Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B063705.473ON37837818000.0
KNAG0B040705.473ON37337814140.0
CAGL0I07227g5.473ON36837313910.0
Ecym_23135.473ON37037813730.0
YOR136W (IDH2)5.473ON36937313720.0
Kpol_440.125.473ON36836813690.0
Smik_15.3165.473ON36937313610.0
Skud_15.3005.473ON36936313600.0
NDAI0C014105.473ON36936313600.0
Suva_8.1885.473ON36937813560.0
TDEL0A033705.473ON37137813500.0
SAKL0G03520g5.473ON36937813490.0
NCAS0H022505.473ON42237813540.0
KLTH0F15048g5.473ON36836313470.0
Kwal_55.212735.473ON36837013330.0
AFR137C5.473ON36737813300.0
KLLA0E03125g5.473ON36837813300.0
TBLA0B022405.473ON37334913021e-180
Kpol_543.85.473ON36836112871e-178
TPHA0J027705.473ON37635212801e-176
ZYRO0D11220g5.473ON36835712681e-175
TPHA0E014805.473ON37738011441e-156
ADL223W2.278ON3623616371e-79
Ecym_33162.278ON3623446241e-77
KLTH0G10186g2.278ON3603446214e-77
Kwal_23.50122.278ON3613656171e-76
Smik_14.2902.278ON3603456171e-76
YNL037C (IDH1)2.278ON3603456162e-76
KLLA0F04103g2.278ON3613466153e-76
ZYRO0D02838g2.278ON3613686092e-75
SAKL0E07876g2.278ON3613446066e-75
NDAI0B035902.278ON3593455988e-74
TBLA0B069102.278ON3653815981e-73
Skud_14.2932.278ON3613455944e-73
TPHA0D015602.278ON3603645858e-72
NCAS0B062902.278ON3593715796e-71
KNAG0A052802.278ON3613825753e-70
TDEL0C038402.278ON3613485692e-69
CAGL0G02673g2.278ON3583625675e-69
Kpol_1039.352.278ON3593655543e-67
Suva_14.3022.278ON3002865354e-65
KAFR0J014102.278ON3503795325e-64
Kpol_1003.392.287ON3703653784e-41
NCAS0B062502.287ON3733533583e-38
NDAI0B035502.287ON3723543558e-38
ADL214C2.287ON3673633522e-37
Ecym_33262.287ON3663473495e-37
TBLA0B059402.287ON3693533488e-37
KNAG0A054202.287ON3723533488e-37
CAGL0G02585g2.287ON3723593471e-36
YIL094C (LYS12)2.287ON3713573443e-36
KAFR0J013602.287ON3733523426e-36
Smik_9.852.287ON3713573373e-35
KLLA0E08339g2.287ON3693593347e-35
SAKL0E07656g2.287ON3683603347e-35
Suva_9.1052.287ON3713573349e-35
TPHA0C034102.287ON3713793312e-34
TDEL0G021802.287ON3693713261e-33
Skud_9.792.287ON3713573242e-33
ZYRO0A01914g2.287ON3683593233e-33
KLTH0G10384g2.287ON3673643163e-32
Kwal_27.115282.287ON3673643163e-32
Skud_3.431.402ON3643551815e-14
YCL018W (LEU2)1.402ON3643591815e-14
Smik_3.661.402ON3643551799e-14
TDEL0B060001.402ON3623561719e-13
KAFR0I022001.402ON3653591692e-12
AAL012C1.402ON3723531692e-12
Ecym_12961.402ON3632711692e-12
Suva_3.31.402ON3643561664e-12
NDAI0G042301.402ON3633551612e-11
TBLA0C015001.402ON3653081575e-11
KLLA0D04906g1.402ON3623061568e-11
Kwal_0.2251.402ON3643601551e-10
ZYRO0E04796g1.402ON3622671504e-10
CAGL0H03795g1.402ON3653571488e-10
NCAS0C048701.402ON3652671417e-09
SAKL0D08690g1.402ON3642681372e-08
TPHA0B037301.402ON3653571353e-08
KLTH0H12188g1.402ON3643631336e-08
Kpol_1048.631.402ON3643061301e-07
KNAG0I012801.402ON4473611302e-07
Suva_14.303singletonON5343770.032
KNAG0L008307.154ON135962780.52
KLLA0F08459g3.153ON83778731.9
KNAG0H010303.302ON443140722.1
TBLA0B071702.306ON47068685.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B06370
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   697   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   549   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   540   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   533   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   533   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   531   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   528   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   528   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   528   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   526   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   524   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   524   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    526   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   523   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   518   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   516   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   516   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   506   e-180
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   500   e-178
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   497   e-176
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   493   e-175
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   445   e-156
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   249   1e-79
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   244   1e-77
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   243   4e-77
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   242   1e-76
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   242   1e-76
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   241   2e-76
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   241   3e-76
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   239   2e-75
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   238   6e-75
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   234   8e-74
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            234   1e-73
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   233   4e-73
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   229   8e-72
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   227   6e-71
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              226   3e-70
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   223   2e-69
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   223   5e-69
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   218   3e-67
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   210   4e-65
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   209   5e-64
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   150   4e-41
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   142   3e-38
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   141   8e-38
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   140   2e-37
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   139   5e-37
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   138   8e-37
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              138   8e-37
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   138   1e-36
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   137   3e-36
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   136   6e-36
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   134   3e-35
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   133   7e-35
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   133   7e-35
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   133   9e-35
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   132   2e-34
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   130   1e-33
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   129   2e-33
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   129   3e-33
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   126   3e-32
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   126   3e-32
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    74   5e-14
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    74   5e-14
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    74   9e-14
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    70   9e-13
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    70   2e-12
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    70   2e-12
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    70   2e-12
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       69   4e-12
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    67   2e-11
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    65   5e-11
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    65   8e-11
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    64   1e-10
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    62   4e-10
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              62   8e-10
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    59   7e-09
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    57   2e-08
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    57   3e-08
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    56   6e-08
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    55   1e-07
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    55   2e-07
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    34   0.032
KNAG0L00830 Chr12 complement(145662..149741) [4080 bp, 1359 aa] ...    35   0.52 
KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {...    33   1.9  
KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {O...    32   2.1  
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...    31   5.8  

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/378 (91%), Positives = 346/378 (91%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
           DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDI                  ANIGDKISI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQNKANPTA              NEYGDKIENAVLKTIAASSKNRTGD
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 361 LGGTATTTSFTEAVIDNL 378
           LGGTATTTSFTEAVIDNL
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/378 (73%), Positives = 306/378 (80%), Gaps = 5/378 (1%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLR ++L   R +   +RFL+     QPSIGRFTGKP+ ATGK+ VSFIEGDGIGPEIS+
Sbjct: 1   MLRNSLL---RNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQ 57

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVKDIF+AA VPI WE CDV+PI V+GLTTIPD AV SINKNL+ LKGPLATPIGKGHRS
Sbjct: 58  SVKDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRS 117

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTFNLFANVRPAKS+ GFKTTY +VDLVLIRENTEGEYSGIEHVV PGVVQSIK
Sbjct: 118 LNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIK 177

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITRDASERVIRYAFEYAKAIGRP+V+VVHKSTIQRL+DGLFVNVAKEL KE  +  I+L
Sbjct: 178 LITRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKE--YPEIKL 235

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
           +TELIDNTVLNVV NP+ Y+DAV VCPNLYGDI                  ANIG++ISI
Sbjct: 236 ETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISI 295

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQNKANPTA               +   +IE AVL TIA+SSKNRTGD
Sbjct: 296 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGD 355

Query: 361 LGGTATTTSFTEAVIDNL 378
           LGG+ATT+SFT+AVI NL
Sbjct: 356 LGGSATTSSFTDAVIKNL 373

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 302/373 (80%), Gaps = 5/373 (1%)

Query: 6   MLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDI 65
           MLG   + +  +RFL   A  QPSIGRFTGKP+ +TGK+TVSFIEGDGIGPEIS SVK I
Sbjct: 1   MLGIRSFRLNARRFL---ATAQPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRI 57

Query: 66  FQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTL 125
           FQAA VP+ WETCDV+PI V+GLTTIPD AV+SINKNLV LKGPLATPIGKGHRSLNLTL
Sbjct: 58  FQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 117

Query: 126 RKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRD 185
           RKTFNLFANVRPAKS+ GFKTTY+NVDLVLIRENTEGEYSGIEH+V+PGVVQSIKLITRD
Sbjct: 118 RKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRD 177

Query: 186 ASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELI 245
           ASERVIRYA+EYA+AIGRP++IVVHKSTIQRL+DGLFVNVAKEL  E  + +I+L+TELI
Sbjct: 178 ASERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAE--YPDIQLETELI 235

Query: 246 DNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVH 305
           DNT LNVV NPS Y+DAV VCPNLYGDI                  ANIG K+SIFEAVH
Sbjct: 236 DNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVH 295

Query: 306 GSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTA 365
           GSAPDIAGQNKANPTA               E+ D+IE AVL TIA  S+ RTGDLGG+A
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSA 355

Query: 366 TTTSFTEAVIDNL 378
           +TTSFT+A+I  L
Sbjct: 356 STTSFTDAIIKKL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/378 (70%), Positives = 302/378 (79%), Gaps = 8/378 (2%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           M +Q++   +R      R+L+  + +QPSIGRFTGKP+  TGKYTVSFIEGDGIGPEIS+
Sbjct: 1   MFKQSIFKGSR------RYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQ 54

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVKDIF AA VP+ WE CDV+PI ++GLTTIPD AV+SINKNLV LKGPLATPIGKGHRS
Sbjct: 55  SVKDIFSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRS 114

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTF LFANVRPAKS+ GFKTTY+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIK
Sbjct: 115 LNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIK 174

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITRDASERVIRYAFEYA+A+GRPKV+VVHKSTIQRL+DGLFVNVA+E+ KE  + +IEL
Sbjct: 175 LITRDASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKE--YPDIEL 232

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
             ELIDNTVLNVV  P KYSD+V VCPNLYGDI                  ANIG  +SI
Sbjct: 233 QPELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSI 292

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQN ANPTA              +E+ D+IE+AVL T+A+  KNRT D
Sbjct: 293 FEAVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTAD 352

Query: 361 LGGTATTTSFTEAVIDNL 378
           L GTATT+SFT+AVI+ L
Sbjct: 353 LAGTATTSSFTKAVIERL 370

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/373 (71%), Positives = 300/373 (80%), Gaps = 4/373 (1%)

Query: 6   MLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDI 65
           ML    +   ++RFL+    +QPSIGR+TGKP+ +TGKYTVSFIEGDGIGPEIS+SVK I
Sbjct: 1   MLRNTFFRNTSRRFLATV--KQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI 58

Query: 66  FQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTL 125
           F AA+VPI WE+CDVSPI V+GLTTIPD AV+SI KNLV LKGPLATPIGKGHRSLNLTL
Sbjct: 59  FSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118

Query: 126 RKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRD 185
           RKTF LFANVRPAKS+ GFKTTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRD
Sbjct: 119 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178

Query: 186 ASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELI 245
           ASERVIRYAFEYA+AIGRP+VIVVHKSTIQRL+DGLFVNVAKEL KE  + ++ L+TELI
Sbjct: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDLTLETELI 236

