSFTIIVICVTTWQF---IFLILPMIVLYVYYQQ 1110

Query: 271  KQIRMNS--KKLQDVTGDLTRVT-EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKE 327
              +R +   ++L  VT        +E   G+ T++G+    ++  RF ++ +        
Sbjct: 1111 YYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY----DQQDRFTHINQSRID-NNM 1165

Query: 328  SAF---INGKFFTSASLIGDLGFLIVLTYGSYLVMH---GSMSIGDLTAFMLYTEYTGNA 381
            SAF   +N   + +  L   +G +I+    S  ++    GS++ G +   + Y      +
Sbjct: 1166 SAFYPSVNANRWLAFRL-EFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLSYALQITQS 1224

Query: 382  IFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG---EAKFKPLNEVGGCEIEFKNVS 438
            +  +     E+   + +  RI E ++    IKS      E    P +     +I+F++ S
Sbjct: 1225 LNWIVRMTVEVETNIVSVERIKEYSE----IKSEAPLVIEDHRPPADWPSKGDIKFEHYS 1280

Query: 439  FFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDI 498
              Y     N + K++N  V     + IVG +G GKS++   L     A  G+I+IDG  I
Sbjct: 1281 TRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPI 1339

Query: 499  ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFP 558
              +    LR K+ I+ Q+  +  GT+R+NI    T + S EEI  V +     N +    
Sbjct: 1340 NEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIWRVLELSHLKNHVLSMS 1397

Query: 559  DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 618
                               Q+Q + +ARAL+    ILILDEAT+A+DVE++  I  T   
Sbjct: 1398 KD-GLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRT 1456

Query: 619  IMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              K +  TI++IAHRL+TI   + ++VL       + G+ +E +D P
Sbjct: 1457 AFKDR--TILTIAHRLNTIMDSDRILVL-------DAGEVRE-FDTP 1493

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 103/237 (43%), Gaps = 38/237 (16%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           + +F +  +P  Q+  KN+N +V  G   C+VG  G GKS +   LL     V G   + 
Sbjct: 636 DANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGDLYRVKGYAAVH 695

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G                 V Q P +M+GT++DNI +G   +P   +  L  K C     +
Sbjct: 696 GS-------------TAYVSQVPWIMNGTVKDNILFGHKYDPVFYD--LTIKACALTIDL 740

Query: 555 TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAIN 613
              PD                  QK R+++ARA   + +  +LD+  +A+D   ++  I 
Sbjct: 741 GILPD--GDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEHVAQHLIE 798

Query: 614 YTFGQ--IMKSKS-------MTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  G   ++KSK+       +T++SIA  +S +            G +++ G ++++
Sbjct: 799 HVLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQHGSYEDI 845

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 135/574 (23%), Positives = 251/574 (43%), Gaps = 73/574 (12%)

Query: 122  GTILDTLRNNYENLTSLSQIKILNIPLSTFLMG--VGITLIFGCFANFGRVVILRIISER 179
              +   L N++ N   LS   I+   +S+FL    V + ++FG   N  + +  +++S  
Sbjct: 1026 AMLYSMLENSHSNAYFLSTYTIIGF-ISSFLTAGKVWVAVLFG--TNATKKIFAKLLSSI 1082

Query: 180  LVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXX 239
             +++LR             F D   VG +M+R   D  ++ + +         S      
Sbjct: 1083 FLAKLR-------------FHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLW 1129

Query: 240  XXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDV----TGDLTRVTEEQF 295
               L+  ++      LFAI  P+     + G      S++L+ +       + ++  E  
Sbjct: 1130 VIFLIGYITPRFL--LFAI--PLCALYYIVGSLYLRASRELKRIDNINVSPIHQLFTEAI 1185

Query: 296  NGIRTVQGFVAERNEIKRFNNVLREIFQVGKESA---FINGKFFTSASLIGDLGFLIVLT 352
             G+ T++    ER    RF  + + +  + K +A   ++N         +  +G LI+ +
Sbjct: 1186 KGVATIRALADER----RF--ITQTLVAIDKSNAPFFYLNLATEWITYRVDIIGALILFS 1239

Query: 353  YGSYLVMHGSMSIGDLTAFML-----YTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND 407
                +V+        L   +L     +TE T   I  + S    LM  V    RI E  D
Sbjct: 1240 SSLMIVLKAPYLDAGLAGILLSNAFSFTE-TAQWIIKVFSGVELLMSSV---ERIKEYVD 1295

Query: 408  KEPKIKSTTGEAKFKPL-NEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466
                ++S+       PL N     +IEF+N++  Y    +++    ++FKV AG+ V IV
Sbjct: 1296 --VPLESSESNNYATPLANWPQTGDIEFENLTLRYSPH-SSKALDGVSFKVKAGTKVGIV 1352

Query: 467  GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
            G +G GKS+I + +    +   G I+ID +DI  +  + LR  I  + Q P L  GTIR 
Sbjct: 1353 GRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRS 1412

Query: 527  NI----TYGLTEE-PSKEEIRLVAKQ---CFCHNFITKFPDTY-------DXXXXXXXXX 571
            N+     Y   +   + E++ L+ +    C        +P  +       D         
Sbjct: 1413 NLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQKLSYPSNHKLRNRFIDLNTVVKSGG 1472

Query: 572  XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIA 631
                  Q+Q + +AR+++   NI+++DEAT+++D  S+  I  T  + M++   T+++IA
Sbjct: 1473 SNISQGQRQLLCLARSMLGARNIMLIDEATASIDYVSDAKIQKTIRETMRNT--TVLTIA 1530

Query: 632  HRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            HRL ++  ++ ++V+       +MG+ +E YD+P
Sbjct: 1531 HRLRSVIDYDKILVM-------DMGRVEE-YDHP 1556

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 101/425 (23%), Positives = 186/425 (43%), Gaps = 44/425 (10%)

Query: 255 LFAILPPIIWCTSVFGK----QIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNE 310
           L A++P   WC   +GK    Q+ +  ++   ++        E  N IR ++    E+  
Sbjct: 501 LIAMIPLNFWCAIFYGKYQADQLILTDRRTSGIS--------EALNSIRVIKLLAWEKLF 552

Query: 311 IKRFNNVLR--EIFQVGKESA--FINGK-FFTSASLIGDLGFLIVLTYGSYLVMHGSMSI 365
            +R   V R  EI  + K++   F+N   +F   +L+  + F + + +     +  S++ 
Sbjct: 553 YRRIM-VTRNGEISLLKKKATIFFLNHLIWFFGPTLVSVVTFAVFVKFQKQ-TLTPSIAF 610

Query: 366 GDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-INDKEPKIKSTTGEAKFKPL 424
             L+ F +        +  ++S  + LMQ   +  RI + +N+ E +      ++K K  
Sbjct: 611 TALSLFAILR----TPMDQIASTINLLMQSFISLERIQDYLNEPETRKYEILTQSKTK-- 664

Query: 425 NEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHY 484
                  + F+N +  +    T+   KN++      +   I+GP+G GKS++   LL   
Sbjct: 665 -------LGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGEL 717

Query: 485 NAVSGQI---LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEI 541
           N  SG+I    +  +D   +    +   +    Q P L+SGTI+DNI +G  E  ++++ 
Sbjct: 718 NLRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKF 775

Query: 542 RLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEAT 601
             V K C     I     T                 Q+QRIA+ARA+      L+ D+  
Sbjct: 776 DDVIKCCCLEKDIKAM--TAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCL 833

Query: 602 SALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFK 659
           SA+D E+   I      G +MK ++  + S  H +S I +    +V+ ++G V   GK  
Sbjct: 834 SAVDPETALHIYEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQGKPS 891

Query: 660 ELYDN 664
           +L ++
Sbjct: 892 DLIES 896

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 125/529 (23%), Positives = 232/529 (43%), Gaps = 42/529 (7%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKN-IIHKDLEFFDTFKVGDLM 209
            F +G+G  L     A   + ++L +      S+    ++ N ++   + FF+T  +G ++
Sbjct: 997  FALGIGSAL-----ATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
            +R  ND + V   +    +    +         ++   + +    +F I+P  ++   ++
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICVTTWQF---IFIIVPLGVF--YIY 1106

Query: 270  GKQIRMNSKKLQDVTGDLTRVT-----EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQV 324
             +Q  + + +       +TR       +E   G+ TV+G+    ++ KRF+++  +    
Sbjct: 1107 YQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY----SQQKRFSHI-NQCRID 1161

Query: 325  GKESAF---INGKFFTSA--SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTG 379
               SAF   +N   + +    LIG +  L   T   + +  G+++ G +   + Y     
Sbjct: 1162 NNMSAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMVGLSLSYALQIT 1221

Query: 380  NAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG---EAKFKPLNEVGGCEIEFKN 436
              +  +     E+   + +  RI E  D    IKS      E    P    G  +I+F  
Sbjct: 1222 QTLNWIVRMTVEVETNIVSVERIKEYAD----IKSEAPLVIEGHRPPKEWPGQGDIKFNQ 1277

Query: 437  VSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG 495
             S  Y  RP  + + K ++  +     + IVG +G GKS++   L     A +G I+IDG
Sbjct: 1278 YSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDG 1335

Query: 496  QDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFIT 555
              I  +    LR K+ I+ Q+  +  GT+R+NI   + +   +   R +       + ++
Sbjct: 1336 IPINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAMWRALELSHLKEHILS 1394

Query: 556  KFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 615
               D  D               Q+Q + +ARA++ +  IL+LDEAT+A+DVE++  I  T
Sbjct: 1395 MSNDGLD--SQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQET 1452

Query: 616  FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
                 K +  TI++IAHRL+TI   + +IVL N G V E     +L  N
Sbjct: 1453 IRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTN 1498

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 99/237 (41%), Gaps = 38/237 (16%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           + +F +  +P  ++  KN+NF+   G   C+VG  G GK+ + S  L     V G   + 
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSSTLGDLFRVKGFASVH 691

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G              +  V Q P +M+GT+++NI +G   +   E      K C     +
Sbjct: 692 G-------------SVAYVSQVPWIMNGTVKENILFG--HKYDAEFYEKTIKACALTIDL 736

Query: 555 TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALD--------- 605
               D                  QK R+++ARA+  + +  +LD+  +A+D         
Sbjct: 737 AILMD--GDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVE 794

Query: 606 -VESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            V     + +T  +++ +  ++ +S+A          D I L ++G +++ G + ++
Sbjct: 795 HVLGSNGLLHTKTKLLATNKVSALSVA----------DSIALLDNGEIIQQGTYDDI 841

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 138/550 (25%), Positives = 240/550 (43%), Gaps = 82/550 (14%)

Query: 150 TFLMGVGITLIFGCFA----NFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKV 205
           +F MG+    +FG +      F  +  L + + +    L  + VK I+H  L F DT  +
Sbjct: 447 SFYMGLYSFFVFGQYMFMNIQFTVLCFLGVTASKF---LNLKAVKGILHTPLSFMDTTPL 503

Query: 206 GDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGAL---------F 256
           G +++R   D    + S+ +++ + +R          LM+     + G +         F
Sbjct: 504 GRILNRFTKD----TDSMDNELTEDIR----------LMMFQLGNIIGVIVMCIVYLPWF 549

Query: 257 AILPPIIWCTSVF--------GKQI-RMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           AI  P +    V         G+++ R+ + +   V  +L  V      G+ T++ + ++
Sbjct: 550 AIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEV----LGGLDTIRAYRSQ 605

Query: 308 RNEIKRFNNVLREIFQVGK--ESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSI 365
                RF  +++  F + K  E+ ++        ++  D+  +I     + L +     I
Sbjct: 606 ----DRF--LVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFALIITLLCVTRQFKI 659

Query: 366 GDLTAFMLYTEYTGNAIFGLSSFYSELMQ---GVGAASRIFEINDKEPKIKSTTGEAKFK 422
              +  +L T Y       L++    L Q   G+ +A R+       P+           
Sbjct: 660 SPSSTGVLLT-YVLQLPGLLNTVLRALTQAENGMNSAERLVTYALDLPQEAEYRRPEMSP 718

Query: 423 PLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL 481
           P N     EI+F+ VSF Y P+ P   + KN +  + +G  + I G +G GKSTI S L 
Sbjct: 719 PENWPDRGEIKFEGVSFAYRPSLPP--VLKNFSLNIGSGEKIGICGRTGAGKSTIMSALY 776

Query: 482 HHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YGLTEEPSKEE 540
                + G+I ID  +IA L    LR K+ I+ Q+P+L  GTI+ N+  +G   E + +E
Sbjct: 777 RINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFG---EKTDQE 833

Query: 541 I--RLVAKQCFCHNFI----TKFPDT---------YDXXXXXXXXXXXXXXXQKQRIAIA 585
           +   LV         I     + PD          +                +KQ +A+ 
Sbjct: 834 LWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKFHLEQKVEEEGGNFSLGEKQLLALT 893

Query: 586 RALIKKPNILILDEATSALDVESEGAINYTFGQIMKS-KSMTIVSIAHRLSTIRRFEDVI 644
           RAL++   ILILDEATS++D E++  I     +I+++    TI+ IAHRL+TI  ++ ++
Sbjct: 894 RALVRNSRILILDEATSSVDYETDDKIQ---SRIVEAFGDCTILCIAHRLNTILNYDRIL 950

Query: 645 VLGNDGSVVE 654
           VL   G V E
Sbjct: 951 VL-EQGEVAE 959

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 97/213 (45%), Gaps = 22/213 (10%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F+NLNF +  G  + + GP G GK+++ S +        G + ++G+ ++          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLSC--------- 156

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
                  P + + T+RDNI +G   E +K   R V K C   + +   P           
Sbjct: 157 -----GYPWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILP--AGDMTEIGE 207

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIV 628
                   QK RI +AR + K  +I + D+  SA+D    +  ++     ++  K+  + 
Sbjct: 208 RGINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKTRILA 267

Query: 629 SIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  H+L+ I +   +IVLGNDGS   +G ++EL
Sbjct: 268 T--HQLALIEKATRLIVLGNDGSFT-IGTYEEL 297

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 125/526 (23%), Positives = 230/526 (43%), Gaps = 34/526 (6%)

Query: 155  VGITLIFGCFANFG---RVVILRIISERLVSR-LRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            + + L FG F+      + V+L +      S+ L + +  ++    + FF+T  +G +++
Sbjct: 999  LAVYLAFGIFSALSTLIQTVVLWVYCTIHGSKYLHAGMANSVFRAPMRFFETTPIGRILN 1058

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFG 270
            R  ND F V   +    +  V +         ++   + + T  LF I P  I       
Sbjct: 1059 RFSNDIFKVDELLGRTFSQFVNNVIKVSFTIIVICFTTWQFT--LFVI-PLGILYVYYQQ 1115

Query: 271  KQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIK----RFNNVLREIFQ 323
              +R +   ++L   T   +    +E   G+ T++G+  +R  I     R +N +   + 
Sbjct: 1116 YYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIRGYNQQRRFIHINQSRMDNNMSAYYP 1175

Query: 324  VGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMH---GSMSIGDLTAFMLYTEYTGN 380
                + ++       A  +  +G +I+    S  ++    GS++ G +   + Y      
Sbjct: 1176 SVNANRWL-------AYRLEFIGTIIIFGASSLSILRLKSGSLTPGMIGLSLSYALQITQ 1228

Query: 381  AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
            ++  +     E+   + +  RI E ++   +      + +  P     G  I+F++ S  
Sbjct: 1229 SLNWIVRMTVEVETNIVSVERIKEYSEIPSEAPYLIEDRRPSPNWPTDGA-IQFQHYSTR 1287

Query: 441  YPTRP-TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIA 499
            Y  RP  + I K++N  +     + IVG +G GKS++   L     A  G+I+IDG  I 
Sbjct: 1288 Y--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPID 1345

Query: 500  TLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
             +    LR K+ I+ Q+  +  G++R+NI    TE+ S EEI  V       N +    +
Sbjct: 1346 QMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRVLDLSHLKNHVLNMGN 1403

Query: 560  TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQI 619
                              Q+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T    
Sbjct: 1404 D-GLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTA 1462

Query: 620  MKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
               +  TI++IAHRL+TI   + ++VL + G V E    + L  NP
Sbjct: 1463 FADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNP 1505

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 92/412 (22%), Positives = 167/412 (40%), Gaps = 93/412 (22%)

Query: 288 TRVTEEQFNGIRTVQGFVAERNEIKRFNNV-----LREIFQVGKESAFINGKF------- 335
           TR+  E  N +++++ +  E+   ++   V     L+ + ++G  +A IN +F       
Sbjct: 488 TRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFV 547

Query: 336 ---------------------FTSASLIGDLGF---LIVLTYGSYLVMHGSMSIGDLTAF 371
                                F + +L G L F   ++ L   SY+    S+SIG L +F
Sbjct: 548 SCSTFAVFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSYI--EASVSIGRLYSF 605

Query: 372 MLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCE 431
           +   E   +++                         + P++K+  G+   K    +G   
Sbjct: 606 LTNEELQRDSV------------------------QRLPRVKNI-GDVAMK----LG--- 633

Query: 432 IEFKNVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
               N +F +  +P  ++  KN+NF+   G   C+VG  G GKS +   LL     V G 
Sbjct: 634 ---DNATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLLGDLFRVKGF 690

Query: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
             + G              I  V Q   +M+GT++DNI +G   +P   E  +  K C  
Sbjct: 691 ATVHGN-------------IAYVSQVAWIMNGTVKDNILFGHKYDPEFYEKTI--KACAL 735

Query: 551 HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SE 609
              +   PD                  QK R+++ARA+  + +I +LD+  +A+D   S 
Sbjct: 736 TIDLAILPD--GDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVST 793

Query: 610 GAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             I++  G     K+ T +   +++S +   + V +L N G +++ G F E+
Sbjct: 794 HLIDHVLGPNGLLKTKTKILATNKISALSIADSVTLLEN-GEIIQQGTFCEI 844

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 113/485 (23%), Positives = 211/485 (43%), Gaps = 32/485 (6%)

Query: 182  SRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXX 241
            +RL   + K ++   + FF+T  VG +++R  ND + V   +    +             
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 242  XLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNS----KKLQDVTGDLTRVT-EEQFN 296
             ++ +++ +    +F ILP  +    +F +Q  + +    ++L  VT        +E   
Sbjct: 1075 IVICSITWQF---IFFILPLSV--LYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLT 1129

Query: 297  GIRTVQGFVAERNEIK----RFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLT 352
            G+ TV+ F  +   I     R N  +   +     + ++  +       +G +  L    
Sbjct: 1130 GVTTVRSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAFRL----EFMGSIVILAAAV 1185

Query: 353  YGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKI 412
               + +  G ++ G L   + Y      ++  +     E+   + +  RI E  D +P+ 
Sbjct: 1186 LSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEA 1245

Query: 413  KSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGR 471
                  ++  P N     +I+F++ S  Y  RP  + I +++N  +     V IVG +G 
Sbjct: 1246 PMIIPTSR-PPKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGA 1302

Query: 472  GKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNI--T 529
            GKS++   L     A +G+ILID   I ++    LR  + I+ Q+  +  GT R+NI   
Sbjct: 1303 GKSSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPC 1362

Query: 530  YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
               T++     + L   +       T+  +T                 Q+Q + +ARAL+
Sbjct: 1363 NKFTDDEIWNALELAHLKQHVMTLGTEGLNT-----SLKEGGSNLSVGQRQLMCLARALL 1417

Query: 590  KKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGND 649
                IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI   + ++VL + 
Sbjct: 1418 VPSKILVLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DK 1474

Query: 650  GSVVE 654
            G + E
Sbjct: 1475 GRIAE 1479

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 100/442 (22%), Positives = 185/442 (41%), Gaps = 67/442 (15%)

Query: 254 ALFAILPPIIWC-TSVFGKQIRMNS------KKLQDVT----GDLTRVTEEQFNGIRTVQ 302
           +L+ +L P +W    +    I +NS      KKLQ V        TR+  E  N I++++
Sbjct: 426 SLYKLLGPCMWAGVFIMVITIPLNSLIMGIQKKLQGVQMKNKDKRTRIISEILNNIKSLK 485

Query: 303 GFVAERNEIKRFNNV-----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357
            +  E+    + + V     L+ + ++G  +     +F     ++         T+G+++
Sbjct: 486 LYAWEQPYKAKLDYVRNEKELKNLVKIGITNTISVFQFSVVPFMVS------CATFGTFV 539

Query: 358 VMHGSMSIG-DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKS-- 414
           +     ++  DL        +   A+F L SF    +    AA+   E +    ++ S  
Sbjct: 540 LTQKDKALSTDLI-------FPALALFNLLSFPLGFIPM--AATSFIEASVSIKRLHSFL 590

Query: 415 TTGEAK------FKPLNEVGGCEIEFK-NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIV 466
           T+GE +         + E+G   +    + ++ +  +P  ++  KN+NF+   G   CIV
Sbjct: 591 TSGEIQRDAIQHLPKVEEIGDISVNISGDATYLWQRQPEYKVALKNINFQARKGELSCIV 650

Query: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
           G  G GKS +   +L     V G   + G              +  V Q   +M+GTI+D
Sbjct: 651 GKVGTGKSALIQAMLGDLFRVKGSATLHGS-------------VAYVSQVSWIMNGTIKD 697

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
           NI +G   +    E  +  K C     +   PD                  QK R+A+AR
Sbjct: 698 NILFGYKYDAEFYEKTI--KACALSLDLNTLPD--GDQTFVGERGISLSGGQKARLALAR 753

Query: 587 ALIKKPNILILDEATSALDVE-SEGAINYTFGQ--IMKSKSMTIVS-IAHRLSTIRRFED 642
           A+  K ++  LD+  +A+D   S+  + Y  G   ++K+K+  + +   H LS      D
Sbjct: 754 AVYAKADVYFLDDPLAAVDEHVSKHLVKYVIGPTGLLKTKTRILTTNKIHVLSV----AD 809

Query: 643 VIVLGNDGSVVEMGKFKELYDN 664
            I L ++G +V+ G + ++  N
Sbjct: 810 SITLLDNGVIVQQGSYDQVNSN 831

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 133/551 (24%), Positives = 244/551 (44%), Gaps = 81/551 (14%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            FL+G+  +L+        + V+  ++  R   ++   ++   +H  L FFD   +G +M+
Sbjct: 1113 FLIGLTQSLLAA-----SKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMN 1167

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRE------LTGALFAILPPIIW 264
            R   D   V + +T  +               L+  ++ +      L G L+ ++     
Sbjct: 1168 RFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYM 1227

Query: 265  CTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQV 324
              S   K+    SK        + +   E   G+ T++ +  E     RF  +L  + ++
Sbjct: 1228 AASRELKRFESISK------SPIYQHFSETLVGVATIRAYGDE----SRF--MLENLHKI 1275

Query: 325  GKESAFINGKFFTSASL-------IGDLGFLIVLTYGSYLV-----MHGSMSIGDLTAFM 372
             +     N  FF            I  +G  ++   G +++     +   M+   LT  +
Sbjct: 1276 DEN----NKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAI 1331

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIND--KEP--KIKSTTGEAKFKPLNEVG 428
             +TE        L  FY+++   + +  R+ E  +  +EP  + K T    ++ P N   
Sbjct: 1332 SFTE----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEW-PSNG-- 1384

Query: 429  GCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487
              +IE K++S  Y P  P  ++ KN++F V   + + IVG +G GKSTI + +    N  
Sbjct: 1385 --KIEVKDLSLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPE 1440

Query: 488  SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YG-LTEEP--------- 536
            SG I ID  +IA++N   LRR I I+ Q+P L +GTI+ N+  Y   T++          
Sbjct: 1441 SGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVN 1500

Query: 537  --SKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNI 594
              ++EE++    Q        KF    +               Q+Q + +AR+L++ P I
Sbjct: 1501 LVTEEELQNNGTQTGTSENANKF---LNLENEITEGGSNLSHGQRQLVCLARSLLRNPKI 1557

Query: 595  LILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            ++LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++  ++ +IV+       +
Sbjct: 1558 ILLDEATASIDYASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-------D 1608

Query: 655  MGKFKELYDNP 665
             G+ KE YD+P
Sbjct: 1609 AGEVKE-YDHP 1618

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 114/259 (44%), Gaps = 23/259 (8%)

Query: 411 KIKSTTGEAKFKPLNEVG----GCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466
           +I+   GE      N++     G  I FKNV+  +     +   ++LN +   G+   ++
Sbjct: 686 RIQDFLGEQDTDKYNQLTIDKLGNRIAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVI 745

Query: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDG----QDIATLNTKSLRRKIGIVQQEPILMSG 522
           GP+G GK+++   LL       G+I++      QD+  ++   L   I    Q   L++ 
Sbjct: 746 GPTGSGKTSLLLALLGEMCLEKGEIIVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNE 804

Query: 523 TIRDNITYGLTEEPSKEE-IRLVAKQCFCHN--FITKFPDTYDXXXXXXXXXXXXXXXQK 579
           T+R+NI +     P  EE    V   C       I K  D  +               QK
Sbjct: 805 TVRNNILFN---SPYNEERYNAVIDACGLRRDLKILKASDMTE----IGEKGITLSGGQK 857

Query: 580 QRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTI 637
           QR+++ARAL      ++LD+  SA+D  +   I  N   G +M  ++  +VS  H ++  
Sbjct: 858 QRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLMSGRTCILVS--HNIALT 915

Query: 638 RRFEDVIVLGNDGSVVEMG 656
            +  +++V+  +G V + G
Sbjct: 916 LKNAELVVILENGRVKDQG 934

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 127/250 (50%), Gaps = 27/250 (10%)

Query: 431  EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
            +I+FK+ +F Y       I KN N  V +G  + I G +G GKSTI + L        G 
Sbjct: 801  KIQFKDANFRYK-EGLPLILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDELTDGA 859

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT-YGLTEEPSKEEIRLVA---- 545
            I ID  DI+TL    LR+ + I+ Q+PIL  GTIR N+  +   ++ +  E  +++    
Sbjct: 860  IYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILSGFID 919

Query: 546  KQCFCH--------NFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
            +  F H          +TKF  T                 +KQ +A  RA+I    +++L
Sbjct: 920  RDTFGHFSEKPVNNKELTKFHLT----AHVEEDGTNYSLGEKQLLAFTRAIIHHSKVVVL 975

Query: 598  DEATSALDVESEGAINYTFGQIMKSKSM---TIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            DEA+S++D E++  I     Q + SK     TI+ IAHRL+TI +++ ++VL + G+++ 
Sbjct: 976  DEASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRLNTILKYDRILVL-DHGNIIG 1029

Query: 655  MGKFKELYDN 664
                + L++N
Sbjct: 1030 FENPRVLFEN 1039

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 98/216 (45%), Gaps = 28/216 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F NLNF +  G  + I GP G GK+++   +      + G I IDG            + 
Sbjct: 205 FNNLNFSI-XGEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDGN----------LQL 253

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEE--IRLVAKQCFCHNFITKFPDTYDXXXXX 567
            G     P + + T+RDNI +G   E  K +  IR+ A      NF  K           
Sbjct: 254 CGY----PWVQNTTVRDNIIFGSKYEKEKFDHVIRICALTEDLENFSGK------DLTEI 303

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSM 625
                     QK RI +ARA+ K  +I + D+  SA+D      I  N   G  +  K+ 
Sbjct: 304 GELGITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGA-LSGKTX 362

Query: 626 TIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            I++  H+LS I++ + ++VLGND S  E+G +KEL
Sbjct: 363 XILA-THQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 121/516 (23%), Positives = 225/516 (43%), Gaps = 36/516 (6%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKN-IIHKDLEFFDTFKVGDLM 209
            F +G+G  L     A   + ++L +      S+    ++ N ++   + FF+T  +G ++
Sbjct: 996  FALGIGSAL-----ATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1050

Query: 210  SRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVF 269
            +R  ND + V   +    +    +         ++   + +    +F I+P  ++   ++
Sbjct: 1051 NRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQF---IFIIIPLSVF--YIY 1105

Query: 270  GKQIRMNSKKLQDVTGDLTRVT-----EEQFNGIRTVQGFVAERNEIKRFNNVLREIFQV 324
             +Q  + + +       +TR       +E   G+ TV+G+  +    KRF+++  +    
Sbjct: 1106 YQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQ----KRFSHI-NQCRID 1160

Query: 325  GKESAF---INGKFFTSA--SLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTG 379
               SAF   IN   + +    LIG +  L   T   + +  G+++ G +   + Y     
Sbjct: 1161 NNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQIT 1220

Query: 380  NAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSF 439
              +  +     E+   + +  RI E  D + +      E    P       +I+F N S 
Sbjct: 1221 QTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIV-EGHRPPKEWPSQGDIKFNNYST 1279

Query: 440  FYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDI 498
             Y  RP  + + K++N  +     V IVG +G GKS++   L     A  G I+ID   I
Sbjct: 1280 RY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAI 1337

Query: 499  ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFP 558
              +    LR K+ I+ Q+  +  GT+R+NI   + +   +   R +       + ++   
Sbjct: 1338 NEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAIWRALELSHLKEHVLSMSN 1396

Query: 559  DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 618
            D  D               Q+Q + +ARA++    IL+LDEAT+A+DVE++  +  T   
Sbjct: 1397 DGLD--AQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRT 1454

Query: 619  IMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
              K +  TI++IAHRL+TI   + +IVL N G V E
Sbjct: 1455 AFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAE 1487

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 160/399 (40%), Gaps = 36/399 (9%)

Query: 271 KQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERN-----EIKRFNNVLREIFQVG 325
           K+++ +  K +D   + TRV  E  N I++++ +  E+      E  R N  L+ + ++G
Sbjct: 470 KKLQKSQMKYKD---ERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLG 526

Query: 326 KESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGL 385
              A  + +F     L+    F  V  Y     +   +    LT F L +         L
Sbjct: 527 CYMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVL 585

Query: 386 SSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSFFYPTR 444
           +SF  E    +G     F   + +P         +   +  +G   I    + +F +  +
Sbjct: 586 NSFI-EASVSIGRLFTFFTNEELQPD-----SVQRLPKVKNIGDVAINIGDDATFLWQRK 639

Query: 445 PTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNT 503
           P  ++  KN+NF+   G+  CIVG  G GK+ + S +L     V G   + G        
Sbjct: 640 PEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG-------- 691

Query: 504 KSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
                 +  V Q P +M+GT+++NI +G       E      K C     +    D    
Sbjct: 692 -----SVAYVSQVPWIMNGTVKENILFG--HRYDAEFYEKTIKACALTIDLAILMD--GD 742

Query: 564 XXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKS 622
                         QK R+++ARA+  + +  +LD+  +A+D   +   I +  G     
Sbjct: 743 KTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLL 802

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            + T V   +++S +    D I L ++G + + G + E+
Sbjct: 803 HTKTKVLATNKVSAL-SIADSIALLDNGEITQQGTYDEI 840

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 119/257 (46%), Gaps = 39/257 (15%)

Query: 431  EIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489
            EI F++VSF Y P  P   + K ++  + +   + I G +G GKSTI S L        G
Sbjct: 1203 EIVFEDVSFAYRPGLPV--VLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDG 1260

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP------------- 536
            +I ID  DI  +    LR+K+ I+ Q+P+L  GTIR N+     E P             
Sbjct: 1261 KIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD-PFQEHPDELLWKSLVSGGA 1319

Query: 537  -SKEEIRLVAKQCFCHNFITKFPDT---------YDXXXXXXXXXXXXXXXQKQRIAIAR 586
             S EE+ +V  Q          PD+         +                ++Q +A+ R
Sbjct: 1320 ISAEEVEVVKGQK---------PDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTR 1370

Query: 587  ALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVL 646
            AL+++  ILILDEATS++D E++  I             TI+ IAHRL TI  ++ ++VL
Sbjct: 1371 ALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILVL 1428

Query: 647  GNDGSVVEMGKFKELYD 663
               G + E    + LY+
Sbjct: 1429 -EQGEIEEFDTPRSLYE 1444

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 94/214 (43%), Gaps = 24/214 (11%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FKNLN  +  G  V I GP G GKS++ S +       SG + +DG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXX 569
             ++   P + + T+RDNI +G   +  KE    V + C     I   P           
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPG--GELTEIGE 697

Query: 570 XXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMTI 627
                   QK RI +AR++ K  +I + D+  SA+D      I      G++   K  T 
Sbjct: 698 RGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTR 754

Query: 628 VSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +   H+LS I +   VIVLG DGS  E GK ++L
Sbjct: 755 ILATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 131/530 (24%), Positives = 224/530 (42%), Gaps = 43/530 (8%)

Query: 155  VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGN 214
            V I+L     +N   +V+L + S +   +L   +   +I   + FF+T  VG +++R  +
Sbjct: 1012 VFISLSAALLSNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFETTPVGRIINRFSS 1071

Query: 215  DAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALF----AILPPIIWCTSVFG 270
            D   +  S+ +     V S         L++ +       LF    A+L  I +   V+ 
Sbjct: 1072 DMNSLDDSVQY-----VMSFFLVSILDYLVVVIIIGYQVPLFLIVNAVLLVIYFYYQVYY 1126

Query: 271  KQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFN--NVLREIFQVGKE 327
              +    K+L   +   +  +  E   G   +  F        RF+  NV    F +   
Sbjct: 1127 VTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAF----RHSDRFDYLNVENVQFNINCL 1182

Query: 328  SAFINGKFFTSASLIGDLGFLIVLTYG--SYLVMHG--SMSIGDLTAFMLYTEYTGNAIF 383
              F +   + S  L   +G L++LT    S    +G  ++S G +   M Y     N + 
Sbjct: 1183 FNFRSTNRWLSIRL-ESIGALMILTTALLSLATKNGGHALSTGMVGLLMSYALQVTNKLM 1241

Query: 384  GLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPT 443
             +     +L   + +  RI E  D  P+      +++  P N      I FKN S  Y  
Sbjct: 1242 WIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSR-PPKNWPSQGLIRFKNYSTRYRA 1300

Query: 444  RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNT 503
               + + ++L+ ++     + IVG +G GKST++  L        G I IDG DI+ +  
Sbjct: 1301 N-LDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGL 1359

Query: 504  KSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFP-DTYD 562
            K LR  + I+ Q+     GT+R N+     E+ S EEI    +       I K   D  D
Sbjct: 1360 KDLRSNLSIIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHLKPHILKMAKDDAD 1417

Query: 563  XXXXXXXXXXXXXXX-------QKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 615
                                  Q+Q + ++RAL+ +  IL+LDEAT+A+D E++  I  T
Sbjct: 1418 PEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQET 1477

Query: 616  FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
                 K +  TI++IAHR+ T+   + ++VL       + G+ KE +D+P
Sbjct: 1478 IRAEFKDR--TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDSP 1517

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 96/218 (44%), Gaps = 19/218 (8%)

Query: 450 FKNLN-FKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRR 508
            KN++ F+V  G  VC+VG  G GKST    LL     +S     +    A+        
Sbjct: 643 LKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALLGQLPCIS-----NSPSHASPTVHFRAN 697

Query: 509 KIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
            + +  Q+  +M+ +++DN+ +G   + +  +  L A Q      I    D         
Sbjct: 698 SVALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPDLEILADGDE----TLVG 753

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKS---- 624
                    QK R+++ARA+  + ++ +LD+  SA+D E    I     Q++  K+    
Sbjct: 754 EKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRI---IEQVLSKKTGLLK 810

Query: 625 -MTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             T++   + +S ++  + +  L  DG +VE G F ++
Sbjct: 811 NKTVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDI 847

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 125/544 (22%), Positives = 226/544 (41%), Gaps = 67/544 (12%)

Query: 155  VGITLIFG----CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            VGI  + G     F N   +++L   + R   +L   +   I++  ++FF+T  +G +++
Sbjct: 1007 VGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRILN 1066

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFG 270
            R   D             D V S              S  +T  L  I  P+     +F 
Sbjct: 1067 RFSADI------------DTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFL 1114

Query: 271  KQIRMNSKKLQDVTG-DLTRVTEEQFNGIRTVQG-----------------FVAERNEIK 312
              I +  +KL  V   +L R+T   ++ I ++ G                 F    NE  
Sbjct: 1115 MVIYIYYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERV 1174

Query: 313  RFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIGDL 368
            +FN  +  +F     + +++ +  T       +G L+VL  G    S +     ++ G +
Sbjct: 1175 QFN--INCVFDYRSTNRWLSIRLQT-------IGALMVLITGMLSLSTISSSKPLTAGMV 1225

Query: 369  TAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPL-NEV 427
               M Y      ++  +      +  G+ +  RI E  +   + +    +  ++P  N  
Sbjct: 1226 GLLMSYVLQVTTSLMWIVRSSVMIETGIVSVERIMEYCELPSEAEQIVDD--YRPASNWP 1283

Query: 428  GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487
                I+FKN S  Y     + + KN++  +  G  V IVG +G GKST+   L      +
Sbjct: 1284 SKGAIQFKNYSTRYRAN-LDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPI 1342

Query: 488  SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT--YGLTEEPSKEEIRLVA 545
             G I+IDG DI+ +    LR  + I+ Q+     GT+R N+      +++     I L  
Sbjct: 1343 EGTIIIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSH 1402

Query: 546  KQCFCHNFI----TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEAT 601
             +      +    ++ P                   Q+Q + +ARAL+ +  IL+LDEAT
Sbjct: 1403 LKPHLKKLMEESGSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEAT 1462

Query: 602  SALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +++DVE++  I  T  +    +  TI++IAHR+ T+   + ++VL       E G+ KE 
Sbjct: 1463 ASVDVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-------EQGEVKE- 1512

Query: 662  YDNP 665
            +++P
Sbjct: 1513 FNSP 1516

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 90/218 (41%), Gaps = 32/218 (14%)

Query: 455 FKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG-------QILIDGQDIATLNTKSLR 507
           F+       C+VG  G GK+T+   +L      SG       +++I G+ +A        
Sbjct: 654 FRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESVAY------- 706

Query: 508 RKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
                  QE  +M+ +I++NI +G      +    L  K C         PD        
Sbjct: 707 -----CPQEAWIMNDSIKENILFG--HRYDETFYNLTVKACELRPDFKILPD--GDNTLV 757

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS----- 622
                     QK R+++ARA+  + +I +LD+  SA+D     +I +   +++ S     
Sbjct: 758 GEKGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIH---RVLDSDTGLL 814

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660
           K+  I+   + +S +   + + VL  DG ++E   + E
Sbjct: 815 KNKAIILTTNDISVLEHSDRIYVL-QDGRIIEESTYAE 851

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 127/536 (23%), Positives = 235/536 (43%), Gaps = 56/536 (10%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKD-LEFFDTFKVGDLM 209
            FL+GVG  L     +   + +IL +      S+    ++ + I K  + FF+T  +G ++
Sbjct: 976  FLLGVGSAL-----STLTQTIILWVYCTIHGSKYLHDIMADAIFKAPMTFFETTPIGRVL 1030

Query: 210  SRVGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWC 265
            +R  ND +    ++ R+ +    + V+           ++ +       +F I+P     
Sbjct: 1031 NRFSNDIYKVDELLGRTFSQFFVNAVKVSFT-------IIVICSSTWQFVFVIIPLGTLY 1083

Query: 266  TSVFGKQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAER-----NEIKRFNNV 317
                   +R +   ++L  VT   +    +E   GI T++G+  +      N+ +  NN+
Sbjct: 1084 IYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLHINQARVDNNM 1143

Query: 318  LREIFQVGKESAF---INGKFFTSASL--IGDLGFLIVLTYGSYLVMHGSMSIGDLTAFM 372
                      SAF   +N   + +  L  IG +  L   T   + +  G+++ G +   +
Sbjct: 1144 ----------SAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMIGLSV 1193

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFE---INDKEPKIKSTTGEAKFKPLNEVGG 429
             Y      ++  +     E+   + +  RI E   I  + P +  +   A+  P +    
Sbjct: 1194 SYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDWPTHGA-- 1251

Query: 430  CEIEFKNVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVS 488
              I+F+N S  Y  RP   +  +N+N  +     + IVG +G GKS++   L     A  
Sbjct: 1252 --IKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAE 1307

Query: 489  GQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQC 548
            G+I+IDG    ++  + LR  + I+ Q+  +  GT+R+NI    T E + EEI    +  
Sbjct: 1308 GRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI--DPTNEYTDEEIWHALELA 1365

Query: 549  FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVES 608
               + I       +               Q+Q + +ARAL+    IL+LDEAT+A+DVE+
Sbjct: 1366 HLKDHIKSLGKD-ELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVET 1424

Query: 609  EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            +  I  T     K++  TI++IAHR++TI   + ++VL + G + E    + L  N
Sbjct: 1425 DQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKN 1477

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 104/237 (43%), Gaps = 38/237 (16%)

Query: 436 NVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
           + +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L     V G   + 
Sbjct: 616 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGILGDLFRVKGFASVH 675

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFI 554
           G              I  V Q P +M+GT+++NI +G   +    +  L A  C     +
Sbjct: 676 G-------------SIAYVSQVPWIMNGTVKENILFGHKYDADFYDTTLRA--CALAVDL 720

Query: 555 TKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAIN 613
           +  P   +               QK RI++ARA+  + +  +LD+  +A+D   ++  I 
Sbjct: 721 SILPKGDE--TLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIE 778

Query: 614 YTFG---------QIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           +  G         +++ +  ++++SIA          D I L  +G +++ G ++E+
Sbjct: 779 HVLGSQGLLSSKVKVLATNKISVLSIA----------DHISLLENGEIIQQGSYEEV 825

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 121/543 (22%), Positives = 223/543 (41%), Gaps = 60/543 (11%)

Query: 157  ITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDA 216
            I L+   F N   V++L   S R   +L   +  +++   + FF+T  +G +++R  +D 
Sbjct: 1030 IGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIVNRFSSDL 1089

Query: 217  FVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTG-------ALFAILPPIIWCTSVF 269
              +   + +  +   RS         L+  +S  L G       AL A+L  I +    +
Sbjct: 1090 EAIDSGLQYIFSFFFRSV--------LIYVVSLILVGYNLPWFIALNAVLIMIYFYYQAY 1141

Query: 270  GKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKES 328
               +    K+L  ++   +  +  E   G   +  F    +   RFN    E  Q   + 
Sbjct: 1142 YIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETVQYNIDC 1197

Query: 329  AFINGKFFTSASLIG----DLGFLIVLTYG----SYLVMHGSMSIGDLTAFMLYTEYTGN 380
             F   +F ++   +      +G LI+L  G    + L     +S G +   M Y+    +
Sbjct: 1198 VF---QFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTS 1254

Query: 381  AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
            ++  +     ++   + +  R  E  + +P+       ++  P        IEF N +  
Sbjct: 1255 SLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSR-PPEGWPREGAIEFNNYTTK 1313

Query: 441  YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
            Y     + + K++N  +     + IVG +G GKST+   L     A  G I IDG DI+ 
Sbjct: 1314 Y-RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISK 1372

Query: 501  LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF--- 557
            +  + LR  + I+ Q+     GTIR N+     ++ S EE+    +       I +    
Sbjct: 1373 IGLEDLRSNLAIIPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSHLKQHILRMNEE 1430

Query: 558  ---------------PDTYDXXXXXXXXXXX----XXXXQKQRIAIARALIKKPNILILD 598
                           PD+++                   Q+Q + ++RAL+    +LILD
Sbjct: 1431 ANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILD 1490

Query: 599  EATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKF 658
            EAT+A+D+E++  +  T     K +  TI++IAHR+ T+  ++ ++VL + G V E    
Sbjct: 1491 EATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVL-DKGEVAEFDTV 1547

Query: 659  KEL 661
              L
Sbjct: 1548 SNL 1550

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 107/222 (48%), Gaps = 20/222 (9%)

Query: 450 FKNL-NFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI-LIDGQDIATLNTKSLR 507
            KN+ NF V  GS  CIVG  G GKSTI    LH   A+ GQ+  I   D       ++R
Sbjct: 645 LKNIDNFTVKKGSLTCIVGKVGSGKSTI----LH---AILGQLPCISALDQTRAPKVTIR 697

Query: 508 R-KIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXX 566
              I    QE  +M+ ++++NI +G   +  +    LV + C   + ++  PD  D    
Sbjct: 698 ATSIAYCPQEAWIMNSSVKENIVFG--HKHDENYYNLVIQACQLASDLSILPDG-DETIV 754

Query: 567 XXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---IMKS 622
                      QK RI++ARA+  + ++ +LD+  SA+D   S+  I Y   +   ++++
Sbjct: 755 GEKGISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRN 814

Query: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
           K  TI+   + ++ ++  + +  +   G +VE   ++ + ++
Sbjct: 815 K--TIILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNS 853

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 133/533 (24%), Positives = 233/533 (43%), Gaps = 50/533 (9%)

Query: 151  FLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKD-LEFFDTFKVGDLM 209
            F +GVG       F+   + VIL I      S     ++ N + +  + FF+T  +G ++
Sbjct: 1018 FALGVG-----SAFSTLIQTVILWIFCTIHGSTYLHNLMTNAVFRAPMSFFETTPIGRIL 1072

Query: 210  SRVGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWC 265
            +R  ND +    ++ R+ +    + V+              ++      +F I+P  I+ 
Sbjct: 1073 NRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIG-------VIAYTTWQFVFVIVPLGIFY 1125

Query: 266  TSVFGKQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIF 322
                   +R +   ++L+ VT   +    +E   G+ T++G+     + KRF ++  E  
Sbjct: 1126 IYYQQYYLRTSRELRRLESVTRSPIFSHFQETLGGLATIRGY----GQQKRFEHI-NECR 1180

Query: 323  QVGKESAF---INGKFFTSASL--IGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEY 377
                 SAF   IN   + +  L  IG +  L   T   + +  G+M+ G +   + Y   
Sbjct: 1181 VDNNMSAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLRAGTMTAGMIGLSLSYALQ 1240

Query: 378  TGNAIFGLSSFYSELMQGVGAASRI---FEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF 434
                +  +     E+   + +  RI    E+  + P +  +    K  P   V G EI+F
Sbjct: 1241 ITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPPKEWP---VAG-EIKF 1296

Query: 435  KNVSFFYPTR---PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
            ++    Y TR     + + K++N ++     + IVG +G GKS++   L     A SG I
Sbjct: 1297 EH----YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGI 1352

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCH 551
            LIDG  I  +    LR  + I+ Q+  +  GTIR+NI    T + +  +I    +     
Sbjct: 1353 LIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENI--DPTNQFTDADIWRALELSHLK 1410

Query: 552  NFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGA 611
              I +                     Q+Q + +ARAL+    +L+LDEAT+A+DVE++  
Sbjct: 1411 EHIMQMGGD-GLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKV 1469

Query: 612  INYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
            I  T     K +  TI++IAHR++TI   + +IVL + G VVE    + L  N
Sbjct: 1470 IQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEFDTPEALLKN 1519

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 108/266 (40%), Gaps = 23/266 (8%)

Query: 398 AASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSFFYPTRPTNQI-FKNLNF 455
           + SR+F     E   K      +   + E+G   +    N +F +  +P  ++  KN+N+
Sbjct: 613 SVSRLFNFLTNEELQKDAV--QRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINY 670

Query: 456 KVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQ 515
           +   G   CIVG  G GKS     LL     V G   I G              +  V Q
Sbjct: 671 QAKKGELSCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGS-------------VAYVSQ 717

Query: 516 EPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXX 575
              +M+GT+RDN+ +G   +P   E  +  K C     +    D                
Sbjct: 718 VAWIMNGTVRDNVLFGHKYDPEFYEKTI--KACALTIDLATLVD--GDQTLVGEKGISLS 773

Query: 576 XXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTIVSIAHRL 634
             QK R+++ARA+  + +  +LD+  +A+D   S   + +  G      S T +   +++
Sbjct: 774 GGQKARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILATNKI 833

Query: 635 STIRRFEDVIVLGNDGSVVEMGKFKE 660
           S +   + + +L N G + + G + +
Sbjct: 834 SVLSAADSITLLEN-GEITQQGTYAD 858

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 129/551 (23%), Positives = 236/551 (42%), Gaps = 64/551 (11%)

Query: 149  STFLMGVGITLIFGCFANF-GRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            ++F MG+    +FG      G+  +L  I  R    L  Q V  +IH  + F ++  +G 
Sbjct: 837  TSFYMGMYSFFVFGSIVFLTGQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPMGR 896

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPP----II 263
            +M+R   D    + S+ +++ D +R           +  L   +    FAI  P    I+
Sbjct: 897  IMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCI-IYLPWFAIAIPGLGLIL 951

Query: 264  WCTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIF 322
            +      +      K+L+ V    +     +   G+ T++ + AE    +RF+  L  + 
Sbjct: 952  FVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAE----ERFSYKLDYLI 1007

Query: 323  QVGKESAFINGKFFTSA--------SLIGDLGFLIV--LTYGSYLVMHGSMSIGDLTAFM 372
                E++++    +T+         +L+G    LIV  L       + G+ +   L+  +
Sbjct: 1008 DKTNEASYL----YTAVQRWINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVL 1063

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEI 432
            L  +   N +    +  ++    + +  R+     + P+  S   E   K   E G  EI
Sbjct: 1064 LIPDLLNNTL----TMVTQTENDMNSVERLVTYATELPQEASHGEEVPSKTWPENG--EI 1117

Query: 433  EFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQIL 492
            +F+NV + +       +      K+ AG  V I G +G GKST+   L       SG+++
Sbjct: 1118 KFENVRYTHRD-GLPAVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRVM 1176

Query: 493  IDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHN 552
            ID  D++ LN  +LR ++ I+ Q+P+L  G++R N+      +P  E    V K      
Sbjct: 1177 IDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDDDVLKNALMRC 1230

Query: 553  FITKFPDT-------------------YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
             + KF  T                   +                ++Q +A+ARALI+  +
Sbjct: 1231 TVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNSS 1290

Query: 594  ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
            IL+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI  ++ ++VL N G ++
Sbjct: 1291 ILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVLEN-GKII 1347

Query: 654  EMGKFKELYDN 664
             +   K L DN
Sbjct: 1348 GLDTPKSLLDN 1358

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 106/217 (48%), Gaps = 28/217 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKST----IASLLLHHYNAVSGQILIDGQDIATLNTKS 505
           F +LNF++  G  + IVGP G GK++    I  L+  + N   G++ +DG  ++      
Sbjct: 531 FHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGN--EGELEVDGSLVSC----- 583

Query: 506 LRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXX 565
                      P + + T+RDNI +G   + SK   + V + C     + K    YD   
Sbjct: 584 ---------GYPWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKLS-AYD-MT 630

Query: 566 XXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKS 624
                       QK RI +AR+L K+ +I + D+  SA+D    +  +     + +K+K+
Sbjct: 631 EIGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKT 690

Query: 625 MTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
             + +  H+LS I + + +IVLGNDG   +MG++++L
Sbjct: 691 RVLAT--HQLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 116/480 (24%), Positives = 210/480 (43%), Gaps = 26/480 (5%)

Query: 184  LRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXL 243
            L   +  +++   + FF+T  +G +++R  ND + V   +    A    +         +
Sbjct: 1028 LHDAMASSVLKAPMSFFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVV 1087

Query: 244  MLTLSRELTGALFAILPPIIWCTSVFGKQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRT 300
            +   + +    +F +LP  +         +R +   ++L  VT   +    +E   G+ T
Sbjct: 1088 ICMATWQF---IFIVLPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGLTT 1144

Query: 301  VQGFVAERNEIK----RFNNVLREIFQVGKESAFINGKF-FTSASLIGDLGFLIVLTYGS 355
            ++G+  +   +     R +N +   +     + ++  +  F  + +I     L V+  G+
Sbjct: 1145 IRGYSQQNRFVHINQTRVDNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGN 1204

Query: 356  YLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKST 415
              +  G   IG   +F L    + N I  ++    E+   + +  RI E  + + +    
Sbjct: 1205 GTLTAGM--IGLSLSFALQITQSLNWIVRMTV---EVETNIVSVERIKEYAELKSEAPYI 1259