Query: 246 DNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVH 305
           DN+VL VV NPS Y+DAV VCPNLYGDI                  ANIG KISIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 306 GSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTA 365
           GSAPDIAGQ+KANPTA                + D+I+NAVL TIA+  +NRTGDL GTA
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 366 TTTSFTEAVIDNL 378
           TT+SFTEAVI  L
Sbjct: 357 TTSSFTEAVIKRL 369

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/368 (71%), Positives = 294/368 (79%), Gaps = 2/368 (0%)

Query: 11  RYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAAS 70
           R TI    F  M    QP+IGRFTGKP+  TGKYTV FIEGDG+GPEIS+SVKDIF AA 
Sbjct: 3   RNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAAAK 62

Query: 71  VPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFN 130
           VPI WE CDV PI V+GLTTIPD AV+SINK+LV LKGPLATPIGKGHRSLNLTLRKTFN
Sbjct: 63  VPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRKTFN 122

Query: 131 LFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERV 190
           LFANVRPA+SV  +KTTY NVDLVLIRENTEGEYSGIEHV++PGV+QSIKLIT+DASERV
Sbjct: 123 LFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDASERV 182

Query: 191 IRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVL 250
           IRYAFEY +AIGRP+++VVHKSTIQR++DGLFVNVAKEL  E  + +IEL TELIDNT+L
Sbjct: 183 IRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASE--YPDIELQTELIDNTIL 240

Query: 251 NVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPD 310
           NVV +P  Y+DAV VCPNLYGDI                  ANIGDK+SIFEAVHGSAPD
Sbjct: 241 NVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPD 300

Query: 311 IAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSF 370
           IAGQNKANPTA              NE+  KIENA+L TIA+ S+NRTGDL GTATT+SF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSF 360

Query: 371 TEAVIDNL 378
           TEAVI+ L
Sbjct: 361 TEAVINKL 368

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/373 (71%), Positives = 298/373 (79%), Gaps = 4/373 (1%)

Query: 6   MLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDI 65
           ML    +   ++RFL+    +QPSIG++TGKP+ +TGKYTVSFIEGDGIGPEIS+SVK I
Sbjct: 1   MLRNTFFRNTSRRFLATV--KQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI 58

Query: 66  FQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTL 125
           F AA+VPI WE CDV+PI V+GLTTIPD AV+SI KNLV LKGPLATPIGKGHRSLNLTL
Sbjct: 59  FSAANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118

Query: 126 RKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRD 185
           RKTF LFANVRPAKSV GFKTTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRD
Sbjct: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178

Query: 186 ASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELI 245
           ASERVIRYAFEYA+AIGRP+VIVVHKSTIQRL+DGLFVNVAKEL KE  + +I L+TELI
Sbjct: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDITLETELI 236

Query: 246 DNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVH 305
           DN+VL VV NPS Y++AV VCPNLYGDI                  ANIG KISIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 306 GSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTA 365
           GSAPDIAGQ+KANPTA                Y D+I+NAVL TIA+  +NRTGDL G A
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAA 356

Query: 366 TTTSFTEAVIDNL 378
           TT+SFTEAVI  L
Sbjct: 357 TTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/363 (72%), Positives = 296/363 (81%), Gaps = 4/363 (1%)

Query: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75
           ++RFL+    +QPSIGRFTGKP+ +TG+YTVSFIEGDGIGPEIS+SVK IF AA+VPI W
Sbjct: 11  SRRFLATV--KQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEW 68

Query: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANV 135
           E+CDV+PI V+GLTTIPD AV+SI  NL+ LKGPLATPIGKGHRSLNLTLRKTF LFANV
Sbjct: 69  ESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 128

Query: 136 RPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAF 195
           RPAKSV GFKTTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYAF
Sbjct: 129 RPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAF 188

Query: 196 EYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMN 255
           EYA+AIGRP+VIVVHKSTIQRL+DGLFVNVAKEL KE  + +I L+TELIDN+VL VV N
Sbjct: 189 EYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDIILETELIDNSVLKVVTN 246

Query: 256 PSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQN 315
           PS Y++AV VCPNLYGDI                  ANIG KISIFEAVHGSAPDIAGQ+
Sbjct: 247 PSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQD 306

Query: 316 KANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVI 375
           KANPTA                + D+I+NAVL TIA+  +NRTGDL GTATT+SFTEAVI
Sbjct: 307 KANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVI 366

Query: 376 DNL 378
             L
Sbjct: 367 KRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/363 (72%), Positives = 297/363 (81%), Gaps = 4/363 (1%)

Query: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75
           T+RFLS++   QPSIG+FTGKP+ +TGK+TVSFIEGDGIGPEIS+SVK IF AA VPI W
Sbjct: 11  TRRFLSVK--NQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDW 68

Query: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANV 135
           E CDVSP+ ++GLTTIP+ AV+SINKNLV LKGPLATPIGKGHRSLNLTLRKTF LFANV
Sbjct: 69  EPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANV 128

Query: 136 RPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAF 195
           RPAKS+ GFKT YDNVDLV+IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYA+
Sbjct: 129 RPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAY 188

Query: 196 EYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMN 255
           EYA+AIGRP+VIVVHKSTIQRL+DGLFV+VAKEL +E  + +I+L+TELIDNTVLNVV N
Sbjct: 189 EYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE--YPDIQLETELIDNTVLNVVSN 246

Query: 256 PSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQN 315
           PS YS+AV VCPNLYGDI                  ANIG ++SIFEAVHGSAPDIAGQN
Sbjct: 247 PSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQN 306

Query: 316 KANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVI 375
           KANPTA              N + DKIE AVL TIA+  + RTGDL G ATT+SFT+AVI
Sbjct: 307 KANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVI 366

Query: 376 DNL 378
             L
Sbjct: 367 GRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/378 (70%), Positives = 300/378 (79%), Gaps = 9/378 (2%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLR   L   R T  ++RFLS    +QPSIGR+TGKPD +TG+YTVSFIEGDGIGPEIS+
Sbjct: 1   MLRNTFL---RNT--SRRFLSTV--KQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISK 53

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVK IF AA VPI WE CDV+PI V+GLTTIPD AV+SI KNLV LKGPLATPIGKGHRS
Sbjct: 54  SVKKIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRS 113

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTF LFANVRPAKS+ GFKTTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIK
Sbjct: 114 LNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIK 173

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITR+ASERVIRYAFEYA+AIGRP++IVVHKSTIQRL+DGLFVNVAKEL KE  + +I  
Sbjct: 174 LITREASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKE--YPDITF 231

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
           +TELIDN VLNVV NPS Y++AV VCPNLYGDI                  ANIG K+SI
Sbjct: 232 ETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSI 291

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAG++KANPTA                + D+I+NAVL TIA+  +NRTGD
Sbjct: 292 FEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGD 351

Query: 361 LGGTATTTSFTEAVIDNL 378
           L GTATT+SFTEAVI  L
Sbjct: 352 LAGTATTSSFTEAVIKRL 369

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/378 (68%), Positives = 297/378 (78%), Gaps = 7/378 (1%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLR  +  R        R L+    +QPSIG++TGKPD  TGKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRSQICRRT-----VNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISK 55

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVKDIF AA VPI WE+C V+P+LV+G+TTIP++A +SIN+NLV LKGPLATPIGKGHRS
Sbjct: 56  SVKDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRS 115

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           +NLTLRKTF LFANVRPAKSV GFKTTY++VDLVLIRENTEGEY+GIEHV+ PGVVQSIK
Sbjct: 116 MNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIK 175

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITR+ASERVIRYA+EYA+A+GRPK++VVHKSTIQRL+DGLFV VAKEL  E  F +I+L
Sbjct: 176 LITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHE--FPDIQL 233

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
            TELIDNTVLNVV NPSKYSD V+VCPNLYGDI                   NIG K+SI
Sbjct: 234 QTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSI 293

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQNKANPTA               E+  KIE AVL TIAA  ++RTGD
Sbjct: 294 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGD 353

Query: 361 LGGTATTTSFTEAVIDNL 378
           L G+A+T+SFTEAVI  L
Sbjct: 354 LAGSASTSSFTEAVISRL 371

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/378 (69%), Positives = 299/378 (79%), Gaps = 9/378 (2%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLR  +L +    +P +RFLS +  +QPSIGRFTGKP+ +TGKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRSQVLRQ----LP-RRFLSSK--KQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISK 53

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVKDIF AA VP+ WE+CDV+P+ ++GLTTIP  AV SINKNL+ LKGPLATPIGKGHRS
Sbjct: 54  SVKDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRS 113

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTF LFANVRPAKSV GFKTTY+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIK
Sbjct: 114 LNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIK 173

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITRDASERVIRYAFEYA+A+GRPKV+VVHKSTIQRL+DGLFV+VAKEL  E  + +I+L
Sbjct: 174 LITRDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSE--YPDIQL 231

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
             +L+DNTVLNVV NP  Y+D V VCPNLYGDI                  ANIG K+SI
Sbjct: 232 QLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSI 291

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQNKANPTA               E  D IE AVL TIA+  +NRT D
Sbjct: 292 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTAD 351

Query: 361 LGGTATTTSFTEAVIDNL 378
           L G+A+T+SFTEAVI  L
Sbjct: 352 LAGSASTSSFTEAVIKRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/378 (70%), Positives = 304/378 (80%), Gaps = 9/378 (2%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           M R ++L   R T  T+R LS++   QPSIG++TGKP+ +TGKYTVSFIEGDGIGPEIS 
Sbjct: 54  MFRSSIL---RTT--TRRLLSVK--HQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISN 106

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVK IF AA VPI WETCDV+P+ +DGLTTIP+ AV+SINKNLV LKGPLATPIGKGHRS
Sbjct: 107 SVKQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRS 166

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTF LFANVRPA+SV+GFKTTY NVDLVLIRENTEGEYSGIEHVVTPGVVQSIK
Sbjct: 167 LNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 226

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITR+ASERVIRYAFEY +AIGRP+++VVHKSTIQRLSDGLFVNVAKEL KE  + +I+ 
Sbjct: 227 LITREASERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE--YPDIQF 284

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
           +TELIDNTVL VV NPS Y+DAV VCPNLYGDI                   NIG++ISI
Sbjct: 285 ETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISI 344

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAG+N ANPTA              +++ D+IENAVL TIA+  ++RTGD
Sbjct: 345 FEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGD 404

Query: 361 LGGTATTTSFTEAVIDNL 378
           L GTATT++FT+AVI  L
Sbjct: 405 LAGTATTSTFTDAVIKKL 422

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/363 (70%), Positives = 293/363 (80%), Gaps = 4/363 (1%)

Query: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75
           + RFL+ +  +QPSIGR+TGKPD ATGKYTVSFIEGDG+GPEIS++VKDIF AA  PI W
Sbjct: 10  SARFLATK--KQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQW 67

Query: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANV 135
           E+CDVSP+ ++GLTTIP  A  SINKNL+ LKGPLATPIGKGHRSLNLTLRKTF LFANV
Sbjct: 68  ESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 127

Query: 136 RPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAF 195
           RPAKSV+G+KT YDNVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DASERVIRYAF
Sbjct: 128 RPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDASERVIRYAF 187