Query: 416  TGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQ-IFKNLNFKVPAGSNVCIVGPSGRGKS 474
              + +  P +     EI+F N S  Y  RP  + I K+++  +     + IVG +G GKS
Sbjct: 1260 IKDHR-PPASWPESGEIKFVNYSTRY--RPELELILKDIDLHIHPKEKIGIVGRTGAGKS 1316

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE 534
            ++   L     A SG I+IDG  I ++    LR  + I+ Q+  +  GT+R+NI    T 
Sbjct: 1317 SLTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPTN 1374

Query: 535  EPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNI 594
              + EEI          + I                       Q+Q + +ARAL+   NI
Sbjct: 1375 RYTDEEIWNALALSHLKDHILGMGSN-GLETMLTEGGSNLSVGQRQLMCLARALLISSNI 1433

Query: 595  LILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            LILDEAT+A+DVE++  I  T     K +  TI++IAHR++TI   + +IVL + G V E
Sbjct: 1434 LILDEATAAVDVETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTE 1490

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 101/436 (23%), Positives = 185/436 (42%), Gaps = 63/436 (14%)

Query: 254 ALFAILPPIIWC-------TSVFGKQIRMNSKKLQDVT----GDLTRVTEEQFNGIRTVQ 302
           +L+ +L P +W               I    KKLQ +      + TRVT E  N I++++
Sbjct: 437 SLYKLLGPCMWVGVIIMIVMIPINSVIVRIQKKLQKIQMKNKDERTRVTSEILNNIKSLK 496

Query: 303 GFVAERNEIKRFNNV-----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357
            +  E     + ++V     L+ + ++G   A  N +F     L+    F  V  Y    
Sbjct: 497 VYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQFNIVPFLVSCSTF-AVFVYTEER 555

Query: 358 VMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE-INDKEPKIKSTT 416
            +   +    LT F L +         +SSF    ++   + +R+F  + ++E +  +  
Sbjct: 556 PLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRLFAFLTNEELQNDAVL 611

Query: 417 GEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKST 475
            E K K + + G   ++  + +F +  +P  ++  KN+NF    G   CIVG  G GKS 
Sbjct: 612 REPKVKNIGDEG---VKVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSA 668

Query: 476 IASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEE 535
           +   LL     V G   + G D+A             V Q P +M+GT++DNI +G   +
Sbjct: 669 LIQSLLGDLIRVKGFATVHG-DVAN------------VSQVPWIMNGTVKDNILFGHKYD 715

Query: 536 PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNIL 595
           P  E  +L  K C     ++  PD                  QK R+++ARA+  + +  
Sbjct: 716 P--EFYQLTIKACALSIDLSMLPD--GDQTLVGEKGISLSGGQKARLSLARAVYSRADTY 771

Query: 596 ILDEATSALDVE-SEGAINYTFG---------QIMKSKSMTIVSIAHRLSTIRRFEDVIV 645
           +LD+  +A+D   ++  I +  G         +++ +  +T++SIA          D I 
Sbjct: 772 LLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA----------DSIT 821

Query: 646 LGNDGSVVEMGKFKEL 661
           L  +G +++ G + ++
Sbjct: 822 LMENGEIIQQGSYDQV 837

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 116/507 (22%), Positives = 215/507 (42%), Gaps = 61/507 (12%)

Query: 188  VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTL 247
            V+  I+H  + FFD    G +M+R+  D   V + +         +         L+  +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 248  SREL------TGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRT 300
            + +        G L+A++         F        K+ + +T   + +   E   GI +
Sbjct: 1174 TPQFLIMAIFIGFLYALI-------GYFYVTTSRELKRFESITRSPIYQHFSETLVGITS 1226

Query: 301  VQGFVAER----NEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSY 356
            ++ +  ER      + R ++  R  F +     +I  ++   A  +  LG L+    G +
Sbjct: 1227 IRAYGDERRFMLENLSRIDDNNRPFFYL-----WIANRWL--AFRVDLLGALVTFFSGLF 1279

Query: 357  LVMH-GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKST 415
            + ++ G +  G     + Y  +           YS +   + +  R+ E  + E +    
Sbjct: 1280 IYLNIGKLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKEYMEIEQE--PY 1337

Query: 416  TGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKS 474
               A+  P N      I+  ++S  Y P  P  ++ KN+NF V     V IVG +G GKS
Sbjct: 1338 NENAQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKS 1395

Query: 475  TIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE 534
            TI + +    +  +G + ID  DI T+    LR+ I I+ Q+P L +GT++ +I    ++
Sbjct: 1396 TIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLK-SILDPYSQ 1454

Query: 535  EPSKEEIRLVAKQCFCHNF----------------ITKFPDTYDXXXXXXXXXXXXXXXQ 578
               K+    + +     +                 I KF    D               Q
Sbjct: 1455 YSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKF---LDLNNEVTEGGANLSQGQ 1511

Query: 579  KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIR 638
            +Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I 
Sbjct: 1512 RQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSII 1569

Query: 639  RFEDVIVLGNDGSVVEMGKFKELYDNP 665
             ++ V+V+       + G+ KE YD+P
Sbjct: 1570 DYDKVLVM-------DAGEVKE-YDHP 1588

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 98/237 (41%), Gaps = 13/237 (5%)

Query: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
           + G  + F+N +  +   P++   +N++ +   G      GP+G GKS++   LL     
Sbjct: 667 ISGNRLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTL 726

Query: 487 VSGQILI---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEE-IR 542
             G+I +   D ++   +    L   I    Q   L++ T R NI   L   P  E+   
Sbjct: 727 QEGKIYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNI---LFNSPYNEQRYN 783

Query: 543 LVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATS 602
            V + C                             QKQRI++ARAL      L+LD+  S
Sbjct: 784 DVLEACGLKKDFEILSG--GDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLS 841

Query: 603 ALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGK 657
           A+D  +   I  N   G +M+ ++  +VS  H ++   R  D +V+  +G V   G+
Sbjct: 842 AVDSHTALLIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 127/542 (23%), Positives = 222/542 (40%), Gaps = 54/542 (9%)

Query: 149  STFLMGVGITLIFGC-FANFGR-VVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVG 206
            + F +G+ + +  G  F N  R +V+L + S R   +L   +   ++   + FF+T  VG
Sbjct: 1013 AVFFVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVG 1072

Query: 207  DLMSRVGNDAFVVSRSITHKVA-------DGVRSXXXXXXXXXLMLTLSRELTGALFAIL 259
             +++R  +D   V  ++ + ++       D V           L L ++  L G      
Sbjct: 1073 RIINRFSSDMNSVDDNVQYVISFFLISILDYVVVVVIIGYQVPLFLLVNAALLG------ 1126

Query: 260  PPIIWCTSVFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVL 318
              I     VF   +    K+L   +   +  +  E   G   +  F    N   RF+ + 
Sbjct: 1127 --IYLYYQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRFDYLN 1180

Query: 319  REIFQVGKESAFINGKFFTSASLIG----DLGFLIVLTYG--SYLVMHG--SMSIGDLTA 370
             E  Q      F    F ++   +      +G L++LT    S     G  ++S G +  
Sbjct: 1181 IEAVQFNINCVF---NFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGL 1237

Query: 371  FMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGC 430
             M Y     N +  +     +L   V +  RI E  D  P+      + + +  N     
Sbjct: 1238 LMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEK-NWPAQG 1296

Query: 431  EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
             + FK+ S  Y     + + K LN ++     + IVG +G GKST++  L        G 
Sbjct: 1297 HVVFKDYSARY-RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGT 1355

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
            I+IDG DI  +    LR  + I+ Q+     G++R N+     E+ S +EI    +    
Sbjct: 1356 IVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHL 1413

Query: 551  HNFITKFPDTYDXXXXXXXXXXXXXXX-------QKQRIAIARALIKKPNILILDEATSA 603
               I K  +                         Q+Q + ++RAL+ +  IL+LDEAT+A
Sbjct: 1414 KPHILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAA 1473

Query: 604  LDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
            +D E++  I  T     K +  TI++IAHR+ T+   + ++VL       + G+ KE +D
Sbjct: 1474 VDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-------DQGEVKE-FD 1523

Query: 664  NP 665
            +P
Sbjct: 1524 SP 1525

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 111/510 (21%), Positives = 201/510 (39%), Gaps = 94/510 (18%)

Query: 255 LFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRF 314
           + A++ PI    S   ++I++  KK  +      +   E  N ++TV+ +  E   +KR 
Sbjct: 446 IMAVMFPI---NSYLSRKIKVLIKKQMEYKDARIKTVTEILNSVKTVKLYAWEEPMLKRL 502

Query: 315 NNVLREI-FQVGKESAFINGKFFTSAS----LIGDLGFLIVLTYGSYL-------VMHGS 362
           ++V  E+  +  K+ A +N     + +    L+    FLI   Y   +       ++  S
Sbjct: 503 DHVRNELELESFKKIAVMNNLTLFAWNCVPILVASSTFLI---YALVMDVPLTPQIVFPS 559

Query: 363 MSIGDLTAFMLYTE--------YTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKS 414
           +S+ D+    +YT          TG ++  L  F   L + +  +   FE    +P +  
Sbjct: 560 LSLFDILNDCIYTIPRTIINFIETGVSMGRLKDFL--LAKELDKSFIEFESLPDDPNV-- 615

Query: 415 TTGEAKFKPLNEVGGCEIEFKNVSFF--YPTRPTNQ--------------IFKNLN-FKV 457
                   P+       IE  N +F    PT+ T++                KN++ F+ 
Sbjct: 616 --------PV-------IEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQA 660

Query: 458 PAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEP 517
             G  VC+VG  G GKST    LL     +S        D AT         + +  Q+ 
Sbjct: 661 LKGQLVCVVGRVGAGKSTFLHALLGQLPCISS-----SHDQATPKMHFRCDSVALCSQQA 715

Query: 518 ILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXX 577
            +++ +++ N+ +G   + +  +  + A Q      I    D                  
Sbjct: 716 WILNASVKYNVLFGHKYDEASYKATIEACQLLPDLGILADGDE----TLVGEKGISLSGG 771

Query: 578 QKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---IMKSKSMTIVSIAHR 633
           QK RI++ARA+  + ++ +LD+  SA+D E  +  I++   +   ++K+K  T++   + 
Sbjct: 772 QKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNS 829

Query: 634 LSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXAT-----PQPVN 688
           +S ++  + +  L N G +VE G F E+                    +      P P  
Sbjct: 830 ISVLKHSQSIYALEN-GEIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAVKDDEPIPEQ 888

Query: 689 PPPFIDLQ----------TNPEEKKEADNA 708
            PP +DLQ           NPE   E DNA
Sbjct: 889 KPP-VDLQEVEDDALEEEINPEVPFELDNA 917

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 109/225 (48%), Gaps = 7/225 (3%)

Query: 431  EIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489
            EI F+ VSF Y P  P       ++F V AG  + I G +G GK+++ + L       SG
Sbjct: 1144 EIVFQEVSFAYRPGLPLA--LCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESG 1201

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCF 549
             I IDG DIATL    LR  + I+ Q+P+L  GT+R N+     E         + +   
Sbjct: 1202 SIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLD-PFAEHTDGTLWSALVRSGV 1260

Query: 550  CHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESE 609
                +      +                ++Q +A+ARAL++   ILILDEATS++D  ++
Sbjct: 1261 VPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARALVRSTRILILDEATSSVDYATD 1320

Query: 610  GAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
              +        + +  T++ +AHRL TI  ++ ++VL + G V E
Sbjct: 1321 ARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-DQGRVAE 1362

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 115/283 (40%), Gaps = 41/283 (14%)

Query: 452 NLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIG 511
           +L F +  G  + ++G  G GK+++ + +  +    +G + ++G  +            G
Sbjct: 553 DLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLLFC----------G 602

Query: 512 IVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXX 571
           +    P + + TIRDNI +G + + ++ +   V   C        FP             
Sbjct: 603 V----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPA--GDKTEVGERG 654

Query: 572 XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIA 631
                 QK RI++ARA+ K  +I + D+  SA+D      I      + + ++ T +   
Sbjct: 655 ITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILAT 713

Query: 632 HRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPP 691
           H+L+ ++    VI LG DGS  +MG   EL++                    PQ  N   
Sbjct: 714 HQLALVQEASRVIFLGQDGS-FDMGTPAELHEK------------------NPQFRNLMS 754

Query: 692 FIDLQTNPEEKKEADNASEENGAKLDDSKEDVSVPDNMTSSDD 734
            +  QTN EE +     S+    K   S   VS+PD     DD
Sbjct: 755 -LSSQTNAEESEMESIRSQSKSKKA--STAPVSMPDFNEEIDD 794

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 126/525 (24%), Positives = 228/525 (43%), Gaps = 46/525 (8%)

Query: 148  LSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKD-LEFFDTFKVG 206
            L  F +GVG  L     +   + VIL +      S+    V+ N + +  + FF+T  +G
Sbjct: 998  LIYFALGVGSAL-----STLIQTVILWVFCTIHGSKYLHTVMTNAVFRAPMSFFETTPIG 1052

Query: 207  DLMSRVGNDAF----VVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPI 262
             +++R  ND +    ++ R+ +  + + V+           M+ +       +F I P  
Sbjct: 1053 RILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFT-------MIVICWTTWQFIFIIGPLG 1105

Query: 263  IWCTSVFGKQIRMNS--KKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLR 319
            +         +R +   ++L  +T   +    +E   G+ T++G+    N+ +RF+++  
Sbjct: 1106 VLYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGMSTIRGY----NQQRRFDHI-N 1160

Query: 320  EIFQVGKESAF---INGKFFTSASL--IGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLY 374
                    SAF   IN   + +  L  IG +  L   T   Y +  G+++ G +   + Y
Sbjct: 1161 HCRIDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTAGMVGLSLSY 1220

Query: 375  TEYTGNAIFGLSSFYSELMQGVGAASRI---FEINDKEPKIKSTTGEAKFKPLNEVGGCE 431
                   +  +     E+   + +  RI    E+  + P +      A   P       +
Sbjct: 1221 ALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHWP----DSGD 1276

Query: 432  IEFKNVSFFYPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490
            I F + S  Y  RP  + + +++N  +     + IVG +G GKS++   L     A SG 
Sbjct: 1277 IRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEASSGG 1334

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
            I+IDG  I  +    LR  + I+ Q+  +  GTIR+N+    TE  + +EI  V +    
Sbjct: 1335 IVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENV--DPTETYTDDEIWRVLELSHL 1392

Query: 551  HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
            +  +                       Q+Q + +ARAL+    ILILDEAT+A+DVE++ 
Sbjct: 1393 NRHVESMGPR-GLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDQ 1451

Query: 611  AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEM 655
             I  T     + +  TI++IAHR++TI   + ++VL + G V E 
Sbjct: 1452 VIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEF 1493

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 90/436 (20%), Positives = 174/436 (39%), Gaps = 62/436 (14%)

Query: 254 ALFAILPPIIWCTSV----------FGKQIRMNSKKLQ-DVTGDLTRVTEEQFNGIRTVQ 302
           +L+ +L P +W   V          F  +I+   +K Q     + T V  E  N I++++
Sbjct: 438 SLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKDERTSVISEILNNIKSLK 497

Query: 303 GFVAERNEIKRFNNV-----LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357
            +  E    K+  +V     L+ + ++G   A  + +F     L+    F  V  Y    
Sbjct: 498 LYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF-AVFVYTEDR 556

Query: 358 VMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG 417
            +   +    LT F L +      +F + +  +  ++   + +R+F     E   K +  
Sbjct: 557 ALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKDSV- 611

Query: 418 EAKFKPLNEVGGCEIEF-KNVSFFYPTRPTNQI-FKNLNFKVPAGSNVCIVGPSGRGKST 475
             +   +  VG   ++   + +F +  +P  ++  KN+NF+   G   C+VG  G GKS 
Sbjct: 612 -QRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSA 670

Query: 476 IASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEE 535
           +   L      V G   + G              +  V Q   +M+GT+++NI +G   +
Sbjct: 671 LIQSLSGDLFRVKGFATVHGS-------------VAYVSQVAWIMNGTVKENILFGHRYD 717

Query: 536 PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNIL 595
           P  E      K C     +    D  +               QK R+++ARA+  + +  
Sbjct: 718 P--EFYDKTIKACALTIDLAVLVDGDE--TLVGEKGISLSGGQKARLSLARAVYARADTY 773

Query: 596 ILDEATSALDVE-SEGAINYTFG---------QIMKSKSMTIVSIAHRLSTIRRFEDVIV 645
           +LD+  +A+D    +  + +  G         +I+ +  ++++SIA R          I 
Sbjct: 774 LLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADR----------IA 823

Query: 646 LGNDGSVVEMGKFKEL 661
           L  +G +VE G + E+
Sbjct: 824 LLENGEIVEQGSYDEV 839

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 124/545 (22%), Positives = 222/545 (40%), Gaps = 70/545 (12%)

Query: 149  STFLMGVGITLIF-GCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGD 207
            ++F MG+    +F   FA   +  +L  +       L  + VK ++H  + F DT  +G 
Sbjct: 925  TSFYMGLYTFFVFFNYFATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTTPIGR 984

Query: 208  LMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGAL---------FAI 258
            +++R   D   +   +T  V               L L  +  + G +         FAI
Sbjct: 985  VLNRFTKDTDTLDTELTESV--------------RLFLFQASNIVGVVIMCIIYLPWFAI 1030

Query: 259  -LPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFN----GIRTVQGFVAERNEIKR 313
             +P ++   +      + +S++++ +           FN    G+ T++ +  E   + +
Sbjct: 1031 AVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTK 1090

Query: 314  FNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFML 373
             + ++ ++ + G     I      +  +I  + F +++T    L +    SI   +  +L
Sbjct: 1091 SDFLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALIITL---LCVTRQFSISAASVGVL 1146

Query: 374  YTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG---EAKFK------PL 424
             T      +  L    + LM+ +       ++N  E  I   T    EA ++      P 
Sbjct: 1147 LT-----YVLQLPGLLNTLMRAMTQGEN--DMNSAERLISYATDLPLEAAYRRPETSPPE 1199

Query: 425  NEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH 483
            +      I+F +VS  Y P  P   +  +++  V  G  + I G +G GKSTI S L   
Sbjct: 1200 SWPSEGAIDFDHVSLAYRPGLPL--VLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRM 1257

Query: 484  YNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN-----------ITYGL 532
                 G I IDG DIA L    LR K+ I+ Q+P+L  G +R N           +   L
Sbjct: 1258 IELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDAL 1317

Query: 533  TEE---PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
                   +++E    A        +T     +                ++Q +A+ RAL+
Sbjct: 1318 VRAGAIATEDEAAARAVTRATAGALTNL-HKFHLEQEVEEDGSNFSLGERQLLALTRALV 1376

Query: 590  KKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGND 649
            +   ILILDEATS++D E++  I             T++ IAHRL+TI  ++ ++VL + 
Sbjct: 1377 RSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVL-DQ 1433

Query: 650  GSVVE 654
            G V E
Sbjct: 1434 GRVCE 1438

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 93/215 (43%), Gaps = 26/215 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           FKNLN ++  G  V + G  G GKS++ + +       SG I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 510 IGIVQQEPILMSGTIRDNITYG--LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXX 567
             ++   P + + T++DNI +G    E   KE IR+    C     +   P         
Sbjct: 642 --LLCGYPWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQADLDLLPA--GDKTEI 693

Query: 568 XXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMT 626
                     QK RI +AR++ KK +I + D+  SA+D    +  ++      +  K+  
Sbjct: 694 GERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGKTRV 753

Query: 627 IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           + +  H+LS I R   VI +  DG+ V+ G   EL
Sbjct: 754 LAT--HQLSLIARASKVIFIDLDGT-VDSGTLDEL 785

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 113/512 (22%), Positives = 219/512 (42%), Gaps = 29/512 (5%)

Query: 167  FGRVVILRIISERLVSRL-RSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITH 225
              R +I+ +      S+L  +Q+  +++   + FF+T  VG +++R  +D   +     H
Sbjct: 1049 LARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVGRIVNRFSSDVNSIDEDFQH 1108

Query: 226  KVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT- 284
             ++   RS         +++T+S         IL  I +        +    K+L  ++ 
Sbjct: 1109 IISFFFRSMLDYLITI-VIITVSMPWFLLFNTILLGIYYYYQTLYVVLSRELKRLTSISY 1167

Query: 285  GDLTRVTEEQFNGIRTVQGFV-AERNEIKRFNNV---LREIFQVGKESAFINGKFFTSAS 340
              +  +  E   G   +  +  A       F N+   +  IF     + +++ +  T  +
Sbjct: 1168 SPVMSLLSETLGGHVVINAYKHANIFNYYNFENIQTNINFIFNFRSTNRWLSMRLQTIGA 1227

Query: 341  LIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAAS 400
            +I  +  L+ L   + L     +S G +   M Y     +++  +      +   + +  
Sbjct: 1228 VIVLITSLMAL---ASLGTSNPISAGLIGLLMSYALQVSSSLMWIIRMAVNIETTIVSVE 1284

Query: 401  RIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAG 460
            RI E  D +P+      +++  P N     EI F++ +  Y     + + K+++ ++   
Sbjct: 1285 RIIEYRDLKPEGIRVIEDSR-PPKNWPKRGEITFEHYTTKY-RENLDPVLKDIDLRIKHQ 1342

Query: 461  SNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILM 520
              + +VG +G GKST+   L        G+I IDG DI+TL    LRR + I+ Q+    
Sbjct: 1343 EKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDAQAF 1402

Query: 521  SGTIRDNIT--YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXX----- 573
             GT+R N+      T+    + + L   +      +++ PD  +                
Sbjct: 1403 EGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPDDENKPTDLLDTQISDNGNN 1462

Query: 574  XXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR 633
                Q+Q + ++RAL+    ILILDEAT+A+D E++  I  T     K +  TI++IAHR
Sbjct: 1463 LSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--TILTIAHR 1520

Query: 634  LSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            + T+   + ++VL       + G+ KE +D P
Sbjct: 1521 IDTVLDSDKIMVL-------DKGEVKE-FDTP 1544

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 95/215 (44%), Gaps = 21/215 (9%)

Query: 454 NFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT-LNTKSLRR--KI 510
           NF        CIVG  G GKST          A+ GQ+     D A+ +  K + R   +
Sbjct: 647 NFSAKKAQLTCIVGRVGSGKSTFL-------QAILGQLPCVSSDSASGVKPKVVIRADNL 699

Query: 511 GIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXX 570
               Q+P +M+ +++DNI +G   + +    +   K C     +   PD           
Sbjct: 700 AYCPQQPWIMNASLKDNILFGYKYDEAM--YKKTIKACQLLPDLEILPD--GDQTLVGEK 755

Query: 571 XXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---IMKSKSMT 626
                  QK R+++ARA+  + ++ +LD+  SA+D    +  I+    +   ++K+K++ 
Sbjct: 756 GISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNKTVI 815

Query: 627 IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           + + A     +    D+I L  +G +VE   ++E+
Sbjct: 816 LTTNA---VNVLVHSDMIYLLKNGKIVESNSYEEV 847

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 127/534 (23%), Positives = 235/534 (44%), Gaps = 40/534 (7%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
            L+GVG       F N   +++L   S R   +L   + K++I   + FF+T  VG +++R
Sbjct: 1026 LIGVGS----AAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINR 1081

Query: 212  VGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFG 270
              +D   V  S+ +  +   +S         L+   +   L   +F +   I + T  F 
Sbjct: 1082 FSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQT--FY 1139

Query: 271  KQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLRE--------I 321
              +    K+L  ++   +  +  E  NG   +  +    +  +RF  +  E        +
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----DHFERFIYLNYEKIQYNIDFV 1195

Query: 322  FQVGKESAFINGKFFT-SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGN 380
            F     + +++ +  T  A+++     L + T  +   +   M +G L ++ L  E TG+
Sbjct: 1196 FNFRSTNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSGM-VGLLMSYSL--EVTGS 1252

Query: 381  AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
              + + +    +   + +  RI E  +   + +S   E +    N      IEFK+ S  
Sbjct: 1253 LTWIVRTTVM-IETNIVSVERIVEYCELPSEAQSINPEKR-PDKNWPSRGSIEFKDYSTK 1310

Query: 441  YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
            Y     + + K++N K+     V IVG +G GKST++  L        G+I+IDG +I+ 
Sbjct: 1311 Y-RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISD 1369

Query: 501  LNTKSLRRKIGIVQQEPILMSGTIRDNIT--YGLTEEPSKEEIRLVAKQCFCHNFITKFP 558
            L    LR  + I+ Q+     GT++ N+      +E+  K+ + L   +      +   P
Sbjct: 1370 LGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKKAVELAHLKPHLEKMLENEP 1429

Query: 559  -------DTYDXXXXXXXXX-XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
                   D  D                Q+Q + +ARAL+ +  IL+LDEAT+++D+E++ 
Sbjct: 1430 SDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDK 1489

Query: 611  AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
             I  T  +  K +  TI++IAHR+ T+   + +IVL ++GSV E     +L  N
Sbjct: 1490 IIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSN 1540

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 104/463 (22%), Positives = 178/463 (38%), Gaps = 82/463 (17%)

Query: 243 LMLTLSRELTGAL--FAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRT 300
           L   L + + G L   AI+ PI    +   ++++  SK          +   E  N I++
Sbjct: 428 LYWLLGKAVIGGLITMAIMMPI---NAFLSRKVKKLSKTQMRYKDMRIKTITELLNAIKS 484

Query: 301 VQGFVAERNEIKRFNNV-----LREIFQVGKESAFINGKF-----------FTSASLIGD 344
           ++ +  E   +KR N+V     L+   ++G  S  I   +           F   SL  D
Sbjct: 485 IKLYAWEEPMMKRLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVACSTFGLFSLFND 544

Query: 345 -----------LGFLIVLTYGSYLV-------MHGSMSIGDLTAFMLYTEYTGNAIFGLS 386
                      L    +L    Y V       +  S+S+  L +F+L  E   + I  + 
Sbjct: 545 SPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERID 604

Query: 387 SFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNE--VGGCEIEFKNVSFFYPTR 444
               E    V   + I  +   +  + S+  E   +   E  +G  +I  KN+  F   R
Sbjct: 605 PSVDERTLPVIEMNNITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKR 664