Query: 196 EYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMN 255
           EYA+A+ RPKV+VVHKSTIQRL+DGLFV+VA++L KE  + +IEL TELIDNTVL+ V +
Sbjct: 188 EYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKE--YPDIELQTELIDNTVLHTVRD 245

Query: 256 PSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQN 315
           P+KYSD V VCPNLYGDI                  ANIG K+SIFEAVHGSAPDIAGQN
Sbjct: 246 PTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQN 305

Query: 316 KANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVI 375
           KANPTA               E+ DKIE AV  TIAA  ++RTGDLGG+A+T+SF EAVI
Sbjct: 306 KANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVI 365

Query: 376 DNL 378
             L
Sbjct: 366 SRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/370 (69%), Positives = 293/370 (79%), Gaps = 4/370 (1%)

Query: 9   RARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQA 68
           R+++   T RF + +  +QPSIGR+TGKPD ATGKYTVSFIEGDG+GPEIS++VKDIF A
Sbjct: 3   RSQFGRNTLRFFATK--KQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 69  ASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKT 128
           A  PI WETCDV+P+ ++GLTTIP  A  SINKNL+ LKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 129 FNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASE 188
           F LFANVRPAKS++GFKT YDNVDLVLIRENTEGEYSGIEHVV PGVVQSIKLIT+DASE
Sbjct: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 189 RVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNT 248
           RVIRYAFEYA+A+ RPKV+VVHKSTIQRL+DGLFV+VA++L KE  + +IEL TELIDNT
Sbjct: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKE--YPDIELQTELIDNT 238

Query: 249 VLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSA 308
           VL+ V +P KYSD V VCPNLYGDI                  ANIG ++SIFEAVHGSA
Sbjct: 239 VLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSA 298

Query: 309 PDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTT 368
           PDIAGQNKANPTA               E+ DKIE AV  TIA+  +NRTGDL G+A+T+
Sbjct: 299 PDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTS 358

Query: 369 SFTEAVIDNL 378
           SF EAVI  L
Sbjct: 359 SFAEAVISRL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/378 (68%), Positives = 298/378 (78%), Gaps = 11/378 (2%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLRQ +   +R      R+L+  + RQPSIGR+ GKP+ A GKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRQKLFQGSR------RWLA--SVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQ 51

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVKDIF AASVP+ WE CDV+P+LV+GLTTIP+ AV SINKNLV LKGPLATPIGKGHRS
Sbjct: 52  SVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRS 111

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTF LFANVRPAKS+ G+KTTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIK
Sbjct: 112 LNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIK 171

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LITR+ASERVIRYAFEYA+ +GRPKV+VVHKSTIQRL+DGLFVNVA+EL +E  + +IEL
Sbjct: 172 LITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE--YPDIEL 229

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
            TEL+DNTVLNVV  P  Y D V VCPNLYGDI                  ANIG ++SI
Sbjct: 230 QTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSI 289

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQN+ANPTA              +E+  +IE AVL TIA+S +NRT D
Sbjct: 290 FEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTAD 349

Query: 361 LGGTATTTSFTEAVIDNL 378
           L GTA+T+SFT AVI+ L
Sbjct: 350 LAGTASTSSFTNAVIERL 367

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/378 (68%), Positives = 297/378 (78%), Gaps = 10/378 (2%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           M RQ+++ +      + RFL+ +  +QPSIGR+TGKP+  TGKYTVSFIEGDG+GPEIS+
Sbjct: 1   MFRQSIVKQ------SCRFLATK--KQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISK 52

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SVK IF AA VPI WE+CDVSPI V+GLTTIPD AV SINKNL+ LKGPLATPIGKGHRS
Sbjct: 53  SVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRS 112

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LNLTLRKTF LFANVRPAKS+ G+KTTY+NV+LVLIRENTEGEYSGIEHVV PGVVQSIK
Sbjct: 113 LNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIK 172

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           LIT+DASERVIRYAFEYA+A+ R KV+VVHKSTIQRL+DGLFV+VAK+L  E  + +IEL
Sbjct: 173 LITQDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSE--YPDIEL 230

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
            TEL+DNTVL  V +P  Y D V VCPNLYGDI                  ANIG  +SI
Sbjct: 231 QTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSI 290

Query: 301 FEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGD 360
           FEAVHGSAPDIAGQNKANPTA               E+ DKIE AVL TIA+ +KNRTGD
Sbjct: 291 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGD 350

Query: 361 LGGTATTTSFTEAVIDNL 378
           LGG+A+T+SFT+AVI+ L
Sbjct: 351 LGGSASTSSFTDAVIERL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  506 bits (1302), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/349 (69%), Positives = 287/349 (82%), Gaps = 2/349 (0%)

Query: 30  IGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLT 89
           +G++ G P+ +TG++TV FIEGDG+GPEIS+SVKDIF+AA VP+ WE CDVSP+L++GLT
Sbjct: 27  VGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLT 86

Query: 90  TIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYD 149
           TIP+ AV+ INK+ + LKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+S+RG++TTY 
Sbjct: 87  TIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146

Query: 150 NVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVV 209
           NVDLVLIRENTEGEYSGIEHVV PGVVQSIKLITRDASERVIRYA+EYA+AIGRP+++VV
Sbjct: 147 NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVV 206

Query: 210 HKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNL 269
           HKSTIQ+L+DGLFVN+AKEL  E  F +I+L+TELIDNTVLNVV +P  Y+DAV VCPNL
Sbjct: 207 HKSTIQKLADGLFVNIAKELAPE--FPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNL 264

Query: 270 YGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXXXXXX 329
           YGDI                  ANIG+++SIFEAVHGSAPDIAGQNKANPTA        
Sbjct: 265 YGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMM 324

Query: 330 XXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                   Y +KIENA+L TIA+ S+NRTGDL GTATT+SFTE+VI NL
Sbjct: 325 LNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  500 bits (1287), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 246/361 (68%), Positives = 286/361 (79%), Gaps = 5/361 (1%)

Query: 18  RFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWET 77
           RFLS     QPSIGRFTGKPD ATGK+TV FIEGDG+GPEIS SVK IF AA VPI W  
Sbjct: 13  RFLSTG---QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAKVPIEWVP 69

Query: 78  CDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRP 137
           CDV PI V+G TTIP+ AV+ INK+L+ LKGPLATPIGKGHRSLNLTLRKTFNLFANVRP
Sbjct: 70  CDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRP 129

Query: 138 AKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEY 197
           A+S+  +K+TY+NVDLVLIRENTEGEYSGIEHV+TPGV+QSIKLITR+A+ERV+RYAFEY
Sbjct: 130 ARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATERVVRYAFEY 189

Query: 198 AKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPS 257
            +AIGRP+++V+HKSTIQR++DGLFV VA+EL  E  + +I+L+TE+ID ++LNVV  P 
Sbjct: 190 TQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASE--YPDIKLETEIIDKSILNVVSKPE 247

Query: 258 KYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKA 317
            YSDAV VCPNLYGDI                  ANIGDK+SIFEAVHGSAPDIAGQNKA
Sbjct: 248 LYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKA 307

Query: 318 NPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDN 377
           NPTA              +E+ +KIENAVL TIA+ S+NRT DL GTA+T+SFTE VI  
Sbjct: 308 NPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQR 367

Query: 378 L 378
           L
Sbjct: 368 L 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  497 bits (1280), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 243/352 (69%), Positives = 285/352 (80%), Gaps = 3/352 (0%)

Query: 27  QPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVD 86
           QP+IGRFTGK  +++G YTV FIEGDG+GPEIS+SVKDIF AA+VPI W+ CDV PI V+
Sbjct: 28  QPTIGRFTGK-TNSSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPIFVN 86

Query: 87  GLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSVRGFKT 146
           GLTTIP+ AVK+I ++LV LKGPLATP+GKGHRSLNLTLRKTF+LFANVRPAKSV  +K+
Sbjct: 87  GLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPNYKS 146

Query: 147 TYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKV 206
           TY+NVDLVLIRENTEGEYSGIEH+VTPGVVQSIKLITR+ASE+VIRYA+EYA A+GRP++
Sbjct: 147 TYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGRPRL 206

Query: 207 IVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVC 266
           IVVHKSTIQRL DGLFV +A ELQ E  + +I+L+T+++DNTVLNVV NP+ Y DAV VC
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANELQSE--YPSIKLETQILDNTVLNVVSNPTLYKDAVSVC 264

Query: 267 PNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXXX 326
           PNLYGDI                  ANIGDK+SIFEAVHGSAPDIAGQNKANPTA     
Sbjct: 265 PNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSS 324

Query: 327 XXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                     E+  +IENAVL TIA+  ++RTGDLGG+ATT+SFTE VI  L
Sbjct: 325 VMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  493 bits (1268), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 284/357 (79%), Gaps = 2/357 (0%)

Query: 22  MQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVS 81
           M + +QPSIG+FTGKPD  TG Y VSFIEGDGIGPEIS+SVKDIF AA VP+ +E+  V 
Sbjct: 14  MFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFAAAKVPVDFESVVVK 73

Query: 82  PILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSV 141
           PILV+G+T+IP+EA KSIN NLV LKGPLATP+GKGHRS+NLTLRKTF LFAN+RPAKSV
Sbjct: 74  PILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRKTFGLFANLRPAKSV 133

Query: 142 RGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAI 201
            GFKT YDNV+LVLIRENTEGEY+GIEH + PGVVQSIKLITR+ASERVIR+A+EYA+A 
Sbjct: 134 EGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREASERVIRFAYEYARAA 193

Query: 202 GRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSD 261
            RP++IVVHKSTIQRLSDGLFV+VAKELQ E  F +I+L+TELIDN VLN V +P+KYSD
Sbjct: 194 ERPRLIVVHKSTIQRLSDGLFVDVAKELQSE--FPDIKLETELIDNAVLNTVTDPTKYSD 251

Query: 262 AVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTA 321
           AV VCPNLYGDI                   NIG K+SIFEAVHGSAPDIAG++KANPTA
Sbjct: 252 AVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTA 311

Query: 322 XXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                         +E+  +IE AVL TIAA  ++RTGDL G+A+T+SFTEAVI  L
Sbjct: 312 LLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  445 bits (1144), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 223/380 (58%), Positives = 275/380 (72%), Gaps = 6/380 (1%)

Query: 1   MLRQAMLGRARY--TIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEI 58
           ML+  +   ++Y  TI   R+  M A  + SIG F GKP+  TG YTV FIEGDG+GPEI
Sbjct: 1   MLKVGVPLSSKYIGTISKLRYF-MTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEI 59

Query: 59  SRSVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGH 118
           S+SV+ IF+AA VPI W  CD+ P+L++G TTIP  AV  IN +L+ LKGPLATP+G+GH
Sbjct: 60  SKSVRTIFKAAKVPIDWVNCDIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGH 119

Query: 119 RSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQS 178
           RS+NLTLRKTF LFANVRPAKS+    +TY+NVDL++IRENTEGEYSGIEH + PGVVQS
Sbjct: 120 RSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQS 179

Query: 179 IKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNI 238
           IKLITR ASE+VI+YAFEY ++IGR  +IVVHK+TIQR  DGLFV  A+E+  +  + ++
Sbjct: 180 IKLITRKASEKVIKYAFEYTRSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADK--YPDV 237