Query: 445 PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG-------QILIDGQD 497
                          G+ VCIVG  G GKST    +L     +SG       +++I    
Sbjct: 665 ---------------GNLVCIVGRVGAGKSTFLKAILGQLPCMSGSKESIPPKLIIRSSS 709

Query: 498 IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557
           +A               QE  +M+ ++++NI +G   +  K    L  K C     +   
Sbjct: 710 LAY------------CSQESWIMNASVKENILFG--HKFDKAYYDLTIKACQLLPDLRIL 755

Query: 558 PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF 616
           PD                  QK R+++ARA+  + +I +LD+  SA+D E S+  I Y  
Sbjct: 756 PD--GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVL 813

Query: 617 -GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKF 658
            G+    K+ TI+   + +S ++  + +  L N G +VE G +
Sbjct: 814 IGKKALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNY 855

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 125/520 (24%), Positives = 219/520 (42%), Gaps = 44/520 (8%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
            L+G+G       F  F  +++L   S R    L   + K II   ++FF+T  +G +++R
Sbjct: 1010 LIGLGS----AAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIGRVINR 1065

Query: 212  VGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSVFGK 271
              +D   V  ++ +  +   RS             L   LT  L ++  P     +    
Sbjct: 1066 FSSDIDSVDVNLQNVFSIFFRS------------ILDYILTVILVSVAMPWFLLFNALIM 1113

Query: 272  QIRMNSKKLQDVTG-DLTRVTEEQFNGIRTV-------QGFVAERNEIK--RFNNVLREI 321
             I    +KL  V   +L R+T   ++ I ++       Q  ++  N  K  +F N+ R  
Sbjct: 1114 IIYFYYEKLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAYNHSKMFKFMNIERVQ 1173

Query: 322  FQVGKESAFINGKFFTSASLIGDLGFLIVLTYG--SYLVMHGSMSIGD--LTAFMLYTEY 377
            + +     F +   + S  L   +G  I+L  G  +   +  S  IG   +   M Y   
Sbjct: 1174 YNLNVLFTFRSTNRWLSIRL-QSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQ 1232

Query: 378  TGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNV 437
              +A+  +     ++   + +  RI E     P+ +      + +      G  IEFKN 
Sbjct: 1233 VTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRG-SIEFKNY 1291

Query: 438  SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497
            +  Y     + + KN++  +     V IVG +G GKST++  L     A  G I IDG D
Sbjct: 1292 TTTYRAN-LSPVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVD 1350

Query: 498  IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF 557
            I+ +    LR  + I+ Q+     GT+R N+     ++ +  E+  V +       + + 
Sbjct: 1351 ISRIGLTDLRGNMAIIPQDAQAFEGTVRSNL--DPFQKHTDVELWNVIELSHLKPHVLRM 1408

Query: 558  PDTYDXX-------XXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
             +  +                      Q+Q + +ARAL+ +  +L+LDEAT+A+DVE++ 
Sbjct: 1409 AEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDK 1468

Query: 611  AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDG 650
             I  T     K +  TI++IAHRL TI   + ++VL   G
Sbjct: 1469 IIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVLDAGG 1506

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 115/273 (42%), Gaps = 52/273 (19%)

Query: 422 KPLNE-VGGCEIEFKNVSFFYPTRP---------------TNQI-FKNLN-FKVPAGSNV 463
           KP NE +   EIE  N +F + ++                T Q+  KN++ F     S  
Sbjct: 598 KPANEYIPAVEIE--NATFLWKSQAQLINSENDDSEANIETTQVALKNIDHFTASPKSLT 655

Query: 464 CIVGPSGRGKSTIASLLLHHYNAVSG-------QILIDGQDIATLNTKSLRRKIGIVQQE 516
           C++G  G GK+T+   +L     +SG       ++ I G+ IA               QE
Sbjct: 656 CVIGKVGSGKTTLLKAILGQLPCISGSKESISPKLSIRGESIAY------------CPQE 703

Query: 517 PILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXX 576
             +M+ TI++NI +G   + +   + + A +      I   PD                 
Sbjct: 704 AWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPD--GDQTLVGEKGISLSG 759

Query: 577 XQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKS-----MTIVSIA 631
            QK R+++ARA+  + +I +LD+  SA+D    G        ++ S S      T++   
Sbjct: 760 GQKARVSLARAVYSRADIYLLDDILSAVDA---GVSKKIVENVLDSNSGLLRNKTVILST 816

Query: 632 HRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDN 664
           + +S ++  + +  L N G +VE G + ++ ++
Sbjct: 817 NTVSVLKHSQLIYALEN-GIIVERGNYNDIIES 848

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 124/535 (23%), Positives = 222/535 (41%), Gaps = 43/535 (8%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
            L+GVG       F N   +++L   S R   +L   + K++I   + FF+T  VG +++R
Sbjct: 1026 LLGVGS----AAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINR 1081

Query: 212  VGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFG 270
              +D   V  S+ +  +   +S         L+   +   L   +F ++  I + T  F 
Sbjct: 1082 FSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYYQT--FY 1139

Query: 271  KQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESA 329
              +    K+L  ++   +  +  E  NG   +  +    N  +RF  +  +  Q   +  
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSNIDLV 1195

Query: 330  F----INGKFFTSASLIG-DLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFG 384
            F    IN         IG  +     L   + +     +S G +   M Y+    +++  
Sbjct: 1196 FNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTW 1255

Query: 385  LSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTR 444
            +      +   + +  RI E  +  P+ +S   E +    N      IEFKN S  Y   
Sbjct: 1256 IVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKR-PDENWPSEGRIEFKNYSTKY-RE 1313

Query: 445  PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTK 504
              + + K++N  +     + IVG +G GKST++  L        G+I+ID  +I+ L   
Sbjct: 1314 NLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLF 1373

Query: 505  SLRRKIGIVQQEPILMSGTIRDNIT--YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             LR  + I+ Q+     GT+R N+      +E+  K  I L   +      +    +  D
Sbjct: 1374 DLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAHLKSHLEKMLGNEAENND 1433

Query: 563  XXXXXXXXX------------XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
                                       Q+Q + +ARAL+    IL+LDEAT+++D+E++ 
Sbjct: 1434 INVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDK 1493

Query: 611  AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
             I  T  +  K +  TI++IAHR+ T+   + +IVL       + G  KE +D+P
Sbjct: 1494 IIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FDSP 1538

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 102/239 (42%), Gaps = 31/239 (12%)

Query: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
           +G  +I  KN+  F   R               G  +C+VG  G GKST    +L     
Sbjct: 647 MGSSQIALKNIEHFEAKR---------------GDLICVVGRVGAGKSTFLKAILGQLPC 691

Query: 487 VSGQILIDGQDIATLNTKSLRR--KIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLV 544
           +SG          +L  K + R   +    QE  +M+ ++R+NI +G   +  K    L 
Sbjct: 692 MSGSK-------ESLAPKLIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLT 742

Query: 545 AKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
            K C     +   PD                  QK R+++ARA+  + +I +LD+  SA+
Sbjct: 743 IKACQLLPDLKILPD--GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAV 800

Query: 605 DVE-SEGAINYTF-GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           D E S+  I +   G+    K+ TI+   + +S ++  + +  L N G +VE G ++ +
Sbjct: 801 DAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYESV 858

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 127/549 (23%), Positives = 225/549 (40%), Gaps = 59/549 (10%)

Query: 153  MGVGITLIFG----CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
            M VG+  + G     F N   +V+L   S R   +L   +  ++++  + FF+T  +G +
Sbjct: 1015 MFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRI 1074

Query: 209  MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSV 268
            ++R   D   V   +    +   RS             L   +T  L     P  +  ++
Sbjct: 1075 INRFSGDLDSVDSGLQFIFSHFFRSL------------LGYIVTVILVGYNMPWFFVFNI 1122

Query: 269  FGKQIRMNSKKLQDVTG-DLTRVTEEQFNGI-----RTVQGF--VAERNEIKRFNNVLRE 320
            F   I    +    VT  +L R+T   ++ I      T+ G+  +   N  KRF+    E
Sbjct: 1123 FLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSYFNFE 1182

Query: 321  IFQVGKESAFINGKFFTSASLIG----DLGFLIVLTYG----SYLVMHGSMSIGDLTAFM 372
              Q   +  F    F ++   +      +G LIVL  G    S +     ++ G +   M
Sbjct: 1183 SVQFNIDCLF---NFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLM 1239

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEI 432
             Y+    N++  +     ++   + +  RI E  +  P+      E K +      G  I
Sbjct: 1240 SYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHG-SI 1298

Query: 433  EFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQIL 492
            +F + S  Y  +  + +   +N ++     + IVG +G GKST+   L     A  G+I+
Sbjct: 1299 KFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIV 1357

Query: 493  IDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHN 552
            IDG DI+TL    LR  + I+ Q+     GTIR N+     ++ S EE+    +      
Sbjct: 1358 IDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKP 1415

Query: 553  FITKFPDTYDXXXXXXXXXXXX-----------------XXXQKQRIAIARALIKKPNIL 595
             + +     D                                Q+Q + ++RAL+    IL
Sbjct: 1416 HLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKIL 1475

Query: 596  ILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEM 655
            +LDEAT+++D+E++  I  T       +  TI++IAHR+ T+  ++ ++VL + G V E 
Sbjct: 1476 VLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREF 1532

Query: 656  GKFKELYDN 664
                 L +N
Sbjct: 1533 DSPDTLLEN 1541

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 109/569 (19%), Positives = 229/569 (40%), Gaps = 84/569 (14%)

Query: 201 DTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGAL--FAI 258
           +++  GD+++ V  D   + R   +                 L   L   + G +   AI
Sbjct: 382 ESYSTGDIINFVSVDVLRLQRFFENSQVIIGAPIQIVIVLTSLYWLLGEAVIGGIVTMAI 441

Query: 259 LPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVL 318
           + PI    +   K+++  +K+         R   E  N I++++ +  E+  +KR ++V 
Sbjct: 442 MIPI---NAYLSKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVR 498

Query: 319 REI-FQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLV--MHGSMSIGDLTAF--ML 373
            ++  +  K+   ++   F + + +      I++T  S+++  +   M++     F  + 
Sbjct: 499 NDLELESFKKIGIVSNCIFFAWNCVP-----IMVTCSSFIIFALTSGMALTPDIVFPALA 553

Query: 374 YTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIE 433
                 +AI+ + S  + +++   +  R+      E   +S   ++   P N+   C +E
Sbjct: 554 LFNILNDAIYSVPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSD--PKNDGHSCAVE 611

Query: 434 FKNVSFFYPTRP----------------TNQIFKNLN-FKVPAGSNVCIVGPSGRGKSTI 476
             N +F +  +                 T   FKN+N F+V  GS  CIVG  G GK+T+
Sbjct: 612 IDNATFLWKGKKNLVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTL 671

Query: 477 ASLLLHHYNAVSG-------QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
              +L     +SG       +++I G  IA               Q+  +M+ ++++NI 
Sbjct: 672 LRAVLGQLPCISGAQESIPPKLIIRGNSIA------------YCPQQAWIMNSSVKENIL 719

Query: 530 YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
           +G   +  +    L  + C     +   PD                  QK R+++ARA+ 
Sbjct: 720 FG--HKYDEHYYNLTIEACQLTEDLKMLPD--GDETIVGEKGISLSGGQKARLSLARAVY 775

Query: 590 KKPNILILDEATSALDVE-SEGAINYTFGQ---IMKSKSMTIVSIAHRLSTIRRFEDVIV 645
            + +I +LD+  SA+D E S+  I     +   ++KSK  TI+   + +S ++  + +  
Sbjct: 776 SRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYA 833

Query: 646 LGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEA 705
           L N   ++E G + ++ +                   + +       I+   N  +    
Sbjct: 834 LEN-CEIIEEGAYDDVMN-------------------SSEDSKLKALINEFDNDRDNNSK 873

Query: 706 DNASEENGAKLDDSKEDVSVPDNMTSSDD 734
           +  SEE     +++ + V + DN+  +DD
Sbjct: 874 EEVSEERKTS-EETSDVVPIDDNLIENDD 901

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 127/549 (23%), Positives = 225/549 (40%), Gaps = 59/549 (10%)

Query: 153  MGVGITLIFG----CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
            M VG+  + G     F N   +V+L   S R   +L   +  ++++  + FF+T  +G +
Sbjct: 1043 MFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRI 1102

Query: 209  MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSV 268
            ++R   D   V   +    +   RS             L   +T  L     P  +  ++
Sbjct: 1103 INRFSGDLDSVDSGLQFIFSHFFRSL------------LGYIVTVILVGYNMPWFFVFNI 1150

Query: 269  FGKQIRMNSKKLQDVTG-DLTRVTEEQFNGI-----RTVQGF--VAERNEIKRFNNVLRE 320
            F   I    +    VT  +L R+T   ++ I      T+ G+  +   N  KRF+    E
Sbjct: 1151 FLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSYFNFE 1210

Query: 321  IFQVGKESAFINGKFFTSASLIG----DLGFLIVLTYG----SYLVMHGSMSIGDLTAFM 372
              Q   +  F    F ++   +      +G LIVL  G    S +     ++ G +   M
Sbjct: 1211 SVQFNIDCLF---NFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLM 1267

Query: 373  LYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEI 432
             Y+    N++  +     ++   + +  RI E  +  P+      E K +      G  I
Sbjct: 1268 SYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHG-SI 1326

Query: 433  EFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQIL 492
            +F + S  Y  +  + +   +N ++     + IVG +G GKST+   L     A  G+I+
Sbjct: 1327 KFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIV 1385

Query: 493  IDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHN 552
            IDG DI+TL    LR  + I+ Q+     GTIR N+     ++ S EE+    +      
Sbjct: 1386 IDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKP 1443

Query: 553  FITKFPDTYDXXXXXXXXXXXX-----------------XXXQKQRIAIARALIKKPNIL 595
             + +     D                                Q+Q + ++RAL+    IL
Sbjct: 1444 HLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKIL 1503

Query: 596  ILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEM 655
            +LDEAT+++D+E++  I  T       +  TI++IAHR+ T+  ++ ++VL + G V E 
Sbjct: 1504 VLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREF 1560

Query: 656  GKFKELYDN 664
                 L +N
Sbjct: 1561 DSPDTLLEN 1569

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 109/569 (19%), Positives = 229/569 (40%), Gaps = 84/569 (14%)

Query: 201 DTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGAL--FAI 258
           +++  GD+++ V  D   + R   +                 L   L   + G +   AI
Sbjct: 410 ESYSTGDIINFVSVDVLRLQRFFENSQVIIGAPIQIVIVLTSLYWLLGEAVIGGIVTMAI 469

Query: 259 LPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVL 318
           + PI    +   K+++  +K+         R   E  N I++++ +  E+  +KR ++V 
Sbjct: 470 MIPI---NAYLSKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVR 526

Query: 319 REI-FQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLV--MHGSMSIGDLTAF--ML 373
            ++  +  K+   ++   F + + +      I++T  S+++  +   M++     F  + 
Sbjct: 527 NDLELESFKKIGIVSNCIFFAWNCVP-----IMVTCSSFIIFALTSGMALTPDIVFPALA 581

Query: 374 YTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIE 433
                 +AI+ + S  + +++   +  R+      E   +S   ++   P N+   C +E
Sbjct: 582 LFNILNDAIYSVPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSD--PKNDGHSCAVE 639

Query: 434 FKNVSFFYPTRP----------------TNQIFKNLN-FKVPAGSNVCIVGPSGRGKSTI 476
             N +F +  +                 T   FKN+N F+V  GS  CIVG  G GK+T+
Sbjct: 640 IDNATFLWKGKKNLVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTL 699

Query: 477 ASLLLHHYNAVSG-------QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNIT 529
              +L     +SG       +++I G  IA               Q+  +M+ ++++NI 
Sbjct: 700 LRAVLGQLPCISGAQESIPPKLIIRGNSIA------------YCPQQAWIMNSSVKENIL 747

Query: 530 YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALI 589
           +G   +  +    L  + C     +   PD                  QK R+++ARA+ 
Sbjct: 748 FG--HKYDEHYYNLTIEACQLTEDLKMLPD--GDETIVGEKGISLSGGQKARLSLARAVY 803

Query: 590 KKPNILILDEATSALDVE-SEGAINYTFGQ---IMKSKSMTIVSIAHRLSTIRRFEDVIV 645
            + +I +LD+  SA+D E S+  I     +   ++KSK  TI+   + +S ++  + +  
Sbjct: 804 SRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYA 861

Query: 646 LGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFIDLQTNPEEKKEA 705
           L N   ++E G + ++ +                   + +       I+   N  +    
Sbjct: 862 LEN-CEIIEEGAYDDVMN-------------------SSEDSKLKALINEFDNDRDNNSK 901

Query: 706 DNASEENGAKLDDSKEDVSVPDNMTSSDD 734
           +  SEE     +++ + V + DN+  +DD
Sbjct: 902 EEVSEERKTS-EETSDVVPIDDNLIENDD 929

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 125/535 (23%), Positives = 222/535 (41%), Gaps = 43/535 (8%)

Query: 152 LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
           L+GVG       F N   +++L   S R   +L   + K++I   + FF+T  VG +++R
Sbjct: 455 LLGVG----SAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINR 510

Query: 212 VGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFG 270
             +D   V  S+ +  +   +S         L+   +   L   +F ++  I + T  F 
Sbjct: 511 FSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYYQT--FY 568

Query: 271 KQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESA 329
             +    K+L  ++   +  +  E  NG   +  +    N  +RF  +  +  Q   +  
Sbjct: 569 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSNIDLV 624

Query: 330 F----INGKFFTSASLIG-DLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFG 384
           F    IN         IG  +     L   + +     +S G +   M Y+    +++  
Sbjct: 625 FNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTW 684

Query: 385 LSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTR 444
           +      +   + +  RI E  +  P+ +S   E K    N      IEFKN S  Y   
Sbjct: 685 IVRTTVMIETNIVSVERIVEYCELPPEAQSINPE-KRPDENWPSEGRIEFKNYSTKY-RE 742

Query: 445 PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTK 504
             + + K++N  +     + IVG +G GKST++  L        G+I+ID  +I+ L   
Sbjct: 743 NLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLF 802

Query: 505 SLRRKIGIVQQEPILMSGTIRDNIT--YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
            LR  + I+ Q+     GT+R N+      +E+  K  I L   +      +    +  D
Sbjct: 803 DLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAHLKSHLEKMLGNEAENND 862

Query: 563 XXXXXXXXX------------XXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEG 610
                                      Q+Q + +ARAL+    IL+LDEAT+++D+E++ 
Sbjct: 863 INVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDK 922

Query: 611 AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            I  T  +  K +  TI++IAHR+ T+   + +IVL       + G  KE +D+P
Sbjct: 923 IIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FDSP 967

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 102/237 (43%), Gaps = 31/237 (13%)

Query: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
           +G  +I  KN+  F   R               G  +C+VG  G GKST    +L     
Sbjct: 76  MGSSQIALKNIEHFEAKR---------------GDLICVVGRVGAGKSTFLKAILGQLPC 120

Query: 487 VSGQILIDGQDIATLNTKSLRR--KIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLV 544
           +SG          +L  K + R   +    QE  +M+ ++R+NI +G   +  K    L 
Sbjct: 121 MSGSK-------ESLAPKLIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLT 171

Query: 545 AKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
            K C     +   PD  +               QK R+++ARA+  + +I +LD+  SA+
Sbjct: 172 IKACQLLPDLKILPDGDETLVGEKGISLSGG--QKARLSLARAVYSRADIYLLDDILSAV 229

Query: 605 DVE-SEGAINYTF-GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFK 659
           D E S+  I +   G+    K+ TI+   + +S ++  + +  L N G +VE G ++
Sbjct: 230 DAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYE 285

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 120/527 (22%), Positives = 220/527 (41%), Gaps = 44/527 (8%)

Query: 155  VGITLIFG----CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMS 210
            VGI  + G     F N   V+IL   S R    L +++  +++   + FF++  +G +++
Sbjct: 1029 VGIYALLGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPIGRIIN 1088

Query: 211  RVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM---LTLSRELTGALFAILPPIIWCTS 267
            R  +D   V R++ +  A   +          L+   +         L  +         
Sbjct: 1089 RFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMPWFLVFNAGLLVVYVYYQVFYV 1148

Query: 268  VFGKQI-RMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGK 326
               +++ R++S     +      +  E   G   +  F    +E   F N  +  FQ+  
Sbjct: 1149 TLSRELKRLSSTAFSPIMS----LFSETLGGHMVITAF--RHSERFHFLNFNKTQFQIDA 1202

Query: 327  ESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGS---MSIGDLTAFMLYTEYTGNAIF 383
            +    +   + S  L    G ++++T    L   G+   M+ G +   M Y     N++ 
Sbjct: 1203 QFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQVTNSLM 1262

Query: 384  GLSSFYSELMQGVGAASRIFE---INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
             +    + +   + +  RI+E   +  + P I  ++   K  P   +G  EI FK+ S  
Sbjct: 1263 WIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRPEKSWP--SMG--EIIFKDYSTK 1318

Query: 441  YPTRPT-NQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIA 499
            Y  RP  + + K +N  +     + +VG +G GKS+++  L     +  G I IDG DI+
Sbjct: 1319 Y--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGVDIS 1376

Query: 500  TLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKF-- 557
             +    LR  + I+ Q+     GT+R N+      + S +EI    +       I K   
Sbjct: 1377 KIGLYDLRSHLSIIPQDAQAFEGTVRSNL--DPFNQYSVQEIWKAVELAHLKPHIIKMMT 1434

Query: 558  ---PDTYDXXXXXXXXXXX-------XXXXQKQRIAIARALIKKPNILILDEATSALDVE 607
               PD                         Q+Q + ++RAL+ K  +L+LDEAT+A+D+E
Sbjct: 1435 DEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAVDME 1494

Query: 608  SEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            ++  I  T     + K  TI++IAHR+ T+   + ++VL + G V E
Sbjct: 1495 TDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEVKE 1538

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 118/284 (41%), Gaps = 43/284 (15%)

Query: 387 SFYSELMQGVGAASRIFEIND------KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440
           SF  EL   V       E+N+       E  +KS   EA       VG  ++  +N+   
Sbjct: 609 SFIHELKDEVDGPKPTIEVNNATFLWQSEKTLKSNDEEAN------VGSSQVALENID-- 660

Query: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
                        +F+   G+  C+VG  G GKST+   +L      SG      ++  +
Sbjct: 661 -------------HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGP-----KEFIS 702

Query: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560
                  R +    Q P +M+ +I+DNI +G   + +   + + A Q      I    D 
Sbjct: 703 PEILVRARSVAYCPQAPWVMNASIKDNILFGHRYDETYYNLTIKACQLIPDLKILSEGDE 762

Query: 561 YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ- 618
                            QK R+++ARA+  + ++ ++D+  SA+D E S+  I+   G+ 
Sbjct: 763 ----TLVGEKGISLSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEE 818

Query: 619 --IMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660
             ++K K++ + + A    ++ +  ++I     G +VE G +++
Sbjct: 819 NGLLKHKTIILTTNA---VSVLKHSNMIYALQGGRIVEEGTYEQ 859

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 94/363 (25%), Positives = 160/363 (44%), Gaps = 35/363 (9%)

Query: 183  RLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXX 242
            ++   ++  ++H  L FFD   +G +M+R   D   V + +T  +               
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 243  LMLTLSRE-LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD-LTRVTEEQFNGIRT 300
            L+  ++ + L  A+F  +  + +    F        K+ + VT   + +   E   GI T
Sbjct: 1219 LIAFITPQFLILAIF--IGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVT 1276

Query: 301  VQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASL-------IGDLGFLIVLTY 353
            ++ +  E    KRF  +L  + ++ +     N  FF   +        I  +G L+V   
Sbjct: 1277 IRAYGDE----KRF--MLENLHKIDEN----NKPFFYLWAFNRWLSFRIDMIGSLVVFGA 1326

Query: 354  GSYLVMH-----GSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN-- 406
            G +++++       ++   LT  + +TE    A   L  FY+++   + +  R+ E    
Sbjct: 1327 GVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEI 1382

Query: 407  DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCI 465
            D+EP  +           N     +IE  N+S  Y P  P  ++ KN+ F V     V +
Sbjct: 1383 DQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGV 1440

Query: 466  VGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIR 525
            VG +G GKSTI + L    +A +G I ID  DI T+N   LRR I I+ Q+P L SGTIR
Sbjct: 1441 VGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIR 1500

Query: 526  DNI 528
             N+
Sbjct: 1501 SNL 1503

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 108/469 (23%), Positives = 198/469 (42%), Gaps = 43/469 (9%)

Query: 205 VGDLMSRVGNDAFVVSR--SITHKVADGVRSXXXXXXXXXLMLTLSRELTGALF-AILPP 261
           +G +++ +  DAF VS      H   + +            +L  +  + GAL  A LP 
Sbjct: 512 LGAIINLMAVDAFKVSEICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFLPL 571

Query: 262 IIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNV---- 317
            +   ++ G+      KK   VT    +   E F  IR ++ F  E N  +    V    
Sbjct: 572 NLKLATLLGEY----QKKSLAVTDKRIQKLNETFQAIRIIKYFSWEDNFTRDIETVREKE 627

Query: 318 LREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIG--DLTAFMLYT 375
           L  +F+     AF +  +F + S++    F        Y+ + G         TA  L+T
Sbjct: 628 LHLLFKRSLIWAFSSFIWFITPSIVTSCSF------AFYIYVQGETLTTPVAFTALSLFT 681

Query: 376 EYTGNAIFGLSSFYSELMQGVGAASRIFEI-NDKEPKIKSTTGEAKFKPLN-EVGGCEIE 433
                 +  LS+  S ++Q   +  RI ++  +KE +        K+  L  +  G  I 
Sbjct: 682 -LLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKETE--------KYSQLTIDKNGNRIA 732

Query: 434 FKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILI 493
           F+N +  +  + +    ++LN     G    ++GP+G GKS++   LL   +  +G I++
Sbjct: 733 FQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIV 792

Query: 494 ---DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
              D +D   ++   +   I    Q   L++ T+R+NI +      ++    +V   C  
Sbjct: 793 PSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYN-AVVEACCLK 851

Query: 551 HNF-ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESE 609
            +F I K  D  +               QKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 852 RDFEILKAGDMTE----IGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTA 907

Query: 610 GAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
             I  N   G +M++++  +VS  H ++   R  +++V+  DG V + G
Sbjct: 908 LWIYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 57/88 (64%), Gaps = 10/88 (11%)

Query: 578  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
            Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + K  TI++IAHRL ++
Sbjct: 1566 QRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRSV 1623

Query: 638  RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
              ++ ++V+       + G+ KE YD+P
Sbjct: 1624 CDYDKILVM-------DAGEVKE-YDHP 1643

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 123/551 (22%), Positives = 221/551 (40%), Gaps = 66/551 (11%)

Query: 150  TFLMGVGITLIFGCFANF-GRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
            +F MG+    +FG +    G+  +L  +       L  Q +  I+H  + F DT  +G +
Sbjct: 941  SFYMGLYSFFVFGSYIFMNGQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPLGRI 1000

Query: 209  MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLMLTLSRELTGALFAILPPIIWCTSV 268
            ++R   D   +   +T  +   +           + +     +    FAI  P +    +
Sbjct: 1001 LNRFTKDTDALDNELTENLRLAMSQIANIIGVGAMCI-----IYLPWFAIAIPFLLLIFL 1055

Query: 269  F--------GKQI-RMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLR 319
                     G+++ R+ + +   V  +L     E   G+ T++ + A+     RF     
Sbjct: 1056 LIADHYQSTGREVKRLEAIQRSFVYNNLN----EMLTGMDTIKAYNAQ----DRFATKSE 1107

Query: 320  EIFQVGKESAFINGKFFTSASLIGDL---GFLIVLTYGSYLVMHGSMSIGDLTAFMLYTE 376
             +     E+A+I+      A +  DL    F +++T    +     +S  D    + Y  
Sbjct: 1108 FLIDKMNEAAYISIAVQRWAGIFLDLVAVAFALIITLLC-VTRQFHISGADTGVLLTYVL 1166

Query: 377  YTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFK------PLNEVGGC 430
                 +  +    ++    + +  R+     + P+      EA+++      P++     
Sbjct: 1167 QLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ------EAQYRKPECSPPIDWPQNG 1220

Query: 431  EIEFKNVSFFY-PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489
             I F+N++F Y P  P   I KN N  +     + I G +G GKSTI + L       +G
Sbjct: 1221 HIVFENINFAYRPGLPI--ILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELTTG 1278

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN----------------ITYGLT 533
            +I+ID  DI+ L    LR K+ I+ Q+P+L  G IR N                +  G  
Sbjct: 1279 KIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAI 1338

Query: 534  EEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
            +    E ++   K     N        +                ++Q +A+ RAL+++  
Sbjct: 1339 DSQELETVKSQDKNSDAKNL-----HKFHLNQSVDEDGNNFSLGERQVLALTRALVRQSK 1393

Query: 594  ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVV 653
            ILILDEATS++D E++  I             TI+ IAHRL TI  ++ ++VL   G V 
Sbjct: 1394 ILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRILVL-EKGEVA 1450

Query: 654  EMGKFKELYDN 664
            E      L++N
Sbjct: 1451 EFDTPWNLFNN 1461

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 97/216 (44%), Gaps = 23/216 (10%)

Query: 449 IFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRR 508
           +  N+NF +P G  V + GP G GK+++   L      +SG++   G  +          
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGDLLLC-------- 675

Query: 509 KIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX 568
             GI    P + + TIRDNI +G   +P+    + V   C   + +   P  +D      
Sbjct: 676 --GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLP-AHD-KTEVG 725

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSMTI 627
                    QK RI++ARA+ K  +I + D+  SA+D       ++Y     +  K+  +
Sbjct: 726 ERGVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRIL 785

Query: 628 VSIAHRLSTIRRFEDVIVL--GNDGSVVEMGKFKEL 661
            +  H+LS + + + +IVL    D    E+G FKEL
Sbjct: 786 AT--HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 126/285 (44%), Gaps = 32/285 (11%)

Query: 398  AASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKV 457
            +  RI E  +  P+  +   E++  P        I F+N S  Y     + + K++  ++
Sbjct: 1264 SVERILEYCNLPPEADAIIEESR-PPKEWPSRGAITFQNYSTKY-RENLDPVLKDITVEI 1321

Query: 458  PAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEP 517
                 + IVG +G GKST++  L        G I+IDG DIA L    LR  + I+ Q+ 
Sbjct: 1322 KPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDA 1381

Query: 518  ILMSGTIRDNIT-YGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXX 576
                GTI+ N+  +G   + S EEI    +       I K     +              
Sbjct: 1382 QAFEGTIKSNLDPFG---QYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSH 1438

Query: 577  X----------------QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620
                             Q+Q + ++RAL+    IL+LDEAT+A+D+E++  I  T     
Sbjct: 1439 ELLSARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAF 1498

Query: 621  KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
            K +  TI++IAHR+ T+   + ++VL       + G+ KE +D P
Sbjct: 1499 KDR--TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDTP 1533

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 134/314 (42%), Gaps = 49/314 (15%)

Query: 358 VMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAA-SRIFEINDKEPKIKSTT 416
           ++   +SI  L  F+L  E        L  F+ E +     + S   EI +     KST 
Sbjct: 573 IIETGVSIKRLKDFLLAEE--------LDDFFIERLDANATSNSPAIEIYNATFLWKSTK 624

Query: 417 GEAKFKPLNE---VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGK 473
           G  + +  +E   V   ++  KN+                +F+   G   CIVG  G GK
Sbjct: 625 GLKEDENYDEEAAVASTKVALKNIR---------------HFEARKGDLTCIVGRVGSGK 669

Query: 474 STIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYG-- 531
           ST    +L     +SG   +D      L  ++  + I    Q+P +M+ +++DN+ +G  
Sbjct: 670 STFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWIMNASLKDNVIFGHR 724

Query: 532 LTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKK 591
           L E+  K  IR    +C     +   PD                  QK R+++ARA+  +
Sbjct: 725 LNEDYYKATIR----KCQLLPDLDILPD--GDQTLVGEKGISLSGGQKARLSLARAVYAR 778

Query: 592 PNILILDEATSALDVE-----SEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVL 646
            ++ +LD+  SA+D E      E  +N   G I+K+K  T++   + +S ++  +++  L
Sbjct: 779 ADVYLLDDILSAVDAEVSKNIVEQVLNRGTG-ILKNK--TVILTTNAVSVLKHSQNIYAL 835

Query: 647 GNDGSVVEMGKFKE 660
             DG +VE   + +
Sbjct: 836 L-DGEIVENKSYAD 848

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 122/533 (22%), Positives = 227/533 (42%), Gaps = 54/533 (10%)

Query: 152  LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSR 211
            L+GVG       F N   +V+L   S R   +L   + K++I   + FF+T  VG +++R
Sbjct: 1026 LIGVGS----AAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINR 1081

Query: 212  VGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTSVFG 270
              +D   V  S+ +  +   +S         L+   +       +F ++  I + T  F 
Sbjct: 1082 FSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQT--FY 1139

Query: 271  KQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLRE--------I 321
              +    K+L  ++   +  +  E  NG   +  +    +  +RF  +  E        +
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----DHFERFIYLNYEKIQYNIDFV 1195

Query: 322  FQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNA 381
            F     + +++ +  T  + I     ++ LT  +      S  +G L ++ L  E TG+ 
Sbjct: 1196 FNFRSTNRWLSVRLQTIGATIVLATAMLALTTMNTKKQLSSGMVGLLMSYSL--EVTGSL 1253

Query: 382  IFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFY 441
             + + +    +   + +  RI E  +   + +S   E +        G  IEFKN S  Y
Sbjct: 1254 TWIVRTTVM-IETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGS-IEFKNYSTKY 1311

Query: 442  PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATL 501
                 + + K++N ++     + IVG +G GKST++  L        G I+ID  +I+ L
Sbjct: 1312 -RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDL 1370

Query: 502  NTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP----SKEEIRLVAKQCFCHNFITKF 557
                LR  + I+ Q+     GT+R N+      +P    S+ E++           + K 
Sbjct: 1371 GLFDLRSHLAIIPQDAQAFEGTVRTNL------DPFNRYSEGELKKAVDLAHLGPHLEKM 1424

Query: 558  PDT----YDXXXXXXXXXXXXXXXQ------------KQRIAIARALIKKPNILILDEAT 601
             D      D               +            +Q + +ARAL+ +  IL+LDEAT
Sbjct: 1425 LDNEIRGADGAAEENGNVSDVLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDEAT 1484

Query: 602  SALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            +++D+E++  I  T  +  K +  TI++IAHR+ T+   + +IVL ++G+V E
Sbjct: 1485 ASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKE 1534

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 100/235 (42%), Gaps = 27/235 (11%)

Query: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
           +G  +I  KN+  F   R               G  VC+VG  G GKST    +L     
Sbjct: 647 IGSSQIALKNIDHFEAKR---------------GDLVCVVGRVGAGKSTFLKGILGQLPC 691

Query: 487 VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAK 546
           +SG     G     L  ++    +    QE  +M+ ++R+NI +G   +  K    L  K
Sbjct: 692 MSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFG--HKFDKAYYDLTIK 744

Query: 547 QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDV 606
            C     +   PD  +               QK R+++ARA+  + +I +LD+  SA+D 
Sbjct: 745 ACQLLPDLKILPDGDETLVGEKGISLSGG--QKARLSLARAVYSRADIYLLDDVLSAVDA 802

Query: 607 E-SEGAINYTF-GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFK 659
           E S+  + Y   G+    K+ TI+   + +  ++  + +  L N G ++E G ++
Sbjct: 803 EVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYALEN-GEIIEQGNYE 856

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 127/536 (23%), Positives = 236/536 (44%), Gaps = 55/536 (10%)

Query: 153  MGVGITLIFG----CFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDL 208
            M VG+  + G     F N   +++L   S R   +L   + K++I   + FF+T  VG +
Sbjct: 1019 MFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRI 1078

Query: 209  MSRVGNDAFVVSRSITHKVADGVRSXXXXXXXXXLM-LTLSRELTGALFAILPPIIWCTS 267
            ++R  +D   V  ++ +  +   +S         L+   +   L   +F ++  I + T 
Sbjct: 1079 INRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQT- 1137

Query: 268  VFGKQIRMNSKKLQDVT-GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLRE------ 320
             F   +    K+L  ++   +  +  E  NG   +  +    +  +RF  +  E      
Sbjct: 1138 -FYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----DHFERFIYLNYEKIQYNV 1192

Query: 321  --IFQVGKESAFINGKFFT-SASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEY 377
              +F     + +++ +  T  A+++     L + T  +   +   M +G L ++ L  E 
Sbjct: 1193 DFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGM-VGLLMSYSL--EV 1249

Query: 378  TGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNV 437
            TG+  + + +  + +   + +  RI E  +  P+ +S   E +    N      IEFKN 
Sbjct: 1250 TGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKR-PDENWPSKGGIEFKNY 1307

Query: 438  SFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQD 497
            S  Y     + +  N+N K+     V IVG +G GKST++  L        G+I+IDG D
Sbjct: 1308 STKY-RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGID 1366

Query: 498  IATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEP----SKEEIRLVAKQCFCHNF 553
            I+ +    LR  + I+ Q+     GT++ N+      +P    S++E++   +Q      
Sbjct: 1367 ISDIGLFDLRSHLAIIPQDAQAFEGTVKTNL------DPFNRYSEDELKRAVEQAHLKPH 1420

Query: 554  ITKF----PDTYDXX-----------XXXXXXXXXXXXXQKQRIAIARALIKKPNILILD 598
            + K     P   D                          Q+Q + +ARAL+ +  IL+LD
Sbjct: 1421 LEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLD 1480

Query: 599  EATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVE 654
            EAT+++D+E++  I  T  +  K +  TI++IAHR+ T+   + +IVL + GSV E
Sbjct: 1481 EATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVRE 1533

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 106/239 (44%), Gaps = 31/239 (12%)

Query: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486
           +G  +I  KN+  F   R               G  VC+VG  G GKST    +L     
Sbjct: 647 IGSSQIALKNIDHFEAKR---------------GDLVCVVGRVGAGKSTFLKAILGQLPC 691

Query: 487 VSGQILIDGQDIATLNTKSLRRK--IGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLV 544
           +SG      +D  ++  K + R   +    QE  +M+ ++R+NI +G   +  ++   L 
Sbjct: 692 MSG-----SRD--SIPPKLIIRSSSVAYCSQESWIMNASVRENILFG--HKFDQDYYDLT 742

Query: 545 AKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
            K C     +   PD                  QK R+++ARA+  + +I +LD+  SA+
Sbjct: 743 IKACQLLPDLKILPD--GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAV 800

Query: 605 DVE-SEGAINYTF-GQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
           D E S+  I Y   G+    K+ TI+   + +S ++  + +  L N G +VE G ++++
Sbjct: 801 DAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYEDV 858

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
            similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 75/148 (50%), Gaps = 19/148 (12%)

Query: 390  SELMQGVGAASRIFEINDKEPKIKSTTGEAKF--------KPLNEVGGCEIEFKNVSFFY 441
            ++L   + +A R+    +  PK      EA +        K   E G   I F NV+  Y
Sbjct: 1158 TQLENDMNSAERVLSYANSLPK------EAPYRIPEMAPPKAWPERGA--ITFDNVALAY 1209

Query: 442  -PTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500
             P  P   + ++++F + +G  + I G +G GKSTI + L       +G + IDG DIAT
Sbjct: 1210 RPGLPL--VLQDVSFHISSGEKIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIAT 1267

Query: 501  LNTKSLRRKIGIVQQEPILMSGTIRDNI 528
            +   +LR K+ I+ Q+P+L  GTIR N+
Sbjct: 1268 IGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 54/86 (62%), Gaps = 3/86 (3%)

Query: 578  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
            ++Q +A+ARAL+++  ILILDEATS++D E++  I     Q  + +  TI+ +AHRL TI
Sbjct: 1432 ERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQHATIMCVAHRLKTI 1489

Query: 638  RRFEDVIVLGNDGSVVEMGKFKELYD 663
              ++ ++V+   G V E      LY+
Sbjct: 1490 LHYDRILVM-EKGRVAEFDTPLRLYN 1514

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 92/215 (42%), Gaps = 26/215 (12%)

Query: 450 FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRK 509
           F +L+F+V  G  + I G  G GK+++ + L    +  +G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 510 IGIVQQEPILMSGTIRDNITYGLTEEPSKEEI-RLVAKQCFCHNFITKFPDTYDXXXXXX 568
             +    P + + TIRDNIT+G    P  E + R V + C     ++  P          
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPA--GDKTEVG 690

Query: 569 XXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQIMKSKSMT 626
                    QK RI +AR + K  +I + D+  SA+D     +I  +   G++      T
Sbjct: 691 ERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKT 747

Query: 627 IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKEL 661
            +   H++S   +   VI LG DGS  ++G   EL
Sbjct: 748 RILATHQISLTEQASRVIYLGTDGS-FDIGTVDEL 781

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 88/400 (22%), Positives = 165/400 (41%), Gaps = 37/400 (9%)

Query: 278 KKLQDVT----GDLTRVTEEQFNGIRTVQGFVAE-----RNEIKRFNNVLREIFQVGKES 328
           KKLQ +      + TR+  E  N I++++ +  E     + E  R    L+ + ++G   
Sbjct: 454 KKLQKIQMKNKDERTRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYV 513

Query: 329 AFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSF 388
           AF + +F     L+    F  V  +     +   +    LT F L +         ++SF
Sbjct: 514 AFTHFQFNIVPFLVSCSTF-AVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF 572

Query: 389 YSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEF-KNVSFFYPTRPTN 447
               ++   + +R+F     E   K      +   +   G   I+   + +F +  +P  
Sbjct: 573 ----IEASISINRLFSFLTNEELQKDAV--QRLPNVKNTGDVSIKLGDDATFLWKRKPEY 626

Query: 448 QI-FKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSL 506
           ++  KN+NF+   G   CIVG  G GKS +   +L     V G   + G           
Sbjct: 627 KVALKNINFQARKGELTCIVGKVGSGKSALIQSILGDLFRVKGFATVHGD---------- 676

Query: 507 RRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXX 566
              +  V Q P +M+GT+++NI +G   +  K+      K C     ++  PD       
Sbjct: 677 ---VAYVSQVPWIMNGTVKENILFG--HKFDKKFYEKTIKACALTIDLSILPD--GDSTL 729

Query: 567 XXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQIMKSKSM 625
                      QK R+++ARA+  + +  + D+  +A+D    +  I +  G      S 
Sbjct: 730 VGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSK 789

Query: 626 TIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNP 665
           T V   +++ T+    D I L ++G +++ GK++E+  +P
Sbjct: 790 TKVLATNKI-TVLNIADYITLLDNGEIIQRGKYEEVTSDP 828

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/361 (21%), Positives = 154/361 (42%), Gaps = 34/361 (9%)

Query: 184  LRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAF----VVSRSITHKVADGVRSXXXXXX 239
            L SQ++ +++   + FF+T  +G +++R  ND +    ++ R+ +   ++ V+       
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFT--- 1065

Query: 240  XXXLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNS----KKLQDVTGDLT-RVTEEQ 294
                ++ +       +F I+P  +    ++ +Q  M +    ++L  VT   T    +E 
Sbjct: 1066 ----LVVICVSTWQFIFFIVP--MSFLYIYYQQYYMRTSRELRRLDSVTRSPTISHFQET 1119

Query: 295  FNGIRTVQGFVAERNEI----KRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIV 350
              GI T++G+  E   I    +R +N +   +     S   N         +G +  L  
Sbjct: 1120 LGGISTIRGYSQENRFIHINQQRVDNNMSAYY----PSINCNRWLAFRLEFLGSVIILGA 1175

Query: 351  LTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEP 410
             T G Y +  G+M+ G +   + Y      ++  +     E+   + +  RI E ++   
Sbjct: 1176 STLGIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELAS 1235

Query: 411  KIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTR---PTNQIFKNLNFKVPAGSNVCIVG 467
            +  S   E K   +N      ++F +    Y TR     + + K++   +     + IVG
Sbjct: 1236 EAPSIV-EDKRPDVNWPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVG 1290

Query: 468  PSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDN 527
             +G GKS++   L     A  G I +DG +   +    LR K+ I+ Q+  +  GT+RDN
Sbjct: 1291 RTGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDN 1350

Query: 528  I 528
            I
Sbjct: 1351 I 1351

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 58/88 (65%), Gaps = 10/88 (11%)

Query: 578  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI 637
            Q+Q + +ARAL+   NIL+LDEAT+A+DVE++  I  T     K++  TI++IAHRL+TI
Sbjct: 1441 QRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAFKNR--TILTIAHRLNTI 1498

Query: 638  RRFEDVIVLGNDGSVVEMGKFKELYDNP 665
               + ++VL       + G+ KE +D+P
Sbjct: 1499 MDSDRILVL-------DKGEIKE-FDSP 1518

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 107/425 (25%), Positives = 186/425 (43%), Gaps = 52/425 (12%)

Query: 252 TGALFAILPPIIWCTSVFGK----QIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307
           T AL A++P   WC + +G     Q+ +  K+   ++        E  N IR ++    E
Sbjct: 484 TFALLAMIPLNFWCATFYGNYQADQLILTDKRTSGIS--------EALNSIRVIKLLAWE 535

Query: 308 RNEIKRFNNVLREIFQVGKESA---FINGK-FFTSASLIGDLGFLIVLTYGSYLVMHGSM 363
               ++  NV     ++ K+ A   F+N   +F   +L+  + F + + + +        
Sbjct: 536 NLFYQKIINVRDGEIRLLKKKATIFFLNHLIWFFGPTLVSAITFSVFIKFQN-------- 587

Query: 364 SIGDLTAFMLYTEYTGNAIF-----GLSSFYSELMQGVGAASRIFE-INDKEPKIKSTTG 417
               LT  + +T  +  AI       ++S  S L+Q   +  RI + +N+ E +      
Sbjct: 588 --QTLTPTIAFTALSLFAILRTPMDQIASTVSLLIQSFISLERIQDYLNESETR------ 639

Query: 418 EAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477
             K++ L E    +  F++ S  +    T+   KN++      S   I+GP+G GKS++ 
Sbjct: 640 --KYEIL-EQSNTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLL 696

Query: 478 SLLLHHYNAVSGQIL---IDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTE 534
             LL   N +SG+I    ++ +D   +    +   +    Q P L+SGTI+DN+ +G  E
Sbjct: 697 LGLLGELNLLSGKIYVPTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--E 754

Query: 535 EPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNI 594
             +K++   V K C     I     T                 Q+QRIA+ARA+      
Sbjct: 755 IFNKQKFDDVMKSCCLDKDIKAM--TAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRY 812

Query: 595 LILDEATSALDVESEGAI--NYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSV 652
           LILD+  SA+D E+   I      G +MK ++  I S  H +S + +  D +V+ + G V
Sbjct: 813 LILDDCLSAVDPETALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEV 870

Query: 653 VEMGK 657
              GK
Sbjct: 871 KSQGK 875

>KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C
          Length = 1372

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 143/324 (44%), Gaps = 45/324 (13%)

Query: 432  IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA--VSG 489
            I +KN++  Y      Q+  +++  + +G    ++G SG GK+T+ ++L     +  V+G
Sbjct: 729  ISWKNIN--YTVAGNKQLINDVSGYISSGL-TALMGESGAGKTTLLNVLSQRTESGVVTG 785

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMS-GTIRDN--ITYGLTEEPSKEEIRLVAK 546
            ++LIDGQ +  +N  + RR IG VQQ+ I +   T++++  I+  L  +  K+ I  V+K
Sbjct: 786  ELLIDGQPLTNIN--AFRRSIGFVQQQDIHLELLTVKESLEISCILRGDGDKDYILTVSK 843

Query: 547  QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALD 605
                   + K P                   QK+ ++I   L+ KP++L+ LDE TS LD
Sbjct: 844  -------LLKLP--------LDKIVADLTPTQKKLLSIGVELVTKPSLLLFLDEPTSGLD 888

Query: 606  VESEGAINYTFGQIMKSKSMTIVSIAHR--LSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
             E+   I   F + +  +   I    H+   S I  F+++ +L   G  V  G       
Sbjct: 889  SEAALTI-VQFLKKLSEQGQAIFCTIHQPSKSVISYFDNIFLLKRGGETVYFG------- 940

Query: 664  NPXXXXXXXXXXXXXXXXATPQPVNPPPFI-------DLQTNPEEKKEADNASEENGAKL 716
             P                  P+  NP  FI       +  T+ +E  EA    E   A++
Sbjct: 941  -PTSDACDYFMKYNPSLTFNPEAENPADFIIDVVGSNNTGTDSDEIAEAKPTVETKWAEV 999

Query: 717  -DDSKEDVSVPDNMTSSDDSLKEA 739
               S+E  S+ +++   ++  + A
Sbjct: 1000 WSRSQERASIENDLLDLENEARGA 1023

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 100/222 (45%), Gaps = 14/222 (6%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH--HYNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+  +L +      V+G I +DG     L  
Sbjct: 857  TRRILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGH----LRD 912

Query: 504  KSLRRKIGIVQQEPIL-MSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
             S +RK G  QQ+ +   + T+RD + +     +P  + I    K  +  + I       
Sbjct: 913  TSFQRKTGYCQQQDLHGRTQTVRDALKFSAYLRQP--QSISRAEKNAYVEDIIKLLGMEA 970

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     +++
Sbjct: 971  YADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLV 1030

Query: 621  KSKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
                  + +I H+ S I  + F+ +++L N G  V  G   E
Sbjct: 1031 NHGQAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 54/84 (64%), Gaps = 10/84 (11%)

Query: 582 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFE 641
           I +ARAL++   IL++DEAT+++D E++  +  T     + + +TIV+IAHRL TI  ++
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 642 DVIVLGNDGSVVEMGKFKELYDNP 665
            ++VL + G V+E       YD+P
Sbjct: 60  KILVL-DAGQVIE-------YDHP 75

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 117/264 (44%), Gaps = 25/264 (9%)

Query: 405  INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRP-TNQIFKNLNFKVPAGSNV 463
            I D E   +S+T  A+      V      ++N+ +  P +  T ++  N++  V  G+  
Sbjct: 828  IKDSESTDESSTNGARLLKSQAV----FHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLT 883

Query: 464  CIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPI-LM 520
             ++G SG GK+T+   L        ++G +L+DG+       +S  R IG  QQ+ + L 
Sbjct: 884  ALMGASGAGKTTLLDCLAERVTMGVITGDVLVDGRP----RDESFPRSIGYCQQQDLHLK 939

Query: 521  SGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
            + T+R+++ +     +P+  E+ +  K  +    I                       Q+
Sbjct: 940  TSTVRESLRFSAYLRQPA--EVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQR 997

Query: 580  QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK---SKSMTIVSIAHRLS 635
            +R+ I   L  KP +L+ LDE TS LD ++  +I     Q+M+   S    I+   H+ S
Sbjct: 998  KRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPS 1053

Query: 636  TI--RRFEDVIVLGNDGSVVEMGK 657
             I  + F+ ++ L + G     G+
Sbjct: 1054 AILMQEFDRLLFLQDGGQTTYFGE 1077

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 101/225 (44%), Gaps = 20/225 (8%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G +L+DG+       
Sbjct: 868  TRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDVLVDGRP----RD 923

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            +S  R IG  QQ+ + L + T+R+++ +     +P+  E+ +  K  +    I       
Sbjct: 924  ESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPA--EVSVEEKDAYVEEVIKILEMEK 981

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L  KP +L+ LDE TS LD ++  +I     Q+M
Sbjct: 982  YADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQLM 1037

Query: 621  K---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
            +   S    I+   H+ S I  + F+ ++ L   G  V  G+  E
Sbjct: 1038 RKLASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGELGE 1082

>CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] {ON}
            highly similar to uniprot|Q08409 Saccharomyces cerevisiae
            YOR011w AUS1 or uniprot|P40550 Saccharomyces cerevisiae
            YIL013c PDR11
          Length = 1398