Query: 239 ELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKI 298
            L  ELIDNTVLN +MNP KY+D+V VCPNLYGDI                  ANIG+ +
Sbjct: 238 NLKLELIDNTVLNCIMNPEKYADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV 297

Query: 299 SIFEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRT 358
            ++EAVHGSAPDIAGQ+KANPTA               +Y D IE AVL TI +  + RT
Sbjct: 298 -LYEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRT 356

Query: 359 GDLGGTATTTSFTEAVIDNL 378
            DLGG+ATTTSFT+AVI+NL
Sbjct: 357 ADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  249 bits (637), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/361 (41%), Positives = 203/361 (56%), Gaps = 9/361 (2%)

Query: 20  LSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCD 79
           LS    R  + GR    P    G+YTV+ I GDGIG E++ SV  IF+A +VP+ WE+ +
Sbjct: 6   LSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDWESVE 65

Query: 80  VSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPA 138
           +S +  +       +AV+S+ +N VGLKG   TP  + GH SLN+  RK  ++FANV   
Sbjct: 66  LSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALF 123

Query: 139 KSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA 198
           KS  G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A
Sbjct: 124 KSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFA 183

Query: 199 KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSK 258
               R  V  VHK+ I +L DGLF N   E+   K +  + + + ++DN  +  V  P +
Sbjct: 184 LKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGA-KEYPEVNVSSIIVDNASMQAVAKPHQ 242

Query: 259 YSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKA 317
           +   V V PNLYG I                  AN G + ++FE        DI GQ+ A
Sbjct: 243 FD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVA 299

Query: 318 NPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDN 377
           NPTA              NEY D+I  A  +TI A  K  T D+GGTATTT FT AVID 
Sbjct: 300 NPTAMILSSTLMLRHLGLNEYADRISRATYETI-AEGKRTTKDIGGTATTTEFTNAVIDK 358

Query: 378 L 378
           L
Sbjct: 359 L 359

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  244 bits (624), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 202/344 (58%), Gaps = 9/344 (2%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAV 96
           P    G+YTV+ I GDG+G E++ SV +IF+A +VPI WE+ ++S  L + +  +  +AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAENVPIDWESVELSG-LEENMEGV-QKAV 80

Query: 97  KSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVL 155
           +S+ +N VGLKG  +TP  + GH SLN+  RK  ++FANV   KS  G KT   +VDLV+
Sbjct: 81  ESLKRNKVGLKGIWSTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVI 140

Query: 156 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQ 215
           IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ I 
Sbjct: 141 IRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRRSVCAVHKANIM 200

Query: 216 RLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXX 275
           +L DGLF N   E+   K +  +E+ + ++DN  +  V  P ++   V V PNLYG I  
Sbjct: 201 KLGDGLFRNTVNEIGA-KEYPELEVKSIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-L 256

Query: 276 XXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXXX 334
                           AN G + ++FE        DI GQ+ ANPTA             
Sbjct: 257 GNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLG 316

Query: 335 XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            N+Y D+I  A  + I A  K+ T D+GG A+TT FT+A++D L
Sbjct: 317 LNDYADRISKATYEVI-AEGKHTTKDIGGHASTTQFTKAIVDKL 359

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  243 bits (621), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 144/344 (41%), Positives = 199/344 (57%), Gaps = 10/344 (2%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAV 96
           P    G+YTV+ I GDG+G E++ SV  IF++ +VPI WET ++S +  D    +  +AV
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEISGL--DNEEGV-QKAV 78

Query: 97  KSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVL 155
            S+ +N VGLKG   TP  + GH SLN+ LRK  ++FANV   K+V G  + + NVDLV+
Sbjct: 79  DSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVV 138

Query: 156 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQ 215
           IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+AF++A    R  V  VHK+ I 
Sbjct: 139 IRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKANIM 198

Query: 216 RLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXX 275
           +L DGLF N   E+   K +  IE+   ++DN  +  V  P ++   V V PNLYG I  
Sbjct: 199 KLGDGLFRNCINEIGA-KEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-L 254

Query: 276 XXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXXX 334
                           AN G + ++FE        DI GQN ANPTA             
Sbjct: 255 GNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLG 314

Query: 335 XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            N Y D+I  A    I A +KN T D+GG+A+TT FT+A+I+ L
Sbjct: 315 LNSYADRISKATYDVI-AEAKNTTKDIGGSASTTDFTQAIIEKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  242 bits (617), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 205/365 (56%), Gaps = 17/365 (4%)

Query: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75
           +KR L+  A  Q         P    G+YTV+ I GDG+G E++ SV  IF++ ++PI W
Sbjct: 9   SKRSLATMAAEQL-------LPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDW 61

Query: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFAN 134
           ET ++S +  D    +  +AV+S+ +N VGLKG   TP  + GH SLN+ LRK  ++FAN
Sbjct: 62  ETVEISGL--DNQEGV-QKAVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFAN 118

Query: 135 VRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYA 194
           V   KSV G  + + NVD+V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+A
Sbjct: 119 VALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFA 178

Query: 195 FEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVM 254
           F++A    R  V  VHK+ I +L DGLF N   E+   K +  I++   ++DN  +  V 
Sbjct: 179 FDFAVKNNRKSVCAVHKANIMKLGDGLFRNCINEVGA-KEYPEIDVKNIIVDNASMQAVA 237

Query: 255 NPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAG 313
            P ++   V V PNLYG I                  AN G + ++FE        DI G
Sbjct: 238 KPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKG 294

Query: 314 QNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEA 373
           QN ANPTA              N Y D+I  A    I A +K  T D+GG+A+TT FTEA
Sbjct: 295 QNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVI-AEAKTTTQDIGGSASTTEFTEA 353

Query: 374 VIDNL 378
           +I  L
Sbjct: 354 IISKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  242 bits (617), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 204/345 (59%), Gaps = 12/345 (3%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEA 95
           P    G++TV+ I GDG+G EI+ SVK IF+A  +P+ WET ++      +G+     EA
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQTDHKEGVY----EA 77

Query: 96  VKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLV 154
           V+S+ +N +GLKG   TP  + GH SLN+ LRK  +++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 155 LIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTI 214
           +IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++AK   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 215 QRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIX 274
            +L DGLF N+  E+  +K + +I++ + ++DN  +  V  P ++   V V P++YG I 
Sbjct: 198 MKLGDGLFRNIITEIG-QKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 253

Query: 275 XXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXX 333
                            AN G   ++FE        DI GQN ANPTA            
Sbjct: 254 LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHL 313

Query: 334 XXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
             NEY  +I  AV +TI A  K+ T D+GG+++TT FT  +I+ L
Sbjct: 314 GLNEYATRISKAVHETI-AEGKHTTKDIGGSSSTTDFTNEIINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  241 bits (616), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 205/345 (59%), Gaps = 12/345 (3%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEA 95
           P    G++TV+ I GDG+G EI+ SV+ IF+A ++PI WET ++      +G+     EA
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGVY----EA 77

Query: 96  VKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLV 154
           V+S+ +N +GLKG   TP  + GH SLN+ LRK  +++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 155 LIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTI 214
           +IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++AK   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANI 197

Query: 215 QRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIX 274
            +L DGLF N+  E+  +K + +I++ + ++DN  +  V  P ++   V V P++YG I 
Sbjct: 198 MKLGDGLFRNIITEI-GQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 253

Query: 275 XXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXX 333
                            AN G   ++FE        DI GQN ANPTA            
Sbjct: 254 LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHL 313

Query: 334 XXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
             NEY  +I  AV +TI A  K+ T D+GG+++TT FT  +I+ L
Sbjct: 314 GLNEYATRISKAVHETI-AEGKHTTRDIGGSSSTTDFTNEIINKL 357

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  241 bits (615), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 197/346 (56%), Gaps = 14/346 (4%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTTIPD--E 94
           P    G+YTV+ I GDG+G E++ SV  IF+  ++PI WET D+S     GL    +   
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDIS-----GLENTENVQR 77

Query: 95  AVKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDL 153
           AV+S+ +N VGLKG   TP  + GH SLN+ LRK  ++FANV   KS+ G KT  +N+D+
Sbjct: 78  AVESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDM 137

Query: 154 VLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKST 213
           V+IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VIIRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 214 IQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDI 273
           I +L DGLF N   E+   + +  +++   ++DN  +  V  P ++   V V PNLYG I
Sbjct: 198 IMKLGDGLFRNTVNEIGANE-YPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI 254

Query: 274 XXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXX 332
                             AN G + ++FE        DI GQN ANPTA           
Sbjct: 255 -LGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRH 313

Query: 333 XXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
              N Y D+I  A    I +  K+ T D+GG+A+T+ FT AVI+ L
Sbjct: 314 LGLNAYADRISKATYDVI-SEGKSTTRDIGGSASTSEFTNAVIEKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  239 bits (609), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/368 (39%), Positives = 211/368 (57%), Gaps = 21/368 (5%)

Query: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75
           TKR L+  A  +  +      P    G+YTV+ I GDG+G E++ SV  IF+A +VP+ W
Sbjct: 7   TKRTLATVATTEKML------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDW 60

Query: 76  ETCDVSPILVDGLTTIPD--EAVKSINKNLVGLKGPLAT-PIGK-GHRSLNLTLRKTFNL 131
           +  D+S     G+    D   AV+S+ +N +GLKG   T P  + GH SLN+ LRK  ++
Sbjct: 61  DRVDIS-----GVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKELDI 115

Query: 132 FANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVI 191
           +ANV   KS+ G +    +VDLV+IRENTEGE+SG+EH   PGVV+S+K++T+D  ER+ 
Sbjct: 116 YANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQDNIERIA 175

Query: 192 RYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLN 251
           R+AF+YAK   R +V+ VHK+ I ++ DGLF N+ +E+  EK +  +++   ++DN  + 
Sbjct: 176 RFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEV-GEKEYPELQVGNIIVDNASMQ 234

Query: 252 VVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPD 310
            V NP ++   V V P++YG I                  AN G  +++FE        D
Sbjct: 235 TVANPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLD 291

Query: 311 IAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSF 370
           I GQN ANPTA              N   D+I  AV   I A  K+ T D+GGTA+TT F
Sbjct: 292 IKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVI-AEGKSVTRDIGGTASTTEF 350

Query: 371 TEAVIDNL 378
           TEAVI+ L
Sbjct: 351 TEAVINKL 358

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  238 bits (606), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 141/344 (40%), Positives = 198/344 (57%), Gaps = 10/344 (2%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAV 96
           P    G+YTV+ I GDG+G E++ SV  IF+A +VPI WET +++   VD    +  +AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINITG--VDSEEGV-QKAV 79

Query: 97  KSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVL 155
           +S+ +N +GLKG   TP  + GH SLN+  RK  ++FANV   K+V G KT   N+DLV+
Sbjct: 80  ESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLVV 139

Query: 156 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQ 215
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A    R  V  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 216 RLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXX 275
           +L DGLF N   E+   + +  I++   ++DN  +  V  P ++   V V PNLYG I  
Sbjct: 200 KLGDGLFRNTVNEVGASE-YPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-L 255