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 128/288 (44%), Gaps = 38/288 (13%)

Query: 432  IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA--VSG 489
            I +KN++  Y      ++  N++  + +G    ++G SG GK+T+ ++L     +  VSG
Sbjct: 755  ISWKNIN--YTVGGDKRLINNVSGYIGSGLTA-LMGESGAGKTTLLNVLSQRTESGVVSG 811

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMS-GTIRDN--ITYGLTEEPSKEEIRLVAK 546
            +ILIDG+ +   N  + RR IG VQQ+ I +   T++++  I+  L  +   E +  +++
Sbjct: 812  EILIDGKPLT--NENAFRRSIGFVQQQDIHLELLTVKESLEISSELRGDGDMEYVESISE 869

Query: 547  QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALD 605
                   + K P                   Q++ ++I   L+ KP++L+ LDE TS LD
Sbjct: 870  -------LLKLP--------LDSLVRELNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLD 914

Query: 606  VESEGAINYTFGQIMKSKSMTIVSIAHR--LSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
             E+   I   F + +  +   I    H+   S I  F+++ +L   G  V  G       
Sbjct: 915  AEAALTI-VQFLKKLSLQGQAIFCTIHQPSKSVISYFDNIYLLKRGGECVYFG------- 966

Query: 664  NPXXXXXXXXXXXXXXXXATPQPVNPPPF-IDLQTNPEEKKEADNASE 710
             P                  P+  NP  F ID+  N E  +E D+ ++
Sbjct: 967  -PTSEACGYFMSYDKSLTYDPESDNPADFVIDVVGNNESMEEMDDKAD 1013

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 102/227 (44%), Gaps = 20/227 (8%)

Query: 444  RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATL 501
            + T +I  N++  V  G+   ++G SG GK+T+   L        ++G + IDG+     
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDGKP---- 1019

Query: 502  NTKSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
              +S  R IG  QQ+ + L + T+R+++ +     +P+  E+ +  K  +  + I     
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEM 1077

Query: 560  TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQ 618
                              Q++R+ I   L  KP +L+ LDE TS LD ++  AI     Q
Sbjct: 1078 EKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQ 1133

Query: 619  IMK---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
            +M+   ++   I+   H+ S I  + F+ ++ +   G     G+  E
Sbjct: 1134 LMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 101/225 (44%), Gaps = 20/225 (8%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G + IDG+       
Sbjct: 908  TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDGKP----RD 963

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            +S  R IG  QQ+ + L + T+R+++ +     +P+  E+ +  K  +  + I       
Sbjct: 964  ESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEMEK 1021

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L  KP +L+ LDE TS LD ++  AI     Q+M
Sbjct: 1022 YADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQLM 1077

Query: 621  K---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
            +   ++   I+   H+ S I  + F+ ++ +   G     G+  E
Sbjct: 1078 RKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/377 (21%), Positives = 149/377 (39%), Gaps = 73/377 (19%)

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIG 366
           +KRF+   R +  V     F+NG      ++I D+    ++ YG    SY+     +   
Sbjct: 379 LKRFD---RTLVLVSHSQDFLNG---VCTNMI-DMRMQKLMQYGGNYDSYIKTRTELETN 431

Query: 367 DLTAFMLYTEYTGN--AIFGLSSFYSELMQGVGAASRIFEINDK----EPKIKSTTGEAK 420
            +  +    E   +       +  Y+ L++   +  +I +  +     +P +       +
Sbjct: 432 QMKQYNKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQPVVPDRVFSFR 491

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
           F P+  +    + F ++SF Y   P N ++++LNF V   S   +VGP+G GKST+  ++
Sbjct: 492 FPPVERLPPPVLAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIM 551

Query: 481 L-----------HHYNAVSGQILIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRD 526
                        H +   G      QD   L   +L   R K   + Q+     G +  
Sbjct: 552 TGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG- 610

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
              YGLT +  K ++  +++                               Q+ R+  A 
Sbjct: 611 --RYGLTGDAQKVQMGTLSE------------------------------GQRSRVVFAL 638

Query: 587 ALIKKPNILILDEATSALDVES----EGAIN-YTFGQIMKSKSMTIVS-IAHRLSTIRRF 640
             ++ PN+L+LDE T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   
Sbjct: 639 LALENPNVLLLDEPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAKDIFVV--- 695

Query: 641 EDVIVLGNDGSVVEMGK 657
           ED      DGS+++  K
Sbjct: 696 EDKTATRWDGSILDYKK 712

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K    T+V ++H
Sbjct: 342 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 391

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 103/244 (42%), Gaps = 58/244 (23%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL---------- 481
           + F  +SF Y   P + +++NLNF V   S + +VGP+G GKST+  ++           
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 482 -HHYNAVSGQILIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
             H +   G      QD   L   +L   R K   + Q+     G +     YGLT +  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDGQ 509

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
           K ++  +++                               Q+ R+  A   ++ PNIL+L
Sbjct: 510 KAQMGTLSE------------------------------GQRSRVVFALLALQAPNILLL 539

Query: 598 DEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIVLGN------DG 650
           DE T+ LD+ +  ++     + + + +  +V ++H    + +  +D+ V+ N      DG
Sbjct: 540 DEPTNGLDIPTIDSL----AEAINTFNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDG 595

Query: 651 SVVE 654
           S++E
Sbjct: 596 SILE 599

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 24/30 (80%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVES 608
           K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 96/221 (43%), Gaps = 12/221 (5%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG        
Sbjct: 884  TRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLP----RN 939

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
            +S  R IG  QQ+ + L + T+R+++ +       K E+ +  K  +    I        
Sbjct: 940  ESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPK-EVSVEEKNAYVEEIIKILEMEKY 998

Query: 563  XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK 621
                           Q++R+ I   L  KP +L+ LDE TS LD ++  AI     ++ K
Sbjct: 999  ADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKKLCK 1058

Query: 622  SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
                 + +I H+ S I  + F+ ++ +   G  V  G+  E
Sbjct: 1059 HGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1518

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 112/236 (47%), Gaps = 17/236 (7%)

Query: 434  FKNVSFFYPTRPTNQ-IFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYN--AVSGQ 490
            +KN+ +  P +   + +  N+   V  G+   ++G SG GK+T+ + L    N   V+G 
Sbjct: 874  WKNICYVIPYKGGERTLLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRVNVGVVTGD 933

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNITYG--LTEEPSKEEIRLVAKQ 547
            +LI+G+ + +    S  R+ G VQQ+ I ++  T+R+++ +   L    S  +   VA  
Sbjct: 934  MLINGKPVDS----SFERRTGYVQQQDIHIAEMTVRESLIFSARLRRPQSIPDAEKVADA 989

Query: 548  CFCHNFITKFPDTYDXXXXXX-XXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALD 605
                  + K  D  +                Q+++++I   L+ KP++L+ LDE TS LD
Sbjct: 990  ----ETVMKLLDMEEYADALVGGLGAGLNVEQRKKLSIGVELVSKPDLLLFLDEPTSGLD 1045

Query: 606  VESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMGKFKE 660
             +S  AI     +I ++    + +I    +T+  +F+ +++L   G  V  G   E
Sbjct: 1046 SQSSWAIVQLLKRISRAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1101

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 127/320 (39%), Gaps = 64/320 (20%)

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIG 366
           +KRF+   R +  V     F+NG      ++I D+    +  YG    SY+     +   
Sbjct: 267 LKRFD---RTLVLVSHSQDFLNG---VCTNMI-DMRLQQLTAYGGNYDSYVKTRSELETN 319

Query: 367 DLTAFMLYTEYTGN--AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEA----K 420
            +  +    E   +       +  Y+ L++   +  +I +  + +  +++   +     +
Sbjct: 320 QMKQYSKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLVQAVVADKVFSFR 379

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
           F P+  +    + F ++SF Y   P N +++ LNF V   S + +VGP+G GKST+  ++
Sbjct: 380 FPPVERLPPPVLAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIM 439

Query: 481 LHHYNAVSGQI--------------LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526
                  SG++                D  D+     + +R K   + Q+     G +  
Sbjct: 440 TGQLMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYPNISQDFQYWRGQLG- 498

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
              YGLT E    ++  +++                               Q+ R+  A 
Sbjct: 499 --RYGLTGEAQTSQMGTLSE------------------------------GQRSRVVFAL 526

Query: 587 ALIKKPNILILDEATSALDV 606
             +++PN+L+LDE T+ LD+
Sbjct: 527 LALEQPNVLLLDEPTNGLDI 546

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {ON}
           YIL013C (REAL)
          Length = 1409

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 126/271 (46%), Gaps = 36/271 (13%)

Query: 404 EINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNV 463
           + N K P  ++    AK     E     I +KN+++   T    ++  + +  + +G   
Sbjct: 723 DYNIKHPDDENVNNHAKESVAMETHKHVISWKNINY---TIGDKKLISDASGYISSGLTA 779

Query: 464 CIVGPSGRGKSTIASLLLHHYNA--VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMS 521
            ++G SG GK+T+ ++L     +  V+G++LIDG+ +  ++  + RR IG VQQ+ + + 
Sbjct: 780 -LMGESGAGKTTLLNVLSQRTESGVVTGELLIDGRPLTDID--AFRRSIGFVQQQDVHLE 836

Query: 522 -GTIRDN--ITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQ 578
             T++++  I+  L  +  KE + +V+        + K P                   Q
Sbjct: 837 LLTVKESLEISCVLRGDGDKEYLGVVSN-------LLKLPS--------GKLVTDLSPTQ 881

Query: 579 KQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSM---TIVSIAHR- 633
           ++ ++I   L+ KP++L+ LDE TS LD E+      T  Q +K  SM    I+   H+ 
Sbjct: 882 RKLLSIGVELVTKPSLLLFLDEPTSGLDAEAA----LTIVQFLKKLSMQGQAILCTIHQP 937

Query: 634 -LSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
             S I  F+++ +L   G  V  G   +  D
Sbjct: 938 SKSVISYFDNIYLLKRGGECVYFGSLTDACD 968

>Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {ON}
           complement(62452..64284) [1833 nt, 611 aa]
          Length = 610

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/320 (20%), Positives = 129/320 (40%), Gaps = 64/320 (20%)

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIG 366
           +KRF+   R +  V     F+NG     +++I D+    +  YG    SY+     +   
Sbjct: 269 LKRFD---RTLVLVSHSQDFLNG---VCSNMI-DMRLQKLTAYGGNYDSYVKTRSELETN 321

Query: 367 DLTAFMLYTEYTGN--AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEA----K 420
            +  +    E   +       +  Y+ L++   +  +I +  + +  I++   +     +
Sbjct: 322 QMKQYSKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQAVVPDRVFSFR 381

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
           F P+  +    + F ++SF Y     N +++NLNF V   S + +VGP+G GKST+  ++
Sbjct: 382 FPPVERLPPPVLSFDDISFAYDGNKENNLYQNLNFGVDMDSRIALVGPNGVGKSTLLKIM 441

Query: 481 LHHYNAVSGQI-----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRD 526
                A +G++               QD   L   +L   R K   + Q+     G +  
Sbjct: 442 TGELQAQAGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLG- 500

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
              YGLT E    ++  +++                               Q+ R+  A 
Sbjct: 501 --RYGLTGEGQTVQMGTLSE------------------------------GQRSRVVFAL 528

Query: 587 ALIKKPNILILDEATSALDV 606
             +++PN+L+LDE T+ LD+
Sbjct: 529 LALEQPNVLLLDEPTNGLDI 548

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 19/175 (10%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F ++SF Y + P+  +++NLNF V   S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 492 LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCH 551
                      ++    K+G+  Q         +  + +   + PS  +     +     
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLGR 501

Query: 552 NFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDV 606
             +T    T                 Q+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 502 YGLTGEGQT--------VQMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 101/246 (41%), Gaps = 66/246 (26%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F ++SF Y  +P N ++ +LNF V   S + +VGP+G GKST+  ++     A SG++
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 492 -----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
                          QD   L   +L   R K   + Q+     G +     YGLT E  
Sbjct: 453 SRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRGQLG---RYGLTGEAQ 509

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
             ++  +++                               Q+ R+  A   ++ PN+L+L
Sbjct: 510 TVQMGTLSE------------------------------GQRSRVVFALLALEAPNVLLL 539

Query: 598 DEATSALDVES----EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIVLGN---- 648
           DE T+ LD+ +      AIN   G         +V ++H    + R  +D+ V+ N    
Sbjct: 540 DEPTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDRIAKDIFVVENQTAT 591

Query: 649 --DGSV 652
             DGS+
Sbjct: 592 RWDGSI 597

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 78/189 (41%), Gaps = 47/189 (24%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL---------- 481
           + F  +SF Y  +P N +++NLNF V   S V +VGP+G GKST+  ++           
Sbjct: 392 LAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV 451

Query: 482 -HHYNAVSGQILIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
             H +   G      QD   L   +L   R K G + ++     G +     YGLT E  
Sbjct: 452 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYGHISEDFQYWRGQLG---RYGLTGEGQ 508

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
             ++  +++                               Q+ R+  A   + +PN+L+L
Sbjct: 509 TVQMGTLSE------------------------------GQRSRVVFALLALDQPNVLLL 538

Query: 598 DEATSALDV 606
           DE T+ LD+
Sbjct: 539 DEPTNGLDI 547

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 231 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 112/236 (47%), Gaps = 17/236 (7%)

Query: 434  FKNVSFFYPTRPTNQIF-KNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA--VSGQ 490
            +++V +  P + T +I   N+   V  G+   ++G SG GK+T+ + L    N   V+G 
Sbjct: 871  WQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVGIVTGD 930

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNITYG--LTEEPSKEEIRLVAKQ 547
            + I+G+ + +    S  R+ G VQQ+ I ++  T+R+++ +   L    S  +   VA  
Sbjct: 931  MSINGKPVDS----SFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAEKVADA 986

Query: 548  CFCHNFITKFPDTYDX-XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALD 605
                  + K  D  +                Q+++++I   L+ KP++L+ LDE TS LD
Sbjct: 987  ----ETVMKLLDMEEYGDALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLD 1042

Query: 606  VESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMGKFKE 660
             +S  AI     +I K+    + +I    +T+  +F+ +++L   G  V  G   E
Sbjct: 1043 SQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1098

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 101/221 (45%), Gaps = 20/221 (9%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYN--AVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G +G GK+T+   L        ++G I +DG+    L  
Sbjct: 834  TRRILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLTGSIFVDGK----LRD 889

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            +S  R IG  QQ+ + L + T+R+++ +  +  +P  + +    K+ +    I       
Sbjct: 890  ESFARSIGYCQQQDLHLTTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVINVLEMEP 947

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L  KPN+L+ LDE TS LD ++  +I     Q+M
Sbjct: 948  YADAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGLDSQTAWSI----CQLM 1003

Query: 621  K---SKSMTIVSIAHRLST--IRRFEDVIVLGNDGSVVEMG 656
            K   ++   I+   H+ S   I+ F+ ++ L   G  V  G
Sbjct: 1004 KKLANRGQAILCTIHQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

>NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {ON}
           
          Length = 1400

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 114/237 (48%), Gaps = 29/237 (12%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA--VSG 489
           I ++N++  Y      Q+  + +  + +G    ++G SG GK+T+ ++L     +  V+G
Sbjct: 747 ISWRNIN--YTVEGDKQLINDCSGFISSGLTA-LMGESGAGKTTLLNVLSQRVTSGEVTG 803

Query: 490 QILIDGQDIATLNTKSLRRKIGIVQQEPILMS-GTIRDN--ITYGLTEEPSKEEIRLVAK 546
           ++LIDGQ +   N  + RR IG VQQ+ + +   T++++  I+  L  +  ++ +  VAK
Sbjct: 804 ELLIDGQPLT--NIAAFRRSIGFVQQQDVHLDLLTVKESLEISCILRGDGDRDYLGTVAK 861

Query: 547 QCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALD 605
                  + K P                   +K+ ++I   L+ KP++L+ LDE TS LD
Sbjct: 862 -------LLKLP--------ANTLVADLTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLD 906

Query: 606 VESEGAINYTFGQIMKSKSMTIVSIAHR--LSTIRRFEDVIVLGNDGSVVEMGKFKE 660
            E+   I   F + +  +   I+   H+   S I+ F+++ +L   G  V  G   +
Sbjct: 907 AEAALTI-VQFLKKLSLQGQAILCTIHQPSKSVIKYFDNIYLLKRGGECVYFGHIDD 962

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 77/375 (20%), Positives = 150/375 (40%), Gaps = 75/375 (20%)

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIG 366
           +KRF+   R +  V     F+NG      ++I D+    ++ YG    SY+         
Sbjct: 266 LKRFD---RTLVLVSHSQDFLNG---VCTNMI-DMRLQKLIAYGGNFDSYVKTRTEQETN 318

Query: 367 DLTAFMLYTEYTGN--AIFGLSSFYSELMQGVGAASRIFEINDK----EPKIKSTTGEAK 420
            +  +    E   +       +  Y+ L++   +  +I +  +     EP +       +
Sbjct: 319 QMKQYAKQQEEIAHIKKFIASAGTYANLVRQAKSRQKILDKMEADGLIEPVVPDKVFSFR 378

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
           F  +  +    + F ++SF Y  +  N ++++LNF V   S V +VGP+G GKST+  ++
Sbjct: 379 FPEVERLPPPVLAFDDISFAYDGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIM 438

Query: 481 LHHYNAVSGQI-----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRD 526
               +A SG++               Q+   LN   L   R K   + Q+     G +  
Sbjct: 439 TGELSAQSGRVSRHTHVKLGVYSQHSQEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLG- 497

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
              YGLT E    ++  +++                               Q+ R+  A 
Sbjct: 498 --RYGLTGEGQTSQMGTLSE------------------------------GQRSRVVFAL 525

Query: 587 ALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIV 645
             ++ PN+L+LDE T+ LD+    A   +  + +   +  +V ++H    + +  +D+ V
Sbjct: 526 LALQAPNVLLLDEPTNGLDI----ATIDSLAEAINDFNGGVVVVSHDFRLLDKIAKDIFV 581

Query: 646 LGN------DGSVVE 654
           + N      DGS+++
Sbjct: 582 VENKTATRWDGSILD 596

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 109/231 (47%), Gaps = 14/231 (6%)

Query: 434  FKNVSFFYPTRPTN---QIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSG 489
            ++NVSF    R +N   ++  N++     G+   ++G SG GK+T+ + L   +   V+G
Sbjct: 777  WRNVSF--TIRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTVTG 834

Query: 490  QILIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNITYGLTEEPSKEEIRLVAKQC 548
             IL+DG  +      S  R+ G VQQ+ +  +  T+R+++ +        + I  V K  
Sbjct: 835  DILVDGLPM----DASFERRTGYVQQQDLHTAELTVRESLQFS-ARMRRPQSIPDVEKME 889

Query: 549  FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVE 607
            +    I                       Q+++++I   L+ KP++L+ LDE TS LD +
Sbjct: 890  YVEKIIDILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQ 949

Query: 608  SEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMGK 657
            S  +I     ++ ++    + +I    +T+  +FE +++LG  G  V  G+
Sbjct: 950  SAWSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQTVYFGE 1000

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 101/221 (45%), Gaps = 14/221 (6%)

Query: 444  RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYN--AVSGQILIDGQDIATL 501
            R + +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG+    L
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDGK----L 921

Query: 502  NTKSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
              +S  R IG  QQ+ + L + T+R+++ +  +  +P  + +    K+ +    I     
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVINVLEM 979

Query: 560  TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQ 618
                              Q++R+ I   L+ KP +LI LDE TS LD ++  +I     +
Sbjct: 980  EPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLIRK 1039

Query: 619  IMKSKSMTIVSIAHRLST--IRRFEDVIVLGNDGSVVEMGK 657
             + ++   I+   H+ S   I+ F+ ++ L   G  V  G+
Sbjct: 1040 -LANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 104/248 (41%), Gaps = 66/248 (26%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F ++SF Y + P+  ++++LNF V   S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 492 -----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
                          QD   L   +L   R K   + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQ 509

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
             ++  +++                               Q+ R+  A   +++PN+L+L
Sbjct: 510 TVQMATLSE------------------------------GQRSRVVFALLALEQPNVLLL 539

Query: 598 DEATSALDVES----EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIVLGN---- 648
           DE T+ LD+ +      AIN   G         +V ++H    + +  +D+ V+ N    
Sbjct: 540 DEPTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVENKTAT 591

Query: 649 --DGSVVE 654
             DGS+++
Sbjct: 592 RWDGSILQ 599

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR153W
            (REAL)
          Length = 1510

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 98/225 (43%), Gaps = 20/225 (8%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG        
Sbjct: 883  TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDIFVDG----IPRD 938

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            KS  R IG  QQ+ + L + T+R+++ +     +P+  E+ +  K  +    I       
Sbjct: 939  KSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIEEKDRYVEEVIKILEMEK 996

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L  KP +L+ LDE TS LD ++  +I     Q+M
Sbjct: 997  YADAVVGIAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSI----CQLM 1052

Query: 621  K---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
            K   +    I+   H+ S I  + F+ ++ +   G  V  G   E
Sbjct: 1053 KKLANHGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYFGDLGE 1097

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 98/225 (43%), Gaps = 15/225 (6%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG    T   
Sbjct: 883  TRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLPRDT--- 939

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562
             S  R IG  QQ+ + L + T+R+++ +   E     ++ +  K  +    I        
Sbjct: 940  -SFPRSIGYCQQQDLHLTTATVRESLRFS-AELRQPADVSVSEKHAYVEEVIKILEMEKY 997

Query: 563  XXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK 621
                           Q++R+ I   L  KP +L+ LDE TS LD ++  +I     ++ K
Sbjct: 998  ADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLAK 1057

Query: 622  SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKELYDN 664
                 + +I H+ S I  + F+ ++ L   G  V  G   EL DN
Sbjct: 1058 FGQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFG---ELGDN 1098

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 106/242 (43%), Gaps = 54/242 (22%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F ++SF Y  +P N ++++LNF V   S V +VGP+G GKST+  ++       SG++
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 492 LIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQC--F 549
                      ++    K+G+  Q         +D +   LT+ P    +  V  +    
Sbjct: 450 -----------SRHTHVKLGVYSQHS-------QDQLD--LTKSP----LEFVRDKYSHI 485

Query: 550 CHNF------ITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSA 603
            H+F      + ++  T +               Q+ R+  A   ++ PN+L+LDE T+ 
Sbjct: 486 SHDFQYWRGQLGRYGLTGE---GQTSQMATLSEGQRSRVVFALLALQAPNVLLLDEPTNG 542

Query: 604 LDVES----EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIVLGN------DGSV 652
           LD+ +      AIN   G         +V ++H    + +  +D+ V+ N      DGS+
Sbjct: 543 LDIATIDSLADAINEFNG--------GVVVVSHDFRLLDKIAKDIFVVENKTATRWDGSI 594

Query: 653 VE 654
           ++
Sbjct: 595 LD 596

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 118/283 (41%), Gaps = 54/283 (19%)

Query: 408 KEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP-TRPTN--QIFKNLNFKVP------ 458
           K+ +I+  T   +    N   G  +E  NV    P TR  N  ++ K L F+VP      
Sbjct: 561 KQKRIEKATEVVQGTVQNNFNGVRLE--NVDIVIPSTRAKNGTKLIKKLTFQVPPSIDPL 618

Query: 459 ------------------------AGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILID 494
                                   AGS++ I+GP+G GKS+I  ++   +   +   L+ 
Sbjct: 619 SSRADSVQDFNEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLL- 677

Query: 495 GQDIATLNTKSLRRKIGIVQQEPILM-SGTIRDNITYGLTEEPS-----KEEIRLVAKQC 548
                   +K     +  V Q+P     GT+RD I Y ++ +       K+++ +   + 
Sbjct: 678 --------SKPTEANLLCVPQKPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLRE 729

Query: 549 FCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVES 608
              +++ K    +                +KQR+  AR +  KP  ++LDEAT+A+  + 
Sbjct: 730 VKLDYLLKRDKGWSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADM 789

Query: 609 EGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGS 651
           E   +Y F  ++K      ++I+ R S I+  + ++ + +D S
Sbjct: 790 E---DYLFN-VLKRYRFNFITISQRPSLIKYHDLLLEISDDNS 828

>NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {ON} 
          Length = 1565

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 123/271 (45%), Gaps = 27/271 (9%)

Query: 406  NDKEPKIK------STTGEAKFKPLNEVGGCEIEFKNVSFFYP-TRPTNQIFKNLNFKVP 458
            ND E K K      ST  E  F+ L   G     +K V +  P  R    +  +++    
Sbjct: 882  NDTEIKDKFTSTTISTDEEGAFEELESKG--VFLWKEVCYTIPYERGKRMLLDHVSGYCV 939

Query: 459  AGSNVCIVGPSGRGKSTIASLLL--HHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQE 516
             G+   ++G SG GK+T+ + L   +    V+G +L++G+ +      S  R+ G VQQ+
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGDMLVNGRPV----DASFERRTGYVQQQ 995

Query: 517  PILMSG-TIRDNITYGL----TEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXX 571
             I ++  T+R+++ +      +E  S EE     ++      + +F D            
Sbjct: 996  DIHIAELTVRESLQFSARMRRSEHVSDEEKLAYVEKIIRVLEMEEFADA-----LVGAIG 1050

Query: 572  XXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSI 630
                  Q+++++I   L+ KP++L+ LDE TS LD +S  AI     ++ ++    + +I
Sbjct: 1051 CGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLAQAGQSILCTI 1110

Query: 631  AHRLSTI-RRFEDVIVLGNDGSVVEMGKFKE 660
                +T+  +F+ +++L   G  V  G   E
Sbjct: 1111 HQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1141

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 108/234 (46%), Gaps = 22/234 (9%)

Query: 434  FKNVSFFYPTR-PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQI 491
            +K V+F  P +  T ++  N++     GS   ++G SG GK+T+ + L   +   ++G +
Sbjct: 847  WKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGIITGDM 906

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPI-LMSGTIRDNITYGLTEE-----PSKEEIRLVA 545
            L++G+ I      S  R+ G VQQ+ + +   T+R++  +          P  E++  V 
Sbjct: 907  LVNGKPI----DASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKLAYVE 962