Query: 276 XXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXXX 334
                           AN G + ++FE        DI G++ ANPTA             
Sbjct: 256 GNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLG 315

Query: 335 XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            N Y D+I  A    I A  K+ T D+GG+++TT FT++VID L
Sbjct: 316 LNGYADRISKATYDVI-AEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  234 bits (598), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 140/345 (40%), Positives = 200/345 (57%), Gaps = 12/345 (3%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEA 95
           P    G++TV+ + GDG+G EI+ SV  IF++ +VPI WET D+S +   +G+      A
Sbjct: 21  PKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGLDHTEGVKA----A 76

Query: 96  VKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLV 154
           V S+ +N +GLKG   TP  + GH SLN+  RK  +++ANV   KS+ G KT   NVDLV
Sbjct: 77  VDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLV 136

Query: 155 LIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTI 214
           +IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++AK   R  V  VHK+ I
Sbjct: 137 VIRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSVTAVHKANI 196

Query: 215 QRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIX 274
            +LSDGLF N   ++ +E+ +  I+  + ++DN  +  V  P ++   V V P++YG I 
Sbjct: 197 MKLSDGLFRNTVSKIGEEE-YPEIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI- 252

Query: 275 XXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXX 333
                             N G   ++FE        DI GQN ANPTA            
Sbjct: 253 VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHL 312

Query: 334 XXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
              +  ++I++AV   I A  K  T D+GG+A+TT FT+AVI+ L
Sbjct: 313 GLEKSANRIKSAVYDVI-AEGKATTQDIGGSASTTEFTQAVINKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  234 bits (598), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/381 (38%), Positives = 207/381 (54%), Gaps = 22/381 (5%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           M +  +  R   T+P   F     P           P    G+YTV+ I GDG+G E++ 
Sbjct: 1   MFKTVLAKRGLATVPATGFRGFLNPL----------PKEYGGRYTVTLIPGDGVGKEVTD 50

Query: 61  SVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKG-H 118
           SV  IF A ++PI WE  D+S +   +G+    + AV S+ +N +GLKG   T  G+  H
Sbjct: 51  SVVSIFNAENLPIDWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDH 106

Query: 119 RSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQS 178
            SLN+ LRK  +++ANV   K++ G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S
Sbjct: 107 GSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVES 166

Query: 179 IKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNI 238
           +K+IT++ SER+ R+AF++AK   R  V  VHK+ I +L DGLF N    +  E  + +I
Sbjct: 167 LKIITKEKSERIARFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIG-ETEYPDI 225

Query: 239 ELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKI 298
           ++ + ++DN  +  V  P ++   V V P++YG I                  AN G + 
Sbjct: 226 KVSSIIVDNASMQSVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTEC 282

Query: 299 SIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNR 357
           ++FE        DI GQN ANPTA              N    KIE+AV KTI A  K  
Sbjct: 283 AVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTI-AEGKVT 341

Query: 358 TGDLGGTATTTSFTEAVIDNL 378
           T D+GG+A+TT FT  +I  L
Sbjct: 342 TRDIGGSASTTEFTNEIIKKL 362

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  233 bits (594), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 203/345 (58%), Gaps = 12/345 (3%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEA 95
           P    G++TV+ I GDG+G EI+ SV+ IF+A  +P+ WET ++      +G+     EA
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQTDHKEGVY----EA 77

Query: 96  VKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLV 154
           V+S+ +N +GLKG   TP  + GH SLN+ LRK  +++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 155 LIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTI 214
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++AK   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 215 QRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIX 274
            +L DGLF N+  E+ + + + +I++ + ++DN  +  V  P ++   V V P++YG I 
Sbjct: 198 MKLGDGLFRNIITEIGQTE-YPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 253

Query: 275 XXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXX 333
                            AN G   ++FE        DI GQN ANPTA            
Sbjct: 254 LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHL 313

Query: 334 XXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
             NE   +I  AV +TI A  K+ T D+GG+++TT FT  VI+ L
Sbjct: 314 GLNENATRISKAVHETI-AEGKHTTRDIGGSSSTTDFTNEVINKL 357

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  229 bits (585), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 203/364 (55%), Gaps = 18/364 (4%)

Query: 23  QAPRQPSIGRFTGK----PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETC 78
           Q   + SI  FT      P    G+YTV+ I GDGIG E++ SV  IF +  +PI WE  
Sbjct: 4   QVVSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERI 63

Query: 79  DVSPILVDGLTTIPD--EAVKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANV 135
           DV      G++   +  +AV+S+ +N +GLKG   T   + G+ SLN+ LRK  ++FANV
Sbjct: 64  DVP-----GMSNENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANV 118

Query: 136 RPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAF 195
              KS++G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF
Sbjct: 119 AIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAF 178

Query: 196 EYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMN 255
           ++A    R  V  VHK+ I +LSDGLF N   E+  EK + +I+++T ++DN  +  V  
Sbjct: 179 DFALENNRSTVTAVHKANIMKLSDGLFKNTVAEV-GEKEYPDIKVNTIIVDNASMQAVAK 237

Query: 256 PSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQ 314
           P ++   V V P++YG I                  AN G + ++FE        DI  Q
Sbjct: 238 PHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQ 294

Query: 315 NKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           N ANPTA               E   +I NAV   I    K  T D+GG A+TT FT+AV
Sbjct: 295 NIANPTAMILSATLMLNQLGLREESKRISNAVYAVI-EEGKTTTKDIGGNASTTEFTDAV 353

Query: 375 IDNL 378
           ID L
Sbjct: 354 IDKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  227 bits (579), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 146/371 (39%), Positives = 205/371 (55%), Gaps = 20/371 (5%)

Query: 11  RYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAAS 70
           R TI  KR L+   P++  +      P    G+ TV+ + GDG+G EI+ SV  IFQA +
Sbjct: 3   RQTI-AKRTLATFIPKETIL------PKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAEN 55

Query: 71  VPITWETCDVSPI-LVDGLTTIPDEAVKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKT 128
           VPI WET D+S +   DG+    + AV+S+ +N +GLKG   T   + GH SLN+  RK 
Sbjct: 56  VPIDWETVDISQLDHEDGV----NAAVESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQ 111

Query: 129 FNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASE 188
            +++ANV   KS+ G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SE
Sbjct: 112 LDIYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVNSE 171

Query: 189 RVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNT 248
           R+ ++AF++A    R  V  VHK+ I +LSDGLF N    + +   +  I+ D+ ++DN 
Sbjct: 172 RIAKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEA--YPQIKNDSIIVDNA 229

Query: 249 VLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGS 307
            +  V  P ++   V V P++YG I                   N G + ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHV 286

Query: 308 APDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATT 367
             DI GQN ANPTA              N+   +I  AV   I   +   T D+GG A+T
Sbjct: 287 GLDIKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEGNAT-TKDIGGNAST 345

Query: 368 TSFTEAVIDNL 378
           T FT+AVID L
Sbjct: 346 TEFTKAVIDKL 356

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  226 bits (575), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 143/382 (37%), Positives = 205/382 (53%), Gaps = 30/382 (7%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLR+ +  R+  T+P   F                 P+   G+YTV+ + GDG+G E + 
Sbjct: 1   MLRRLVSKRSLATLPETLF-----------------PNKYGGRYTVTLLPGDGVGKECTD 43

Query: 61  SVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEAVKSINKNLVGLKGPLATPIG--KG 117
           SV  +F A ++PI WE  ++S +   +G+      AV+S+ +N +GLKG   T      G
Sbjct: 44  SVVSVFNAENIPIDWEIVNISGLDHKEGVAA----AVQSLRRNKIGLKGLWHTSNADQSG 99

Query: 118 HRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQ 177
           H SLN+  RK  +++ANV   KS++G KT   +VDLV+IRENTEGE+SG+EH    GVV+
Sbjct: 100 HGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVE 159

Query: 178 SIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQN 237
           S+K+ T   +ER+ R+AF YA+  GR  V  VHK+ I +L DGLF N    +  EK + +
Sbjct: 160 SLKVTTLPKTERIARFAFNYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSI-GEKEYPD 218

Query: 238 IELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDK 297
           IE  + ++DN  +  V  P ++   V V P++YG I                  AN G +
Sbjct: 219 IETSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGRE 275

Query: 298 ISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKN 356
            ++FE        DI GQN ANPTA               + G +I +AV + IA     
Sbjct: 276 YAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDV- 334

Query: 357 RTGDLGGTATTTSFTEAVIDNL 378
           RT D+GG ATTT FT+AVI+ L
Sbjct: 335 RTKDIGGDATTTEFTQAVIEKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  223 bits (569), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 199/348 (57%), Gaps = 17/348 (4%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPI-LVDGLTTIPDEA 95
           P    G++ V+ I GDG+G E++ SV  IF+A ++PI W+  D+S +   +G+      A
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGVQA----A 77

Query: 96  VKSINKNLVGLKG----PLATPIGKGHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNV 151
           V S+ +N +GLKG      A   GKG  SLN+ LRK  +++ANV   KSV G KT   NV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 152 DLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHK 211
           DLV+IRENTEGEYSG+EH   PGVV+S+K++T D +ER+ R+AF++AK   R  V  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 212 STIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYG 271
           + I +L DGLF NV   +  E+ + ++++ + ++DN  +  V  P ++   V V P++YG
Sbjct: 196 ANIMKLGDGLFRNVVTRV-GEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYG 252

Query: 272 DIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPTAXXXXXXXXX 330
            I                  AN G + ++FE        DI  +N ANPTA         
Sbjct: 253 TI-LGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLML 311

Query: 331 XXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                +    KI NAV + I A  K+ T D+GG+A+TT FT+AVI+ L
Sbjct: 312 DHLGLSTSATKISNAVHQVI-AEGKSTTPDIGGSASTTEFTQAVIEKL 358

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  223 bits (567), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 198/362 (54%), Gaps = 10/362 (2%)

Query: 19  FLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETC 78
           F ++Q     S+ +    P    G+YTV+ I GDG+G EI+ SV  IF+A ++P+ WE  
Sbjct: 2   FRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERV 61

Query: 79  DVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIG-KGHRSLNLTLRKTFNLFANVRP 137
           D+S    D +  +  +AV+S+ +N +GLKG   T      H S N+ LRK  ++FA+V  
Sbjct: 62  DIST--SDNIQDV-SQAVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAF 118

Query: 138 AKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEY 197
            KSV G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++
Sbjct: 119 FKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDF 178

Query: 198 AKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPS 257
           AK   R  V  VHK+ I ++ DGLF N   E+   + + +I+  + ++DN  +  V  P 
Sbjct: 179 AKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANE-YPDIQTSSIIVDNASMQAVAKPH 237

Query: 258 KYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNK 316
           ++   V V P++YG I                  A+ G + ++FE        DI G+N 
Sbjct: 238 QFD--VMVTPSMYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNV 294

Query: 317 ANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVID 376
           ANPTA               E   +I  A    I+      T D+GG+A+TT FTEA+I 
Sbjct: 295 ANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVT-TKDIGGSASTTEFTEAIIK 353

Query: 377 NL 378
            L
Sbjct: 354 RL 355

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  218 bits (554), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 196/365 (53%), Gaps = 17/365 (4%)

Query: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75
           +KR  +  A R+  I      P    G+YTV+ + GDG+G EI+ SV  IF+A ++PI W
Sbjct: 7   SKRAFTSIASRENII------PKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDW 60

Query: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFAN 134
           E  ++S +  + + T    AV+S+ +N +GLKG   T     GH S N+ LRK  +++AN
Sbjct: 61  ERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYAN 116

Query: 135 VRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYA 194
           V   KS +G  T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T   +ER+ R+A
Sbjct: 117 VAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFA 176

Query: 195 FEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVM 254
           F+YA    R  V  VHK+ I +L DGLF N+  E+   K +  + + + ++DN  +  V 
Sbjct: 177 FDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGA-KEYPEVGVSSIIVDNASMQAVA 235

Query: 255 NPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAG 313
            P ++   V V P++YG I                  AN G   ++FE        DI  
Sbjct: 236 KPHQFD--VMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIEN 292

Query: 314 QNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEA 373
           QN ANPTA                   +I  AV + I A  K  T D+GG+ATTT FT A
Sbjct: 293 QNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVI-AEGKTTTRDIGGSATTTEFTNA 351

Query: 374 VIDNL 378
           VI  L
Sbjct: 352 VIAKL 356

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  210 bits (535), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 175/286 (61%), Gaps = 9/286 (3%)

Query: 37  PDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAV 96
           P    G++TV+ I GDG+G E++ SVK IF+A ++PI WET ++     D    + +EAV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQ--TDHKEGV-NEAV 78

Query: 97  KSINKNLVGLKGPLATPIGK-GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVL 155
           +S+ +N +GLKG   TP  + GH SLN+ LRK  +++ANV   KS++G KT   ++DL++
Sbjct: 79  ESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 156 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQ 215
           IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++AK   R  V  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 216 RLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXX 275
           +L DGLF N+  E+  +K + +I++ + ++DN  +  V  P ++   V V P++YG I  
Sbjct: 199 KLGDGLFRNIITEI-GQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 276 XXXXXXXXXXXXXXXXANIGDKISIFE-AVHGSAPDIAGQNKANPT 320
                           AN G   ++FE        DI GQN ANPT
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  209 bits (532), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 199/379 (52%), Gaps = 34/379 (8%)

Query: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60
           MLR  +L R+  TI  K++                      G++ ++ I G+GIG E++ 
Sbjct: 1   MLRNTLLRRSISTISPKKY---------------------GGRFQITLIPGNGIGKEVTD 39

Query: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120
           SV+ IFQA ++PI WE  ++     DG+ T    AV SI +N + LKG  ++    G  S
Sbjct: 40  SVRSIFQAENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG--S 92

Query: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180
           LN+ LRK  ++FANV   KS     T   NVDLV+IRENTEGE+SG+EH    GVV+S+K
Sbjct: 93  LNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLK 152

Query: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240
           ++T+  +ER+ R+AF++AK   R  V  VHK+ I +L DGLF N+   +   + +  I+ 
Sbjct: 153 IVTKPKTERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNE-YPEIKN 211

Query: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISI 300
            + ++DN  +  V  P ++   V V P++YG I                  AN G   ++
Sbjct: 212 SSIIVDNASMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAV 268

Query: 301 FE-AVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTG 359
           FE        DI GQN ANPTA                  ++I NAV K + A     T 
Sbjct: 269 FEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAV-KHVIAQGTTVTK 327

Query: 360 DLGGTATTTSFTEAVIDNL 378
           D+GGTA+TT FT+AVI+ L
Sbjct: 328 DIGGTASTTEFTDAVINEL 346

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 174/365 (47%), Gaps = 39/365 (10%)

Query: 40  ATGKYTVSFIEGDGIGPEISRSVKDI-----------FQAASVPITWETCDVSPILVDGL 88
           A    T+  I GDGIG E+  + K +           F+   +   W+T       +D  
Sbjct: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQT------FLDTG 72

Query: 89  TTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFK 145
             +PDE V  + +   G L G + +P  K  G+ S  + LRK   L+AN+RP KSV G  
Sbjct: 73  KALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG-- 130

Query: 146 TTYDNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA-- 198
           T    VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A  
Sbjct: 131 TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190

Query: 199 --KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKN---FQNIELDTELIDNTVLNVV 253
             K  G+  + V HKS +   SDGLF  V +++  EKN   + N+  + +++D+ V  + 
Sbjct: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-EKNKDLYGNVSYNEQIVDSMVYRIF 249

Query: 254 MNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAG 313
             P  +   V V PNLYGDI                  AN+G  I I E  HGSAPDI+G
Sbjct: 250 REPECFD--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPDIIIGEPCHGSAPDISG 306

Query: 314 QNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEA 373
           Q  +NP A              NE    I+NAV + I  S K +T DLGG ++TT  T+ 
Sbjct: 307 QGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENI-RSGKIKTPDLGGDSSTTEVTDD 365

Query: 374 VIDNL 378
           ++  L
Sbjct: 366 ILSKL 370

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  142 bits (358), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 168/353 (47%), Gaps = 25/353 (7%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99
           T+  I GDGIG E+  + K + +  +    + ++  D+       +D    +PDE V+ +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156
                G L G + +P  K  G+ S  + LRK   LFANVRP KSV G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR--PVDMVIV 144

Query: 157 RENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGRPKVI 207
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    K  G+  + 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 208 VVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
           V HKS +   SDGLF  + K++ +  +  + +I  + +++D+ V  +   P  +   V V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 266 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXX 325
            PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A    
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 326 XXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                     N+    I  AV   +   +K +T DLGG +TT   TE V+  L
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANM-RENKIKTPDLGGNSTTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  141 bits (355), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 168/354 (47%), Gaps = 26/354 (7%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99
           T+  I GDGIG E+  + K + Q  +    + ++  D+       +D    +PDE ++ +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156
                G L G + +P  K  G+ S  + LRK   L+ANVRP KSV G  TT   VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 157 RENTEG------EYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPKV 206
           RENT        E + I+      V ++ K I+  A+ R+   A + A    K  G+  +
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 207 IVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVF 264
            V HKS +   SDGLF  + K++ +  +  +  I  + +++D+ V  +   P  +   V 
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260

Query: 265 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXX 324
           V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  +NP A   
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 325 XXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                      NE    I  AV   +   +K +T DLGG +TT   TE V+  L
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANL-KENKVKTPDLGGKSTTQEVTEDVLARL 372

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  140 bits (352), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 174/363 (47%), Gaps = 33/363 (9%)

Query: 36  KPDHATGK-YTVSFIEGDGIGPEI----SRSVKDIFQAASVPITWETCDVS-PILVDGLT 89
           K  +AT K  T+  I GDGIG E+     R ++ I +   +  ++E  D      ++   
Sbjct: 12  KATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGN 71

Query: 90  TIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKT 146
            +P   V+++ +   G L G + +P  K  G+ S  + LR+   L+AN+RP KSV G   
Sbjct: 72  ALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--- 128

Query: 147 TYDNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERV----IRYAFEY 197
           T   VDLV++RENTE  Y   E           V ++IK I+  A+ER+    +R A + 
Sbjct: 129 TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQR 188

Query: 198 AKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMN 255
            +  GR  + V HKS +   +DGLF  V +E+ +  +K++ +IE + +++D+ V  +   
Sbjct: 189 QRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKE 248

Query: 256 PSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQN 315
           P  +   V V PNLYGD+                   N+G+ I I E  HGSAPDIAG+ 
Sbjct: 249 PHCFD--VVVAPNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRG 305

Query: 316 KANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNR---TGDLGGTATTTSFTE 372
            ANP A               E    I+ AV   +    K+R   + DLGG  TT    +
Sbjct: 306 IANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNL----KDRQVVSPDLGGKNTTQEVLD 361

Query: 373 AVI 375
            ++
Sbjct: 362 DIL 364

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  139 bits (349), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/347 (33%), Positives = 159/347 (45%), Gaps = 36/347 (10%)

Query: 44  YTVSFIEGDGIGPEI---SRSVKDI--------FQAASVPITWETCDVSPILVDGLTTIP 92
           +T+  I GDGIG E+    R V +         F+   +   W+T       +D    +P
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT------FLDTGKALP 73

Query: 93  DEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYD 149
           D+ V+ +  N  G L G + +P  K  G+ S  + LRK   L+AN+RP KSV G  T   
Sbjct: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDR 131

Query: 150 NVDLVLIRENTEGEYSGIEHVV----TPG-VVQSIKLITRDASERVIRYAFEYA----KA 200
            VDLV+ RENTE  Y   E       T G V ++IK I+  A+  +   A E A    K 
Sbjct: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191

Query: 201 IGRPKVIVVHKSTIQRLSDGLFVNVAKEL-QKEKNFQNIELDTELIDNTVLNVVMNPSKY 259
            G   + V HKS +   SDGLF  + K + Q  K F N++ + +++D+ V  +   P  +
Sbjct: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF 251

Query: 260 SDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANP 319
              V V PNLYGDI                   N+G  I I E  HGSAPDI GQ  ANP
Sbjct: 252 D--VIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIVGQGIANP 308

Query: 320 TAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTAT 366
            A               E    IE  V + I   +K +T DLGG +T
Sbjct: 309 IATIRSAALLLEFLGLPEAARHIEKVVDENI-RENKIKTPDLGGNST 354

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  138 bits (348), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 164/353 (46%), Gaps = 25/353 (7%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99
           T+  I GDGIG E+  + K + Q  +    + +E  D+       +D    +P + V  +
Sbjct: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82

Query: 100 -NKNLVGLKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156
            NK    L G + +P  K  G+ S  + LRK   LFANVRP K+V G  T    +DLV++
Sbjct: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140

Query: 157 RENTEGEYSGIEHVVT-----PGVVQSIKLITRDASERVIRYAFEYA----KAIGRPKVI 207
           RENTE  Y  IE   T       + ++ K IT  A++R+ + A + A    K  G   + 
Sbjct: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200

Query: 208 VVHKSTIQRLSDGLFVNVAKELQKEKN--FQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
           V HKS +   SDGLF  V KE+ +     +  +  + +++D+ V  +   P  +   V V
Sbjct: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258

Query: 266 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXX 325
            PNLYGDI                  AN+G  I I E  HGSAPDIAG+  ANP A    
Sbjct: 259 APNLYGDILSDGAAALVGSLGLVPS-ANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317

Query: 326 XXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                     +     I  AV   I   +K +T DLGG +TT    + ++  L
Sbjct: 318 TAQMLEYLGYSNPAQDIYKAVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  138 bits (348), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 167/353 (47%), Gaps = 25/353 (7%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99
           T+  I GDGIG E+  + K + Q+ +    + ++  D+        D    +PDE V+ +
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQIL 85

Query: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156
            +   G L G + +P  K  G+ S  + LRK   L+AN+RP KSV G  +    VD++++
Sbjct: 86  KEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIV 143

Query: 157 RENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGRPKVI 207
           RENTE  Y  IE           V ++ K I+  A++R+   A + A    +  G+  + 
Sbjct: 144 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQNNGKATLT 203

Query: 208 VVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
           V HKS +   SDGLF  V +E+ +  +  +  I  + +++D+ V  +   P  +   V V
Sbjct: 204 VTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIV 261