Query: 546  KQCFCHNFITKFPDTYDXXXXXX-XXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSA 603
            K       I +  D  D                Q+++++I   L  KP++L+ LDE TS 
Sbjct: 963  K-------IIEILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSG 1015

Query: 604  LDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMG 656
            LD +S  AI     ++ ++    + +I    +T+   F+ +++L   G  V  G
Sbjct: 1016 LDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1069

>YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter actively regulated by Pdr1p; also
            involved in steroid transport, cation resistance, and
            cellular detoxification during exponential growth
          Length = 1511

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 99/225 (44%), Gaps = 20/225 (8%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G IL++G        
Sbjct: 884  TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILVNG----IPRD 939

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            KS  R IG  QQ+ + L + T+R+++ +     +P+  E+ +  K  +    I       
Sbjct: 940  KSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIEEKNRYVEEVIKILEMEK 997

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L  KP +L+ LDE TS LD ++  +I     Q+M
Sbjct: 998  YADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSI----CQLM 1053

Query: 621  K---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
            K   +    I+   H+ S I  + F+ ++ +   G  V  G   E
Sbjct: 1054 KKLANHGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYFGDLGE 1098

>Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {ON}
            YIL013C (REAL)
          Length = 1413

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 127/311 (40%), Gaps = 64/311 (20%)

Query: 465  IVGPSGRGKSTIASLLLHHYNA--VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMS- 521
            ++G SG GK+T+ ++L        V+G++LIDGQ +   N  + RR IG VQQ+ + +  
Sbjct: 781  LMGESGAGKTTLLNILSQRTEGGVVTGELLIDGQPLT--NIDAFRRSIGFVQQQDVHLEL 838

Query: 522  GTIRDN--ITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
             T++++  I+  L  +  +E +  V         + + P                   ++
Sbjct: 839  LTVKESLEISCVLRGDSDREYLGTVTN-------LLRLPS--------EKLVADLSPTER 883

Query: 580  QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSM---TIVSIAHR-- 633
            + ++I   L+ KP++L+ LDE TS LD E+      T  Q +K  SM    I+   H+  
Sbjct: 884  KLLSIGVELVTKPSLLLFLDEPTSGLDAEAA----LTIVQFLKKLSMQGQAILCTIHQPS 939

Query: 634  LSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXXXXXXXATPQPVNPPPFI 693
             S I  F++V +L   G  V  G   +  D                     +  NP  F+
Sbjct: 940  KSVISYFDNVYLLKRGGECVYFGSLTDACD--------YFVAHDKSLVFDSEADNPADFV 991

Query: 694  ---------DLQTNPEEKKEADNASEENGAK------------LDDSKEDVSVPDNMTSS 732
                     + +TN EEK  +    ++   +               S E V + DN+   
Sbjct: 992  IDVVGSGNTNTETNAEEKSTSGRFDQQTSHRRQSDYSINWANIWQSSPEKVKIADNLLIL 1051

Query: 733  DDSLKEAVNEG 743
            +   KEA N G
Sbjct: 1052 E---KEARNSG 1059

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 104/244 (42%), Gaps = 58/244 (23%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F N+SF Y   P + +++NL+F V   S + +VGP+G GKST+  ++     A +G++
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMAQAGRV 450

Query: 492 -----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
                          QD   L   +L   R K   + Q+     G +     YGLT E  
Sbjct: 451 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSSISQDFQYWRGQLG---RYGLTGESQ 507

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
             ++  +++                               Q+ R+  A   +++PN+L+L
Sbjct: 508 TVQMGTLSE------------------------------GQRSRVVFALLALEQPNVLLL 537

Query: 598 DEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIVLGN------DG 650
           DE T+ LD+ +  ++     +     +  +V ++H    + +  +D+ V+ N      +G
Sbjct: 538 DEPTNGLDIPTIDSLAEAINEF----NGGVVVVSHDFRLLDKIAKDIFVVENKTATRWEG 593

Query: 651 SVVE 654
           S++E
Sbjct: 594 SILE 597

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {ON} 
          Length = 1502

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 118/259 (45%), Gaps = 25/259 (9%)

Query: 414  STTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTN-QIFKNLNFKVPAGSNVCIVGPSGRG 472
            S  GEA F+ L   G     +K + +  P   T  ++  N++     G+   ++G SG G
Sbjct: 832  SAEGEAVFEGLESRG--VFIWKEILYTIPYEGTQRKLLDNISGYCIPGTMTALIGESGAG 889

Query: 473  KSTIASLLLH--HYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNIT 529
            K+T+ + L        V+G IL++G+ I +    S  R+ G VQQ+ I ++  ++R+++ 
Sbjct: 890  KTTLLNTLAQRNEIGVVTGDILVNGRPIDS----SFERRTGYVQQQDIHIAELSVRESLQ 945

Query: 530  YGLTEE-----PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXX-XXXXXXXXXQKQRIA 583
            +          P +E++  V K       I +  D  +                Q+++++
Sbjct: 946  FSARMRRPESVPDEEKMAYVEK-------IIQVLDMEEYAEALVGAIGYGLNVEQRKKLS 998

Query: 584  IARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFE 641
            I   L  KP++L+ LDE TS LD +S  AI     ++  +    + ++    +T+  +F+
Sbjct: 999  IGVELCAKPDLLLFLDEPTSGLDSQSSWAIIQLLKRLTHAGQSILCTVHQPSATLFEQFD 1058

Query: 642  DVIVLGNDGSVVEMGKFKE 660
             +++L   G  V  G   E
Sbjct: 1059 RLLLLRKGGQTVYFGDIGE 1077

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 102/225 (45%), Gaps = 20/225 (8%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G I ++G+    L  
Sbjct: 863  TRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVNGK----LRD 918

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            +S  R IG  QQ+ + L + T+R+++ +  +  +P  + +    K+ +    I       
Sbjct: 919  ESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVIKILEMEP 976

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     Q+M
Sbjct: 977  YADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSI----CQLM 1032

Query: 621  KSKS---MTIVSIAHRLST--IRRFEDVIVLGNDGSVVEMGKFKE 660
            K  S     I+   H+ S   ++ F+ ++ L   G  V  G+  E
Sbjct: 1033 KKLSNHGQAILCTIHQPSAMLMQEFDRLLFLQKGGKTVYFGELGE 1077

>KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON} 
          Length = 1517

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 99/211 (46%), Gaps = 21/211 (9%)

Query: 460  GSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPI 518
            G+   ++G SG GK+T+ + L   +   ++G +L++G  I T    S  R+ G VQQ+ I
Sbjct: 893  GTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGHPIDT----SFERRTGYVQQQDI 948

Query: 519  LMSG-TIRDNITYGL-TEEPS----KEEIRLVAKQCFCHNFITKFPDTYDXXXXXX-XXX 571
             +S  T+R+++ +      P     KE++  V K       I    D  D          
Sbjct: 949  HISELTVRESLQFSARMRRPQSVTDKEKMTYVEK-------IIHVLDMEDYAEALVGTVG 1001

Query: 572  XXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSI 630
                  Q+++++I   L+ KP++L+ LDE TS LD +S  AI     ++  S    + +I
Sbjct: 1002 SGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKKLAHSGQSILCTI 1061

Query: 631  AHRLSTI-RRFEDVIVLGNDGSVVEMGKFKE 660
                +T+  +F+ +++L   G  V  G   E
Sbjct: 1062 HQPSATLFEQFDRLLLLKKGGQTVYFGNIGE 1092

>YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON}
           PDR11ATP-binding cassette (ABC) transporter, multidrug
           transporter involved in multiple drug resistance;
           mediates sterol uptake when sterol biosynthesis is
           compromisedregulated by Pdr1p; required for anaerobic
           growth
          Length = 1411

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 32/203 (15%)

Query: 465 IVGPSGRGKSTIASLLLHHYNA--VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMS- 521
           ++G SG GK+T+ ++L     +  V+G++LIDGQ +   N  + RR IG VQQ+ + +  
Sbjct: 780 LMGESGAGKTTLLNVLSQRTESGVVTGELLIDGQPLT--NIDAFRRSIGFVQQQDVHLEL 837

Query: 522 GTIRDN--ITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
            T+R++  I+  L  +  ++ + +V+        + + P                   Q+
Sbjct: 838 LTVRESLEISCVLRGDGDRDYLGVVSN-------LLRLPS--------EKLVADLSPTQR 882

Query: 580 QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSM---TIVSIAHR-- 633
           + ++I   L+ KP++L+ LDE TS LD E+      T  Q +K  SM    I+   H+  
Sbjct: 883 KLLSIGVELVTKPSLLLFLDEPTSGLDAEAA----LTIVQFLKKLSMQGQAILCTIHQPS 938

Query: 634 LSTIRRFEDVIVLGNDGSVVEMG 656
            S I  F+++ +L   G  V  G
Sbjct: 939 KSVISYFDNIYLLKRGGECVYFG 961

>KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} similar to
            uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2 ABC
            transporter
          Length = 1483

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 112/242 (46%), Gaps = 29/242 (11%)

Query: 434  FKNVSFFYPTRPTNQIF-KNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYN--AVSGQ 490
            +K++ +  P +   ++   N++  V  G+   ++G SG GK+T+ + L    +   V+G 
Sbjct: 839  WKDICYTIPYKGGERLLLDNVSGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIGVVTGD 898

Query: 491  ILIDGQDIATLNTKSLRRKIGIVQQEPI-LMSGTIRDNITYGLTEE-----PSKEEIRLV 544
            +L++G+ I      S  R+ G VQQ+ + +   T+R+++ +          P +E++   
Sbjct: 899  MLVNGKPI----DASFERRTGYVQQQDVHIKEMTVRESLQFSARMRRPLTVPDEEKL--- 951

Query: 545  AKQCFCHNFITKFPDTYDXXXXXXXXX----XXXXXXQKQRIAIARALIKKPNILI-LDE 599
                   +++ K  +  D                   Q+++++IA  L+ KPN+L+ LDE
Sbjct: 952  -------DYVEKVIEILDMSAYGEALVGNIGYGLNVEQRKKLSIAVELVAKPNLLLFLDE 1004

Query: 600  ATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMGKF 658
             TS LD +S  AI     ++  +    + +I    +T+   F+ +++L   G  V  G  
Sbjct: 1005 PTSGLDSQSAWAIVQLLKKLAGAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFGDI 1064

Query: 659  KE 660
             E
Sbjct: 1065 GE 1066

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 95/235 (40%), Gaps = 37/235 (15%)

Query: 449 IFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL---LHHYNAVSGQILIDG---QDIATLN 502
           I  N+N  V  G  + ++G  G G ST    +   L H+  VSG I  DG   +D+    
Sbjct: 160 IISNVNLLVRPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYF 219

Query: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLT-EEPSK-----------EEIRLVAKQCFC 550
              +     +    P L   T++  + + +  + PSK           E IR +    F 
Sbjct: 220 KSDVIYNGEMDVHFPHL---TVQQTLDFAVACKTPSKRINDFTRQQYIEFIRDLYATIFG 276

Query: 551 --HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVES 608
             H + TK  D +                +++R++IA AL  + +I   D AT  LD  +
Sbjct: 277 LKHTYNTKVGDDF---------VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST 327

Query: 609 EGAINYTFG-QIMKS--KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKE 660
             A+ YT   + M +  KS  ++++      I    D + +  +G  +  G+ +E
Sbjct: 328 --ALEYTEAIRCMTNLLKSTALITVYQASENIYETFDKVTILYEGKQIYFGRIEE 380

>Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON}
           YALI0F17996g (REAL)
          Length = 1393

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 26/200 (13%)

Query: 465 IVGPSGRGKSTIASLLLHHYNA--VSGQILIDGQDIATLNTKSLRRKIGIVQQEPI---L 519
           ++G SG GK+T+ ++L     +  VSG+ILIDGQ ++  + ++ +R IG VQQ+ +   L
Sbjct: 779 LMGESGAGKTTLLNVLSQRVESGVVSGEILIDGQPLS--DEEAFKRSIGFVQQQDLHLDL 836

Query: 520 MSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
           ++      I+  L  +  K  +  V+K       + K P                   QK
Sbjct: 837 LTVEESLEISCLLRGDGDKSYLDTVSK-------LLKLPSQ--------MLVADLNPTQK 881

Query: 580 QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR--LST 636
           + ++I   L+ KP++L+ LDE TS LD E+   I   F + +  +   I    H+   S 
Sbjct: 882 KLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTI-VKFLKQLSLQGQAIFCTIHQPSKSV 940

Query: 637 IRRFEDVIVLGNDGSVVEMG 656
           I  F+++ +L   G  V  G
Sbjct: 941 ISHFDNIFLLKRGGECVFFG 960

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 47/189 (24%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F ++SF Y + P+  ++++LNF V   S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 492 -----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
                          QD   L   +L   R K   + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQ 509

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
             ++  +++                               Q+ R+  A   +++PN+L+L
Sbjct: 510 TVQMATLSE------------------------------GQRSRVVFALLALEQPNVLLL 539

Query: 598 DEATSALDV 606
           DE T+ LD+
Sbjct: 540 DEPTNGLDI 548

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 47/189 (24%)

Query: 432 IEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQI 491
           + F ++SF Y + P+  ++++LNF V   S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 492 -----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537
                          QD   L   +L   R K   + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQ 509

Query: 538 KEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILIL 597
             ++  +++                               Q+ R+  A   +++PN+L+L
Sbjct: 510 TVQMATLSE------------------------------GQRSRVVFALLALEQPNVLLL 539

Query: 598 DEATSALDV 606
           DE T+ LD+
Sbjct: 540 DEPTNGLDI 548

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5.500
            YDR406W
          Length = 1509

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 101/223 (45%), Gaps = 20/223 (8%)

Query: 448  QIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNTKS 505
            +I  N++  V  G+   ++G SG GK+T+   L        ++G+I ++G+    L  +S
Sbjct: 880  RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLADRTTMGVITGEIFVNGR----LRDES 935

Query: 506  LRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
              R IG  QQ+ + L + T+R+++ +     +P+K  I    K  +    I      +  
Sbjct: 936  FPRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVSIE--EKNKYVEEVIKILEMEHYA 993

Query: 564  XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK- 621
                          Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     Q+M+ 
Sbjct: 994  DAVVGVAGEGLNVEQRKRLTIGVELVAKPALLVFLDEPTSGLDSQTAWSI----CQLMRK 1049

Query: 622  --SKSMTIVSIAHRLST--IRRFEDVIVLGNDGSVVEMGKFKE 660
              +    I+   H+ S   ++ F+ ++ +   G  V  G   E
Sbjct: 1050 LANHGQAILCTIHQPSAMLMQEFDRLLFMRRGGETVYFGDLGE 1092

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 110/234 (47%), Gaps = 22/234 (9%)

Query: 434  FKNVSFFYPTRP-TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQI 491
            ++NV +  P      Q+  N++     G+   ++G SG GK+T+ + L   +   ++G +
Sbjct: 859  WRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDM 918

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNITYGLTEE-----PSKEEIRLVA 545
            L++G+ I      S  R+ G VQQ+ I +S  T+R+++ +          P +E++  V 
Sbjct: 919  LVNGKPIDI----SFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEEKMEHVE 974

Query: 546  KQCFCHNFITKFPDTYDXXXXXX-XXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSA 603
            +       I K  D  +                Q+++++I   L+ KP++L+ LDE TS 
Sbjct: 975  R-------IIKVLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSG 1027

Query: 604  LDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMG 656
            LD +S  AI     ++ K+    + +I    +T+   F+ +++L   G  V  G
Sbjct: 1028 LDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1081

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 113/271 (41%), Gaps = 66/271 (24%)

Query: 409 EPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGP 468
           +P ++      +F  ++ +    + F ++SF Y  +P N ++++LNF V   S + +VGP
Sbjct: 370 QPVVQDRVFSFRFPQVDRLPPPVLAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGP 429

Query: 469 SGRGKSTIASLLLHHYNAVSGQI-----------LIDGQDIATLNTKSL---RRKIGIVQ 514
           +G GKST+  ++     + SG++               QD   L   +L   R K   + 
Sbjct: 430 NGVGKSTLLKIMTGELMSQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNIS 489

Query: 515 QEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXX 574
           Q+     G +     YGLT E           Q      +++                  
Sbjct: 490 QDFQYWRGQLG---RYGLTGEA----------QTVLMGTLSE------------------ 518

Query: 575 XXXQKQRIAIARALIKKPNILILDEATSALDVES----EGAINYTFGQIMKSKSMTIVSI 630
              Q+ R+  A   +++PN+L+LDE T+ LD+ +      AIN   G         +V +
Sbjct: 519 --GQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNG--------GVVVV 568

Query: 631 AHRLSTIRRF-EDVIVLGN------DGSVVE 654
           +H    + +  +D+ V+ +      DGS++E
Sbjct: 569 SHDFRLLDKIAKDIFVVEHKTATRWDGSILE 599

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 108/256 (42%), Gaps = 58/256 (22%)

Query: 420 KFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASL 479
           +F P+  +    + F ++SF Y   P N +++NL+F V   S + +VGP+G GKST+  +
Sbjct: 381 RFPPVERLPPPVLAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKI 440

Query: 480 LLHHYNAVSGQI-----------LIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIR 525
           +       SG++               QD   L   +L   R K   + Q+     G + 
Sbjct: 441 MTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG 500

Query: 526 DNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIA 585
               YGLT E    ++  +++                               Q+ R+  A
Sbjct: 501 ---RYGLTGEGQTVQMGTLSE------------------------------GQRSRVVFA 527

Query: 586 RALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVI 644
              +++PN+L+LDE T+ LD+ +  ++     +     +  +V ++H    + +  +D+ 
Sbjct: 528 LLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF----NGGVVVVSHDFRLLDKIAKDIF 583

Query: 645 VLGN------DGSVVE 654
           V+ N      +GS++E
Sbjct: 584 VVENKTATRWNGSILE 599

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 105/228 (46%), Gaps = 10/228 (4%)

Query: 434  FKNVSFFYPTR-PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQI 491
            ++NV +  P R  T ++  N++     G+   ++G SG GK+T+ + L   +   ++G +
Sbjct: 855  WRNVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDM 914

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPI-LMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550
            L++G  I      S  R+ G VQQ+ + +   T+R+++ +        + +    K  + 
Sbjct: 915  LVNGNHI----DASFERRTGYVQQQDVHVKEMTVRESLQFA-ARMRRPQSVPEAEKMAYV 969

Query: 551  HNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESE 609
             + I                       Q+++++I   L  KP++L+ LDE TS LD +S 
Sbjct: 970  EDIIEILDMEEYADALVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSS 1029

Query: 610  GAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMG 656
             AI     ++ ++    + +I    +T+  +F+ +++L   G  V  G
Sbjct: 1030 WAIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1077

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 95/207 (45%), Gaps = 20/207 (9%)

Query: 451 KNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKI 510
           + L FK P GS++ I+GP+G GK++I  ++   +   +   L        L+  + R  I
Sbjct: 593 QKLMFKGP-GSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGL--------LSVPAERELI 643

Query: 511 GIVQQEPILMSGTIRDNITYGLTEEP------SKEEIRLVAKQCFCHNFITKFPDTYDXX 564
            I Q+   +  GT R+ I Y ++ +         +E+  V K+     ++ K    +   
Sbjct: 644 CIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYL 702

Query: 565 XXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKS 624
                        ++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K   
Sbjct: 703 DAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYR 758

Query: 625 MTIVSIAHRLSTIRRFEDVIVLGNDGS 651
              ++I+ R S I+  +  + +G D S
Sbjct: 759 FNFITISQRPSLIKYHDLALEIGADES 785

>KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {ON} 
          Length = 1546

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 100/224 (44%), Gaps = 26/224 (11%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T ++  N++  V  G+   ++G SG GK+T+   L        ++G I +DG+    L  
Sbjct: 918  TRRLLSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRD 973

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEP---SKEEIRLVAKQCFCHNFITKFP 558
            +S  R IG  QQ+ + L + T+R+++ +     +P   SKEE     +Q      +  + 
Sbjct: 974  ESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVSKEEKDHYVEQVIKILEMETYA 1033

Query: 559  DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFG 617
            D                  Q++R+ I   L  KP +L+ LDE TS LD ++  A      
Sbjct: 1034 DA-----VVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----C 1084

Query: 618  QIMK---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMG 656
            Q+M+   +    I+   H+ S I  + F+ ++ L   G  V  G
Sbjct: 1085 QLMRKLANHGQAILCTIHQPSAILMQEFDRLLFLQKGGQTVYFG 1128

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 112/252 (44%), Gaps = 12/252 (4%)

Query: 414  STTGEAKFKPLNEVGGCEIEFKNVSFFYPTRP-TNQIFKNLNFKVPAGSNVCIVGPSGRG 472
            S+T  A F+ L   G     +K+V +  P +    Q+  N++     G+   ++G SG G
Sbjct: 821  SSTETAVFEGLQSEG--VFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAG 878

Query: 473  KSTIASLLLH-HYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPI-LMSGTIRDNITY 530
            K+T+ + L   +   ++G +L++G  I      S  R+ G VQQ+ I +   T+R+++ +
Sbjct: 879  KTTLLNTLAQRNVGIITGDMLVNGSPI----DASFERRTGYVQQQDIHIKEMTVRESLQF 934

Query: 531  GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIK 590
                    E I    K  +    I                       Q+++++I   L  
Sbjct: 935  S-ARMRRPESIPDSEKMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAA 993

Query: 591  KPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGN 648
            KPN+L+ LDE TS LD ++  AI     ++ ++    + +I    +T+  +F+ +++L  
Sbjct: 994  KPNLLLFLDEPTSGLDSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKK 1053

Query: 649  DGSVVEMGKFKE 660
             G  V  G   E
Sbjct: 1054 GGQTVYFGPIGE 1065

>YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}
            PDR10ATP-binding cassette (ABC) transporter, multidrug
            transporter involved in the pleiotropic drug resistance
            network; regulated by Pdr1p and Pdr3p
          Length = 1564

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 105/236 (44%), Gaps = 19/236 (8%)

Query: 432  IEFKNVSFFYPTR-PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVS 488
              +KN+ +  P +    +I  N++  V  G+   ++G SG GK+T+   L        ++
Sbjct: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982

Query: 489  GQILIDGQDIATLNTKSLRRKIGIVQQEPI-LMSGTIRDNITYGLTEEPSKEEIRLVAKQ 547
            G + +DG+       +S  R IG  QQ+ + L + T+R+++ +      + +++ +  K 
Sbjct: 983  GDVFVDGRP----RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQA-DDVSIEEKD 1037

Query: 548  CFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDV 606
             +    I                       Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097

Query: 607  ESEGAINYTFGQIMK---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGK 657
            ++     ++  Q+MK   S+   I+   H+ S +  + F+ ++ L   G  V  G+
Sbjct: 1098 QTA----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/375 (19%), Positives = 147/375 (39%), Gaps = 75/375 (20%)

Query: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYG----SYLVMHGSMSIG 366
           +KRF+   R +  V     F+NG      + + D+    +  YG    SY+     +   
Sbjct: 266 LKRFD---RTLVLVSHSQDFLNG----VCTNMLDMRLQKLTAYGGNYDSYVKTRSELETN 318

Query: 367 DLTAFMLYTEYTGN--AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEA----K 420
            +  +    E   +       +  Y+ L++   +  +I +  + +  I++   +     +
Sbjct: 319 QMKQYHKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQAVVADRVFSFR 378

Query: 421 FKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL 480
           F  +  +    + F  +SF Y   P N +++ LNF V   S   +VGP+G GKST+  ++
Sbjct: 379 FPEVERLPPPVLAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIM 438

Query: 481 L-----------HHYNAVSGQILIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIRD 526
                        H +   G      QD   L   +L   R K   + ++     G +  
Sbjct: 439 TGELTPHGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHISEDFQFWRGQLG- 497

Query: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIAR 586
              YGLT E    ++  +++                               Q+ R+  A 
Sbjct: 498 --RYGLTGEAQTAQMATLSE------------------------------GQRSRVVFAL 525

Query: 587 ALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVIV 645
             +++PN+L+LDE T+ LD+ +  ++       + + +  +V ++H    + R  +D+ V
Sbjct: 526 LALEQPNVLLLDEPTNGLDIPTIDSL----ADAIDAFNGGVVVVSHDFRLLDRIAKDIYV 581

Query: 646 LGN------DGSVVE 654
           + N      DGS+++
Sbjct: 582 VENKTATRWDGSILD 596

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} highly
            similar to uniprot|P33302 Saccharomyces cerevisiae
            YOR153w PDR5 or uniprot|Q04182 Saccharomyces cerevisiae
            YDR406w PDR15 or uniprot|P51533 Saccharomyces cerevisiae
            YOR328w
          Length = 1499

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 100/223 (44%), Gaps = 20/223 (8%)

Query: 444  RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATL 501
            + T +I  N++  V  G+   ++G SG GK+T+   L        ++G++ +DG+     
Sbjct: 870  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQ---- 925

Query: 502  NTKSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
               S  R IG  QQ+ + L + T+R+++ +     +P+  ++ +  K  +  + I     
Sbjct: 926  RDDSFARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPA--DVSIEEKNQYVEDVIKILEM 983

Query: 560  TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQ 618
                              Q++R+ I   L  KP +L+ LDE TS LD ++  +I     Q
Sbjct: 984  EQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQ 1039

Query: 619  IMK---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMG 656
            +MK   +    I+   H+ S I  + F+ ++ L   G  V  G
Sbjct: 1040 LMKKLANHGQAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFG 1082

>Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR011W
           (REAL)
          Length = 1394

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 94/200 (47%), Gaps = 26/200 (13%)

Query: 465 IVGPSGRGKSTIASLLLHHYNA--VSGQILIDGQDIATLNTKSLRRKIGIVQQEPI---L 519
           ++G SG GK+T+ ++L     +  V+G+ILIDGQ +A  +  S +R IG VQQ+ +   L
Sbjct: 780 LMGESGAGKTTLLNVLSQRIESGVVTGEILIDGQPLA--DEDSFKRSIGFVQQQDLHLDL 837