Query: 266 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXX 325
            PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A    
Sbjct: 262 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 320

Query: 326 XXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                     NE    I  AV   +      +T DLGG ATT +  + ++  L
Sbjct: 321 TALMLEFLGHNEAAQDIHKAVDANL-RDGLVKTADLGGNATTQNVVDDILARL 372

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  138 bits (347), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 114/359 (31%), Positives = 168/359 (46%), Gaps = 37/359 (10%)

Query: 45  TVSFIEGDGIGPEISRSVKDI-----------FQAASVPITWETCDVSPILVDGLTTIPD 93
           T+  I GDGIG E+  + K I           F+   +   WET        +    +PD
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79

Query: 94  EAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDN 150
           E V+ + ++  G L G + +P  K  G+ S  + LRK   LFANVRP K+V G  T    
Sbjct: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137

Query: 151 VDLVLIRENTEGEYSGIEHVVT-PG----VVQSIKLITRDASERVIRYAFEYA----KAI 201
           VD+V++RENTE  Y  IE   T P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197

Query: 202 GRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKY 259
           G   + V HKS +   SDGLF  + K++ +  +  +  I+ + +++D+ V  +   P  +
Sbjct: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257

Query: 260 SDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANP 319
              V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP
Sbjct: 258 D--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANP 314

Query: 320 TAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            A               E    I  AV   I   ++ +T DLGG +TT    + ++  +
Sbjct: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNI-RENQIKTPDLGGKSTTQQVVDDILSKI 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  137 bits (344), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 166/357 (46%), Gaps = 33/357 (9%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSPILVDGLTT-------IPDEA 95
           T+  I GDGIG E+  + K + +  +    +++   D    L  G  T       +PDE 
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80

Query: 96  VKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVD 152
           VK + +   G L G + +P  K  G+ S  + LR+   LFANVRP KSV G K     +D
Sbjct: 81  VKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--KPID 138

Query: 153 LVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGR 203
           +V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G+
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQ 198

Query: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSD 261
             + V HKS +   SDGLF  + KE+ +  +  +  I+ + +++D+ V  +   P  +  
Sbjct: 199 ATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257

Query: 262 AVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTA 321
            V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A
Sbjct: 258 -VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIA 315

Query: 322 XXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                         NE    I  AV   +   S  +T DLGG A+T    + V+  L
Sbjct: 316 TIRSTALMLEFLGHNEAAQDIYKAVDANLREGSI-KTPDLGGKASTQQVVDDVLSRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  136 bits (342), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 166/352 (47%), Gaps = 23/352 (6%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99
           T+  I GDGIG E+  + K + Q  S    + +   D+       +D    +PDE VK +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156
            +   G L G + +P  +   + S  + LRK   L+AN+RP KSV G  +    VD+V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143

Query: 157 RENTEGEYSGIEHVVTPG----VVQSIKLITRDASERVIRYAFEYA----KAIGRPKVIV 208
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    K  G+  + V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 209 VHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVC 266
            HKS +   SDGLF  + K++ +  +  +  I  + ++ID+ V  +   P  +   V V 
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261

Query: 267 PNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXXX 326
           PNLYGDI                  AN+G  I + E  HGSAPDIAG+  ANP A     
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 327 XXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                     E    I  AV   +   +K +T DLGG ++T +  + V++ L
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNM-RENKIKTPDLGGNSSTQNVVDDVLEKL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  134 bits (337), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 164/357 (45%), Gaps = 33/357 (9%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSPILVDGLTT-------IPDEA 95
           T+  I GDGIG E+  + K + +  +    +++   D    L  G  T       +PDE 
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80

Query: 96  VKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVD 152
           VK + +   G L G + +P  K  G+ S  + LR+   LFANVRP KSV G K     +D
Sbjct: 81  VKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPID 138

Query: 153 LVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGR 203
           +V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGE 198

Query: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSD 261
             + V HKS +   SDGLF  + KE+ +  +  +  I+ + +++D+ V  +   P  +  
Sbjct: 199 ATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257

Query: 262 AVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTA 321
            V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A
Sbjct: 258 -VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIA 315

Query: 322 XXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                         N     I  AV   +   +  +T DLGG A+T    E V+  L
Sbjct: 316 TIRSTALMLEFLGHNNAAQDIYKAVDANLREGAI-KTPDLGGKASTQQVVEDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  133 bits (334), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 116/359 (32%), Positives = 158/359 (44%), Gaps = 37/359 (10%)

Query: 45  TVSFIEGDGIGPEISRSVKDI-----------FQAASVPITWETCDVSPILVDGLTTIPD 93
           T+  I GDGIG E+  + K I           F+   +   WET        +    +PD
Sbjct: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75

Query: 94  EAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDN 150
           E +  +     G L G + +P  K  G+ S  + LRK   LFANVRP KSV G K     
Sbjct: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--K 133

Query: 151 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAI---- 201
           VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+      
Sbjct: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193

Query: 202 GRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKY 259
           G   + V HKS +   SDGLF  V +E  +  +  +  ++ + +++D+ V  +   P  +
Sbjct: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253

Query: 260 SDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANP 319
              V V PNLYGDI                  AN+G  I I E  HGSAPDIAG+  +NP
Sbjct: 254 D--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISNP 310

Query: 320 TAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            A               E    I  AV   I    K  T DLGG +TT    E V+  L
Sbjct: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  133 bits (334), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 167/360 (46%), Gaps = 39/360 (10%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGLTTIPD 93
           T+  I GDGIG E+  + K + +  S           +   W+T       +D    +PD
Sbjct: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQT------FLDTGKALPD 75

Query: 94  EAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDN 150
           E ++ +  +  G L G + +P  K  G+ S  + LRK   L+ANVRP KSV+G  T    
Sbjct: 76  ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRP 133

Query: 151 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA----KAI 201
           VD++++RENTE  Y     + I+      V ++IK I+  A+  + + A E +    KA 
Sbjct: 134 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKAN 193

Query: 202 GRPKVIVVHKSTIQRLSDGLFVNVAK---ELQKEKNFQNIELDTELIDNTVLNVVMNPSK 258
           G+  + V HKS +   SDGLF  V K   E  KE+ +  I  + +++D+ V  +   P  
Sbjct: 194 GKATLTVTHKSNVLSQSDGLFREVCKNVYESNKER-YGAIGYNEQIVDSMVYRLFREPEC 252

Query: 259 YSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKAN 318
           +   V V PNLYGDI                  AN+G    + E  HGSAPDIAG+  +N
Sbjct: 253 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGHDFIVGEPCHGSAPDIAGKGISN 309

Query: 319 PTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
           P A               E    I  AV   I   ++ +T DLGG +TT    + ++  +
Sbjct: 310 PIATIRSTALMLEFMGYTEAAQDIHKAVDTNI-RENQIKTPDLGGKSTTQQVVDDILSKM 368

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  133 bits (334), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 164/357 (45%), Gaps = 33/357 (9%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSPILVDGLTT-------IPDEA 95
           T+  I GDGIG E+  + K I +  +    +++   D    L  G  T       +PDE 
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80

Query: 96  VKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVD 152
           +K +     G L G + +P  K  G+ S  + LR+   L+ANVRP KSV G K     +D
Sbjct: 81  IKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PID 138

Query: 153 LVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGR 203
           +V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGE 198

Query: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSD 261
             + V HKS +   SDGLF  + K++ +  +  +  I+ + +++D+ V  +   P  +  
Sbjct: 199 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257

Query: 262 AVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTA 321
            V V PNLYGDI                  AN+G  I I E  HGSAPDIAG+  ANP A
Sbjct: 258 -VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVIGEPCHGSAPDIAGKGIANPIA 315

Query: 322 XXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                         N+    I  AV   +   +   T DLGG A+T    + V+  L
Sbjct: 316 TIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  132 bits (331), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 118/379 (31%), Positives = 172/379 (45%), Gaps = 46/379 (12%)

Query: 27  QPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDI-----------FQAASVPITW 75
           Q +IG  + K +      T+  I GDGIG E+  S + +           F    +   W
Sbjct: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66

Query: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLF 132
           +T       +D    +P E VK++ +N  G L G + +P  K  G+ S  + LRK   L+
Sbjct: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 133 ANVRPAKSVR--GFKTTYDNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRD 185
           AN+RP KSV   G K     VD+V++RENTE  Y  +E           V  + K I+  
Sbjct: 121 ANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEV 176

Query: 186 ASERVIRYAFEYA----KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKN--FQNIE 239
           A+ R+ + A + A    K  G  ++ V HKS +   SDGLF  V KE+ +     + +I+
Sbjct: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236

Query: 240 LDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKIS 299
            + ++ID+ V  +   P  +   V V PNLYGDI                  AN+G  I 
Sbjct: 237 YNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPGIV 293

Query: 300 IFEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTG 359
           I E  HGSAPDIAG+  +NP A              ++    I+ AV   +    K +T 
Sbjct: 294 IGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNL-REDKIKTP 352

Query: 360 DLGGTATTTSFTEAVIDNL 378
           DLGG  +T+     VI  L
Sbjct: 353 DLGGKNSTSDVVNDVIRRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  130 bits (326), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 110/371 (29%), Positives = 170/371 (45%), Gaps = 27/371 (7%)

Query: 29  SIGRFTGKPDHATG--KYTVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP-- 82
           +IGR   +  +A+      +  I GDGIG E+  + K + +  S    + ++  D+    
Sbjct: 5   AIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGW 64

Query: 83  -ILVDGLTTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPA 138
               +    +P++ V+ +     G L G + +P  K  G+ S  + LRK   L+ANVRP 
Sbjct: 65  GTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPV 124

Query: 139 KSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRY 193
           KSV G K     VD+V++RENTE  Y  +E           V ++ K I+  A+ R+   
Sbjct: 125 KSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATI 182

Query: 194 AFEYA----KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDN 247
           A + A    K  G   + V HKS +   SDGLF  + K++ +  +  +  +  + +++D+
Sbjct: 183 ALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDS 242

Query: 248 TVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGS 307
            V  +   P  +   V V PNLYGDI                  AN+G +I I E  HGS
Sbjct: 243 MVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGS 299

Query: 308 APDIAGQNKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATT 367
           APDIAG+  +NP A              N+    I  AV   +    K +T DLGG +TT
Sbjct: 300 APDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANL-REDKVKTPDLGGNSTT 358

Query: 368 TSFTEAVIDNL 378
               E ++  L
Sbjct: 359 QQVVEDILSKL 369

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  129 bits (324), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 162/357 (45%), Gaps = 33/357 (9%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSPILVDGLTT-------IPDEA 95
           T+  I GDGIG E+  + K + +  +    +++   D    L  G  T       +PDE 
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80

Query: 96  VKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVD 152
           V  + K   G L G + +P  K  G+ S  + LR+   LFANVRP KSV G +     +D
Sbjct: 81  VNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--KPID 138

Query: 153 LVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGR 203
           +V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGE 198

Query: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSD 261
             + V HKS +   +DGLF  + KE+ +  +  +  I+ + +++D+ V  +   P  +  
Sbjct: 199 ATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257

Query: 262 AVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANPTA 321
            V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A
Sbjct: 258 -VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIA 315