Query: 520 MSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
           ++      I+  L  +  +  +  V+K       + K P                   QK
Sbjct: 838 LTVEESLEISCILRGDGDRAYLDTVSK-------LLKLPS--------EILVADLNPTQK 882

Query: 580 QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR--LST 636
           + ++I   L+ KP++L+ LDE TS LD E+   I   F + +  +   I    H+   S 
Sbjct: 883 KLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTI-VKFLKQLSLQGQAIFCTIHQPSKSV 941

Query: 637 IRRFEDVIVLGNDGSVVEMG 656
           I  F+++ +L   G  V  G
Sbjct: 942 ISHFDNIFLLKRGGECVFFG 961

>NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3.133
           YOL075C
          Length = 1273

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 117/282 (41%), Gaps = 37/282 (13%)

Query: 452 NLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRR--- 508
           + +  +P+GS + ++G SG GK+T+ ++L    + +SG +  DG     L  K  R    
Sbjct: 39  SFSLDLPSGSVMAVMGGSGSGKTTLLNVLA---SKISGGLKTDGDIHYILEEKPQRDSEQ 95

Query: 509 --------KIGIVQQEPILMSG-TIRDNITYG--LTEEPSKEEIRLVAKQCFCHNFITKF 557
                   K+  + Q+ +L +  T R+ + Y   L  + SKEE +LV  Q      +   
Sbjct: 96  EQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIHELGLKDC 155

Query: 558 PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 617
            +T                 +K+R+++   +I  P+I+ LDE T+ LD  S   +  T  
Sbjct: 156 AET----LVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLK 211

Query: 618 QIMKSKSMT-IVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPXXXXXXXXXXX 676
           ++ K    T I+SI    S I    D + + + G VV   K                   
Sbjct: 212 KLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVYCDKMPN-----------TIPYF 260

Query: 677 XXXXXATPQPVNPPP-FIDLQTNPEEKKEADNASEENGAKLD 717
                  PQ VNP   FID+ +       +D+A +E   +L+
Sbjct: 261 DKLGYKVPQLVNPADYFIDISS---VDGRSDSAQDETSKRLE 299

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 98/248 (39%), Gaps = 41/248 (16%)

Query: 446 TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL-------LHHYNAVSGQILIDGQDI 498
           + QI +++N     G    I+GPSG GKST+ +L+            A +G I+ +   I
Sbjct: 686 SKQILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQI 745

Query: 499 ATLNTKSLRRKIGIVQQEPILMSGTIRDNITYG-------LTEE----PSKEEIRLVAKQ 547
           +    K++   +     + +L   T+R+   +        LTEE     S E IR +  +
Sbjct: 746 SEEMFKNVCSYVS-QDDDHLLAKLTVRETFKFAADLRLHNLTEEQRVIKSDELIRALGLK 804

Query: 548 CFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSALDVE 607
             C N I                       +K+R+ +   L+  P I++LDE TS LD  
Sbjct: 805 -HCENNIIG-----------NEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSF 852

Query: 608 SEGAINYTFGQIMKSKSMTIVSIAH--RLSTIRRFEDVIVLGNDGSVVEMGKFKEL---- 661
           +   I     ++      TI+   H  R    ++F +V++L   G     G   E+    
Sbjct: 853 TSATILEILKKLSVEYGKTIIITIHQPRSELFKQFGNVLLLAKSGRTAFNGSPNEMIEYF 912

Query: 662 ----YDNP 665
               YD P
Sbjct: 913 ASLGYDCP 920

>Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR070W
           (REAL)
          Length = 1393

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 92/200 (46%), Gaps = 26/200 (13%)

Query: 465 IVGPSGRGKSTIASLLLHHYN--AVSGQILIDGQDIATLNTKSLRRKIGIVQQEPI---L 519
           ++G SG GK+T+ ++L        VSG+ILIDG  +   +  + +R IG VQQ+ +   L
Sbjct: 779 LMGESGAGKTTLLNVLSQRVETGVVSGEILIDGHPMT--DEDAFKRSIGFVQQQDLHLDL 836

Query: 520 MSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
           +S      I+  L  +  K  +  V+K       +   PDT                 QK
Sbjct: 837 LSVKESLEISCLLRGDGDKAYLDTVSK------LLKLPPDT---------LVADLNPTQK 881

Query: 580 QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR--LST 636
           + ++I   L+ KP++L+ LDE TS LD E+   I   F + +  +   I    H+   S 
Sbjct: 882 KLLSIGVELVTKPSLLLFLDEPTSGLDAEAASTI-VKFLKQLSLQGQAIFCTIHQPSKSV 940

Query: 637 IRRFEDVIVLGNDGSVVEMG 656
           I  F+++ +L   G  V  G
Sbjct: 941 ISHFDNIFLLKRGGECVFFG 960

>NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {ON}
            Anc_5.500
          Length = 1551

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 98/224 (43%), Gaps = 20/224 (8%)

Query: 444  RPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATL 501
            + T +I  N++  V  G+   ++G SG GK+T+   L        ++G+I +DG+    L
Sbjct: 886  KETRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGKICVDGR----L 941

Query: 502  NTKSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPD 559
               S  R IG  QQ+ + L + T+R+++ +     +P+   I +  K  +    I     
Sbjct: 942  RDTSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAN--ISIEEKNKYVEEVIDILEM 999

Query: 560  TYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQ 618
                              Q++R+ I   L  KP +L+ LDE TS LD ++  A      Q
Sbjct: 1000 EPYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----CQ 1055

Query: 619  IMK---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGK 657
            +M+        I+   H+ S +  + F+ ++ L   G  V  G+
Sbjct: 1056 LMRKLADNGQAILCTIHQPSAVLMQEFDRLLFLQKGGKTVYFGE 1099

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 98/223 (43%), Gaps = 20/223 (8%)

Query: 448  QIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNTKS 505
            +I  N+N  V  G+   ++G SG GK+T+   L        ++G I +DG+    L  +S
Sbjct: 817  RILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGGIFVDGR----LRDES 872

Query: 506  LRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
              R IG  QQ+ + L + T+R+++ +     +PS   + +  K  +    I         
Sbjct: 873  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPS--SVSVEEKNKYVEEVIKILEMEKYS 930

Query: 564  XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK- 621
                          Q++R+ I   L  +P +L+ LDE TS LD ++     +   Q+M+ 
Sbjct: 931  DAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRK 986

Query: 622  --SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
              +    I+   H+ S I  ++F+ ++ L   G  V  G   E
Sbjct: 987  LATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGDLGE 1029

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 98/223 (43%), Gaps = 20/223 (8%)

Query: 448  QIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNTKS 505
            +I  N+N  V  G+   ++G SG GK+T+   L        ++G I +DG+    L  +S
Sbjct: 817  RILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGGIFVDGR----LRDES 872

Query: 506  LRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
              R IG  QQ+ + L + T+R+++ +     +PS   + +  K  +    I         
Sbjct: 873  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPS--SVSVEEKNKYVEEVIKILEMEKYS 930

Query: 564  XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK- 621
                          Q++R+ I   L  +P +L+ LDE TS LD ++     +   Q+M+ 
Sbjct: 931  DAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRK 986

Query: 622  --SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
              +    I+   H+ S I  ++F+ ++ L   G  V  G   E
Sbjct: 987  LATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGDLGE 1029

>YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Plasma
            membrane ATP binding cassette (ABC) transporter,
            multidrug transporter and general stress response factor
            implicated in cellular detoxification; regulated by
            Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR
            responsive element
          Length = 1529

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 97/223 (43%), Gaps = 20/223 (8%)

Query: 448  QIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNTKS 505
            +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG+    L  +S
Sbjct: 901  RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRDES 956

Query: 506  LRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
              R IG  QQ+ + L + T+R+++ +     +PS   I    K  +    I         
Sbjct: 957  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIE--EKNRYVEEVIKILEMQQYS 1014

Query: 564  XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK- 621
                          Q++R+ I   L  +P +L+ LDE TS LD ++     +   Q+M+ 
Sbjct: 1015 DAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRK 1070

Query: 622  --SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMGKFKE 660
              +    I+   H+ S I  ++F+ ++ L   G  V  G   E
Sbjct: 1071 LATHGQAILCTIHQPSAILMQQFDRLLFLQKGGQTVYFGDLGE 1113

>KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1555

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 96/224 (42%), Gaps = 26/224 (11%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG+    L  
Sbjct: 923  TRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGYIYVDGK----LRD 978

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEP---SKEEIRLVAKQCFCHNFITKFP 558
             S  R IG  QQ+ + L + ++R+++ +     +P   SKEE     K  +    I    
Sbjct: 979  TSFPRSIGYCQQQDLHLKTASVRESLRFSAYLRQPASVSKEE-----KDAYVEEVIKILE 1033

Query: 559  DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFG 617
                               Q++R+ I   L  KP +L+ LDE TS LD ++  A      
Sbjct: 1034 MEAYADAIVGVAGEGLNVEQRKRLTIGVELAAKPRLLVFLDEPTSGLDSQTAWAT----C 1089

Query: 618  QIMK---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMG 656
            Q+M+        I+   H+ S I  + F+ ++ L   G  V  G
Sbjct: 1090 QLMRKLAEHGQAILCTIHQPSAILMQEFDRLLFLQKGGQTVYFG 1133

>NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5.500
          Length = 1509

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 99/221 (44%), Gaps = 20/221 (9%)

Query: 446  TNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNT 503
            T +I  N++  V  G+   ++G SG GK+T+   L        ++G++ ++G+    L  
Sbjct: 879  TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVNGR----LRD 934

Query: 504  KSLRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTY 561
            +S  R IG  QQ+ + L + T+R+++ +     +PS  ++ +  K  +    I       
Sbjct: 935  ESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPS--DVSIEEKNKYVEEIIKILEMEK 992

Query: 562  DXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIM 620
                            Q++R+ I   L  KP +L+ LDE TS LD ++  +I     Q+M
Sbjct: 993  YADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQLM 1048

Query: 621  K---SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMG 656
            K        I+   H+ S I  + F+ ++ +   G  V  G
Sbjct: 1049 KKLADHGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYFG 1089

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 108/233 (46%), Gaps = 14/233 (6%)

Query: 432 IEFKNVSFFYPTRPTNQ-IFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLL--HHYNAVS 488
           + F+N+++   +  T++ I K ++  +  G  + ++G SG GK+T+  +L        V+
Sbjct: 377 LSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVT 436

Query: 489 GQILIDGQDIATLNTKSLRRKIGIVQQEPILM-SGTIRDNI-TYGLTEEPSKEEIRLVAK 546
           G I ++G DI     K   + IG V Q+  L+ + T+ + +    L   P        AK
Sbjct: 437 GSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLP--RSFSFAAK 491

Query: 547 QCFCHNFITKFP--DTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILILDEATSAL 604
           Q   +  + +    D  D               +K+R++IA  L+  P IL LDE TS L
Sbjct: 492 QTRVYQVLEELRILDIKDRVIGNDFERGISGG-EKRRVSIACELVTSPLILFLDEPTSGL 550

Query: 605 DVESEGAINYTFGQIMKSKSMTIV-SIAHRLSTIRRFEDVIVLGNDGSVVEMG 656
           D  +   +     ++ K+ + T+V SI    S I +  D +VL ++G +V  G
Sbjct: 551 DANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVYSG 603

>YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}
           PDR18Putative transporter of the ATP-binding cassette
           (ABC) family, implicated in pleiotropic drug resistance;
           the authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 1333

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 111/234 (47%), Gaps = 20/234 (8%)

Query: 434 FKNVSFFYP-TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQI 491
           +KNVSF  P +    ++  +++     G+   ++G SG GK+T+ + L   +   ++G +
Sbjct: 731 WKNVSFTIPHSSGQRKLLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTITGDM 790

Query: 492 LIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNITYGLTEE-----PSKEEIRLVA 545
           L+DG  +      S +R+ G VQQ+ + ++  T+++++ +          P  E++  V 
Sbjct: 791 LVDGLPM----DASFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQSIPDAEKMEYVE 846

Query: 546 KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSAL 604
           K       I+                      Q+++++I   L+ KP++L+ LDE TS L
Sbjct: 847 K------IISILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGL 900

Query: 605 DVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMGK 657
           D +S  A+     ++  +    + +I    +T+  +F+ +++LG  G  +  G+
Sbjct: 901 DSQSAWAVVKMLKRLALAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFGE 954

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 115/249 (46%), Gaps = 33/249 (13%)

Query: 432 IEFKNVSFFYPTRPTNQ----IFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA- 486
           + F+N+S+  P+   N     I KN++  V  G  + I+G SG GK+T+  +L     + 
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 487 -VSGQILIDGQDIATLNTKSLRRKIGIVQQ-----------EPILMSGTIRDNITYGLTE 534
            VSG I I+G++++    + + + IG V Q           E +L S  +R  +   +T 
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSMTF 547

Query: 535 EPSKEEIRLVAKQCFCHNFITKF-PDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPN 593
              ++ +  V ++   +N   +   D ++               +K+R++IA  L+  P 
Sbjct: 548 YQKQQRVFQVLEELRIYNIKDRLIGDDFERGISGG---------EKRRVSIACELVTSPL 598

Query: 594 ILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR-LSTIRRFEDVIVLGNDGSV 652
           IL LDE TS LD  +   +     ++ K+ + T+V   H+  S I      +VL + G +
Sbjct: 599 ILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEM 658

Query: 653 VEMGKFKEL 661
           V  G+ + +
Sbjct: 659 VYSGEIRRV 667

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 106/233 (45%), Gaps = 20/233 (8%)

Query: 434  FKNVSFFYPTR-PTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQI 491
            +K+V F  P    T  +  N++     G+   ++G SG GK+T+ + L   +   ++G +
Sbjct: 855  WKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGIITGDM 914

Query: 492  LIDGQDIATLNTKSLRRKIGIVQQEPILMSG-TIRDNITYGLTEE-----PSKEEIRLVA 545
            L++G+ I      S  R+ G VQQ+ I ++  T+R+++ +          P  E++  V 
Sbjct: 915  LVNGRPI----DASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPDSEKMEYVE 970

Query: 546  KQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSAL 604
            K       I                       Q+++++I   L+ KP++L+ LDE TS L
Sbjct: 971  K------IIRVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGL 1024

Query: 605  DVESEGAINYTFGQIMKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMG 656
            D +S  AI     ++ K+    + +I    +T+   F+ +++L   G  V  G
Sbjct: 1025 DSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1077

>SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]
           {ON} similar to uniprot|Q12298 Saccharomyces cerevisiae
           YDR061W Mitochondrial protein member of the ATP-binding
           cassette (ABC) transporter family transcriptionally
           activated by Yrm1p along with genes involved in
           multidrug resistance
          Length = 520

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 90/199 (45%), Gaps = 32/199 (16%)

Query: 426 EVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLL-LHHY 484
           E+ G ++ ++ VS          I KNL++KV  GS   + G +G GKST+ SLL   H 
Sbjct: 291 ELNGLDVSYRGVS----------ILKNLHWKVAPGSKWHVRGDNGTGKSTLLSLLTADHP 340

Query: 485 NAVSGQILIDG--QDIATLNTKSLRRKIGIVQQE--PILMSG-----TIRDNITYGLTEE 535
            + + +++ DG  +   + N   +  +IG+   E   I +       ++R+++  G  E 
Sbjct: 341 QSWNSRVIEDGVPRKTGSSNYFDINERIGMTSPELHAIFLKNAGEKLSVRESVATGFREG 400

Query: 536 PSKEEIRLVAK-----QCFCHNFITKF--PDTYDXXXXXXXXXXXXXXXQKQRIAIARAL 588
            S   I    K     +   H ++  F   D  D               +++ +   R++
Sbjct: 401 SSNNFIPYWHKLSKDQKEIAHMYLEYFGLQDVAD-----SKKFNALSTSEQKLVLFVRSV 455

Query: 589 IKKPNILILDEATSALDVE 607
           +K P +LILDEA SA++ E
Sbjct: 456 VKMPQVLILDEAFSAMETE 474

>Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR406W
            (REAL)
          Length = 1537

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 97/219 (44%), Gaps = 20/219 (9%)

Query: 448  QIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHH--YNAVSGQILIDGQDIATLNTKS 505
            +I  N++  V  G+   ++G SG GK+T+   L        ++G I +DG+    L  +S
Sbjct: 908  RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRDES 963

Query: 506  LRRKIGIVQQEPI-LMSGTIRDNITY-GLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
              R IG  QQ+ + L + T+R+++ +     +PS   + L  K  +    I         
Sbjct: 964  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPS--SVSLEEKDKYVEEVIKILEMEKYS 1021

Query: 564  XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMK- 621
                          Q++R+ I   L  +P +L+ LDE TS LD ++     +   Q+M+ 
Sbjct: 1022 DAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRK 1077

Query: 622  --SKSMTIVSIAHRLSTI--RRFEDVIVLGNDGSVVEMG 656
              +    I+   H+ S I  ++F+ ++ L   G  V  G
Sbjct: 1078 LATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFG 1116

>Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ABR125C
          Length = 1474

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 124/272 (45%), Gaps = 34/272 (12%)

Query: 406  NDKEPKIKSTTGEAKFK-------PLNEVG---GCEIE----FKNVSFFYPTRPTN-QIF 450
            +D E     TT EAK+        P+   G   G + E    +KNVS+  P + T  ++ 
Sbjct: 799  HDVESSSPGTTSEAKYMVSDDSNLPVTGAGIFEGLKNEDVFLWKNVSYTIPYKGTKRKLL 858

Query: 451  KNLNFKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQILIDGQDIATLNTKSLRRK 509
              ++     G+   ++G SG GK+T+ + L   +   ++G +L++G  +      S  R+
Sbjct: 859  DEVSGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGLPVDI----SFERR 914

Query: 510  IGIVQQEPI-LMSGTIRDNITYGL-----TEEPSKEEIRLVAKQCFCHNFITKFPDTYDX 563
             G VQQ+ + +   T+R+++ +          P  E++  V K       +T + D    
Sbjct: 915  TGYVQQQDVHIKEMTVRESLQFSARLRRPESVPDAEKLDYVEKIIEVLG-MTDYADA--- 970

Query: 564  XXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKS 622
                          Q+++++I   L+ KP++L+ LDE TS LD +S  AI     ++ K+
Sbjct: 971  --VVGDVGYGLNVGQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSSWAIVQLLKKLAKA 1028

Query: 623  KSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVV 653
                + +I    +T+  +F+ +++L   G  V
Sbjct: 1029 GQSILCTIHQPSATLFEQFDRLLLLKKGGQTV 1060

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 107/256 (41%), Gaps = 58/256 (22%)

Query: 420 KFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASL 479
           +F P+  +    + F ++SF Y   P + +++NL+F V   S + +VGP+G GKST+  +
Sbjct: 380 RFPPVERLPPPVLAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKI 439

Query: 480 LL-----------HHYNAVSGQILIDGQDIATLNTKSL---RRKIGIVQQEPILMSGTIR 525
           +             H +   G      QD   L   +L   R K   + Q+     G + 
Sbjct: 440 MTGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG 499

Query: 526 DNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQKQRIAIA 585
               YGLT E    ++  +++                               Q+ R+  A
Sbjct: 500 ---RYGLTGEGQTVQMGTLSE------------------------------GQRSRVVFA 526

Query: 586 RALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRF-EDVI 644
              +++PN+L+LDE T+ LD+ +  ++     +     +  +V ++H    + +  +D+ 
Sbjct: 527 LLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF----NGGVVVVSHDFRLLDKIAKDIF 582

Query: 645 VLGN------DGSVVE 654
           V+ N      DGS+++
Sbjct: 583 VVENRTATRWDGSILQ 598

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 579 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAH 632
           K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 231 KMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {ON} 
          Length = 1392

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 110/266 (41%), Gaps = 42/266 (15%)

Query: 465  IVGPSGRGKSTIASLLLHHYN--AVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMS- 521
            ++G SG GK+T+ ++L        V+G++LIDG  +   N  + RR IG VQQ+ + +  
Sbjct: 766  LMGESGAGKTTLLNVLSQRVTTGVVTGELLIDGNPLT--NIDAFRRSIGFVQQQDVHLEL 823

Query: 522  GTIRDN--ITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
             T++++  I+  L  +  K  +  VA        + K P                   ++
Sbjct: 824  LTVKESLEISCNLRGDGDKAYLSTVAN-------LLKLP--------ANKLVADLSPTER 868

Query: 580  QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR--LST 636
            + ++I   L+ KP++L+ LDE TS LD E+   I   F + +  +   I+   H+   S 
Sbjct: 869  KLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTI-VQFLKKLSQQGQAILCTIHQPSKSV 927

Query: 637  IRRFEDVIVLGNDGSVVEMG----------------KFKELYDNPXXXXXXXXXXXXXXX 680
            I  F+++ +L   G  V  G                 F +  +NP               
Sbjct: 928  ISYFDNIYLLKRGGECVFFGPINDACDYFVTRDETLSFDKEAENPADFVIDVVGGIQKNE 987

Query: 681  XATPQPVNPPPFIDLQTNPEEKKEAD 706
              T QP +  P+  L     E+ E D
Sbjct: 988  DGTVQPRSSLPWNRLWAESRERIEVD 1013

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 96/204 (47%), Gaps = 21/204 (10%)

Query: 464  CIVGPSGRGKSTIASLLLHHYN---AVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILM 520
             ++G SG GK+T+ ++L    +     SG+IL+D + +     +  +R +G VQQ+ I  
Sbjct: 834  ALMGASGAGKTTLLNVLAQRMDFGIVSSGEILVDAKPV----DRKFKRSVGYVQQQDIHT 889

Query: 521  SG-TIRDNITYGL-----TEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXX 574
               T+R+++ +          P  E++  V K       +    D  D            
Sbjct: 890  QELTVRESLQFSARLRRPDSVPDAEKMEYVEKII----VVLGMQDYSD--AVVGEAGFGL 943

Query: 575  XXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHR 633
               Q+++++I   L+ KP +L+ LDE TS LD +S  AI     ++ ++    + +I   
Sbjct: 944  NVEQRKKLSIGVELVAKPTLLLFLDEPTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQP 1003

Query: 634  LSTI-RRFEDVIVLGNDGSVVEMG 656
             +T+   F+ +++L + GSVV  G
Sbjct: 1004 SATLFESFDRLLLLKDGGSVVYWG 1027

>TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON} 
          Length = 1373

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 102/210 (48%), Gaps = 32/210 (15%)

Query: 465 IVGPSGRGKSTIASLLLHHYNA--VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSG 522
           ++G SG GK+T+ ++L     +  V+G+I+IDG  +   N  + +R IG VQQ+ + +  
Sbjct: 763 LMGESGAGKTTLLNILSQRTESGVVTGEIMIDGMVLN--NGSAFKRSIGFVQQQDVHLDE 820

Query: 523 -TIRDN--ITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXXXXXXXQK 579
            T++++  I+  L  +  K+ +  V+K       + K P                   +K
Sbjct: 821 LTVKESLEISCTLRGDGDKKYMDTVSK-------MLKLPS--------ECMVRDLTPTEK 865

Query: 580 QRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSM---TIVSIAHR-- 633
           + ++I   L+ KP++L+ LDE TS LD  SE A+  T  + +K  SM    I+   H+  
Sbjct: 866 KLLSIGVELVTKPSLLLFLDEPTSGLD--SEAAV--TIVKFLKKLSMQGQAILCTIHQPS 921

Query: 634 LSTIRRFEDVIVLGNDGSVVEMGKFKELYD 663
            S I  F+ + +L   G  V  G  +E  D
Sbjct: 922 KSVISYFDSIYLLKRGGQCVYFGPMQEACD 951

>NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {ON}
          Length = 1488

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 97/206 (47%), Gaps = 19/206 (9%)

Query: 460  GSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPI 518
            G+   ++G SG GK+T+ + L   +   ++G +LI+G  I      S  R+ G VQQ+ I
Sbjct: 873  GTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLINGHPI----DASFERRTGYVQQQDI 928

Query: 519  LMSG-TIRDNITYGLTEE-----PSKEEIRLVAKQCFCHNFITKFPDTYDXXXXXXXXXX 572
             ++  T+R+++ +          P +E++  V K       I      Y           
Sbjct: 929  HIAELTVRESLQFSARMRRAQAIPDEEKMAYVEK------IIQVLDMEYYAEALVGEIGR 982

Query: 573  XXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQIMKSKSMTIVSIA 631
                 Q+++++I   L+ KP++L+ LDE TS LD +S  AI     ++ ++    + +I 
Sbjct: 983  GLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAQAGQSILCTIH 1042

Query: 632  HRLSTI-RRFEDVIVLGNDGSVVEMG 656
               +T+  +F+ +++L   G  V  G
Sbjct: 1043 QPSATLFEQFDRLLLLRKGGQTVYFG 1068

>Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR070W
            (REAL)
          Length = 1421

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 104/222 (46%), Gaps = 34/222 (15%)

Query: 455  FKVPAGSNVCIVGPSGRGKSTIASLLLH-HYNAVSGQILIDGQDIATLNTKSLRRKIGIV 513
            + VP G+   ++G SG GK+T+ + L   +   ++G +L++G  I      S  R+ G V
Sbjct: 801  YCVP-GTLTALIGESGAGKTTLLNTLAQRNVGTITGDMLVNGLPI----DASFARRTGYV 855

Query: 514  QQEPILMSG-TIRDNITYGLTEE-----PSKEEIRLVAK-------QCFCHNFITKFPDT 560
            QQ+ I ++  T+R+++ +          P  E++  V K       Q F    + +    
Sbjct: 856  QQQDIHIAELTVRESLQFSARMRRPQSIPDTEKMEYVEKIISILEMQEFSEALVGEIGHG 915

Query: 561  YDXXXXXXXXXXXXXXXQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQI 619
             +               Q+++++I   L+ KP++L+ LDE TS LD +S  A+     ++
Sbjct: 916  LN-------------VEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVIKVLKRL 962

Query: 620  MKSKSMTIVSIAHRLSTI-RRFEDVIVLGNDGSVVEMGKFKE 660
             +S    + +I    +T+  +F+ +++LG  G  +  G   E
Sbjct: 963  ARSGQSILCTIHQPSATLFEQFDWLLLLGKGGRTIYFGGIGE 1004

>KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {ON} 
          Length = 1553