Query: 322 XXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
                         N     I  AV   +   +   T DLGG A+T    + V+  L
Sbjct: 316 TIRSTALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  129 bits (323), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 163/359 (45%), Gaps = 39/359 (10%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGLTTIPDE 94
           +  I GDGIG E+  + K + +A             +   WE              +PD+
Sbjct: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQG------KALPDD 76

Query: 95  AVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNV 151
            VK + +   G L G + +P  K  G+ S  + LRK   L+ANVRP KSV   K    NV
Sbjct: 77  TVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNV 134

Query: 152 DLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA----KAIG 202
           D++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    K+ G
Sbjct: 135 DMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRG 194

Query: 203 RPKVIVVHKSTIQRLSDGLFVNVAKELQKEKN---FQNIELDTELIDNTVLNVVMNPSKY 259
              + V HKS +   SDGLF  + K++  EKN   +  ++ + +++D+ V  +   P  +
Sbjct: 195 HATLTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGEVKYNEQIVDSMVYRMFREPECF 253

Query: 260 SDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKANP 319
              V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  +NP
Sbjct: 254 D--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNP 310

Query: 320 TAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            A               E    I  AV   +     N T DLGG ATT    + ++  +
Sbjct: 311 IATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  126 bits (316), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 164/364 (45%), Gaps = 38/364 (10%)

Query: 40  ATGKYTVSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGL 88
           A+   T+  I GDGIG E+  + + + +  S           +   W+T        +  
Sbjct: 17  ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETG 70

Query: 89  TTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFK 145
             +PDE +  +     G L G + +P  K  G+ S  + LRK   L+ANVRP KSV   +
Sbjct: 71  KALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQE 130

Query: 146 TTYDNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA-- 198
                VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A  
Sbjct: 131 RP---VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQ 187

Query: 199 --KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVM 254
             K  G   + V HKS +   SDGLF  V +++ +  +  F +I+ + +++D+ V  +  
Sbjct: 188 RQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFR 247

Query: 255 NPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQ 314
            P  +   V V PNLYGDI                  AN+G    + E  HGSAPDIAG+
Sbjct: 248 EPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGK 304

Query: 315 NKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
             +NP A               E    I  AV   +  +S  +T DLGG +TT    E V
Sbjct: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSI-KTPDLGGKSTTQQVVEDV 363

Query: 375 IDNL 378
           +  +
Sbjct: 364 LSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  126 bits (316), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 163/364 (44%), Gaps = 38/364 (10%)

Query: 40  ATGKYTVSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGL 88
           AT   T+  I GDGIG E+  + K + +  S           +   W+T       +D  
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70

Query: 89  TTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFK 145
             +PDE +  +     G L G + +P  K  G+ S  + LRK   L+ANVRP KSV    
Sbjct: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVL--- 127

Query: 146 TTYDNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA-- 198
           +    +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A  
Sbjct: 128 SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187

Query: 199 --KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVM 254
             K  G   + V HKS +   SDGLF  + +++ +  +  F +I  + +++D+ V  +  
Sbjct: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247

Query: 255 NPSKYSDAVFVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQ 314
            P  +   V V PNLYGDI                  AN+G    + E  HGSAPDIAG+
Sbjct: 248 EPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGK 304

Query: 315 NKANPTAXXXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
             +NP A               E    I  AV   +  ++  +T DLGG +TT    + V
Sbjct: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDV 363

Query: 375 IDNL 378
           +  +
Sbjct: 364 LSRM 367

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 149/355 (41%), Gaps = 32/355 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAAS-----VPITWETCDVSPILVDGL-TTIPDEAVKSI 99
           +  + GD +G EI+     + +A S     V   +E   +    +D     +PDEA+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SVRGFKTT 147
            K    L G +  P  G G     + L L +RK   L+AN+RP          +   K  
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKPQ 125

Query: 148 Y-DNVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPK 205
           +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPPL 185

Query: 206 VIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
            I          S  L+    +E  K + F  +++  +LID+  + +V NP+ + + + +
Sbjct: 186 PIWSLDKANVLASSRLWRKTVEETIKNE-FPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 266 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNKANPT 320
             N++GDI                    A++ DK     ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPV 302

Query: 321 AXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           A                E G  IE+AV + + A    RTGDLGG+ +TT   +AV
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAGI--RTGDLGGSNSTTEVGDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 151/359 (42%), Gaps = 32/359 (8%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAAS-----VPITWETCDVSPILVDGL-TTIPDEAVKSI 99
           +  + GD +G EI+     + +A S     V   +E   +    +D     +PDEA+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SVRGFKTT 147
            K    L G +  P  G G     + L L +RK   L+AN+RP          +   K  
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQ 125

Query: 148 Y-DNVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPK 205
           +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPL 185

Query: 206 VIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
            I          S  L+    +E  K + F  +++  +LID+  + +V NP+ + + + +
Sbjct: 186 PIWSLDKANVLASSRLWRKTVEETIKNE-FPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 266 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNKANPT 320
             N++GDI                    A++ DK     ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 321 AXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
           A                E G  IE+AV K + A    RTGDLGG+ +TT   +AV + +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAVAEEV 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 95/355 (26%), Positives = 149/355 (41%), Gaps = 32/355 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAAS-----VPITWETCDVSPILVDGL-TTIPDEAVKSI 99
           +  + GD +G EI+     + +A S     V   +E   +    +D     +PDEA+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SVRGFKTT 147
            K    L G +  P  G G     + L L +RK   L+AN+RP          +   K  
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQ 125

Query: 148 Y-DNVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPK 205
           +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPL 185

Query: 206 VIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
            I          S  L+    +E  K + F  +++  +LID+  + +V NP+ + + + +
Sbjct: 186 PIWSLDKANVLASSRLWRKTVEETIKNE-FPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 266 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNKANPT 320
             N++GDI                    A++ DK     ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 321 AXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           A                E G  IE+AV K + A    RTGDLGG+ +TT   +AV
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAV 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 149/356 (41%), Gaps = 34/356 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTT------IPDEAVKSI 99
           +  + GD +G EI+     + +A S      T +    L+ G         +PDEA+++ 
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SVRGFKTT 147
            K    L G +  P  G G     + L L +RK   L+AN+RP          +   K  
Sbjct: 65  KKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQ 123

Query: 148 Y-DNVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRP- 204
           Y    D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P 
Sbjct: 124 YAQGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPL 183

Query: 205 KVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVF 264
            +  + K+ +   S      V K +++E  F  + ++ +LID+  + +V NP++  + + 
Sbjct: 184 PIWSLDKANVLASSRLWRKTVEKTIKEE--FPTLSVNHQLIDSAAMILVKNPTQL-NGII 240

Query: 265 VCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGD---KISIFEAVHGSAPDIAGQNKANP 319
           +  N++GDI                    A++ D      ++E  HGSAPD+A + K NP
Sbjct: 241 ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNP 299

Query: 320 TAXXXXXXXXXXXXXXN-EYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
            A                E G  IE AV K +      RTGDLGG+ +T+   +AV
Sbjct: 300 VATILSAAMMLKLSLNMVEEGVAIEKAVKKVL--DDGIRTGDLGGSNSTSEVGDAV 353

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 147/359 (40%), Gaps = 40/359 (11%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQA-------ASVPITWETCDVSPILVDGLTTIPDEAVKS 98
           ++   GD IG EI R    +  A        S    ++    + I   G   + DEA++ 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATG-EPLTDEALQV 65

Query: 99  INKNLVGLKGPLATPIGKGHRSLN-----LTLRKTFNLFANVRPAKSVRGFKTTYD---- 149
              +   L G +  P   GH  +      L +RK   ++AN+RP + V   +T  D    
Sbjct: 66  AKNSDAILLGAVGGP-KWGHGLVRPEQGLLKIRKELGVYANLRPCQFVS--ETLLDLSPL 122

Query: 150 ------NVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIG 202
                   D V++RE   G Y G  +     GV    +  +    +R+ R A   A    
Sbjct: 123 KREIVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMAAFLALQHN 182

Query: 203 RP-KVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSD 261
            P  V  + K+ +   S      V + ++ E  F  + ++  LID+  + +V NP+K  +
Sbjct: 183 PPLPVWSLDKANVLATSRLWRKTVEETIKNE--FPTLTINHHLIDSAAMTLVQNPTKL-N 239

Query: 262 AVFVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNK 316
            V +  N++GDI                    A++ DK   + ++E  HGSAPD+   + 
Sbjct: 240 GVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLPA-DH 298

Query: 317 ANPTAX-XXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           ANP A                + G+ IE AV +TI A  K  TGDLGG  TTT    AV
Sbjct: 299 ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAGIK--TGDLGGKNTTTEVGNAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 92/353 (26%), Positives = 144/353 (40%), Gaps = 34/353 (9%)

Query: 49  IEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGL------TTIPDEAVKSINKN 102
           + GD IG E+      +  A    ++    D    LV G       + +PDEA+ +  + 
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 103 LVGLKGPLATPIGKG-----HRSLNLTLRKTFNLFANVRP----AKSVRGFKTTYDNV-- 151
              L G +  P  +G      + L L LR+   ++AN+RP    A S+         +  
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 152 --DLVLIRENTEGEYSGIEHV-VTPGVVQSIKLITRDASERVIRYAFEYAKAIGRP-KVI 207
             D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V 
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 208 VVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCP 267
            + K+ +   S      V +  Q E  F N++L  +LID+  + +V NP  + + V V  
Sbjct: 189 SLDKANVLASSRLWRKTVEETFQSE--FPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTS 245

Query: 268 NLYGDIXXXXXXXX--XXXXXXXXXXANIGDKISIF---EAVHGSAPDIAGQNKANPTAX 322
           N++GDI                    A++ D  S F   E  HGSAPD+    KANP   
Sbjct: 246 NMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGC 304

Query: 323 XXXXXXXXXXXXXN-EYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
                            G+ +E AV + +   S  RTGDL G+++T+   +A+
Sbjct: 305 ILSAAMMLKLSLNMVAAGEAVEQAVQEVL--DSGVRTGDLLGSSSTSEVGDAI 355

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 112/271 (41%), Gaps = 20/271 (7%)

Query: 123 LTLRKTFNLFANVRP----AKSVRGFKTTYDNV----DLVLIRENTEGEYSG-IEHVVTP 173
           L +RK   L+AN+RP    +KS+ G       +    D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 174 GVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEK 233
           GV    +  T    ER+ R     A     P  +          S  L+     E  K +
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRTVNETIK-R 212

Query: 234 NFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXX 291
            F  + +  +LID+  + ++ NP K+ + + +  N++GDI                    
Sbjct: 213 EFPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLLPSASL 271

Query: 292 ANIGDK---ISIFEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXN-EYGDKIENAVL 347
           A+  DK     ++E  HGSAPD+  + +ANP A                + G  IENAV 
Sbjct: 272 ASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK 330

Query: 348 KTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
           + I   S  RTGDLGG  TTT   +AV   L
Sbjct: 331 QVI--ESGIRTGDLGGNNTTTEVGDAVTHAL 359

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 148/356 (41%), Gaps = 34/356 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAAS-----VPITWETCDVSPILVDGLTTIP--DEAVKS 98
           +  + GD +G EI+     + +A S     V   +E   +    +D  T +P  DEA+++
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLTDEALEA 65

Query: 99  INKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SVRGFKT 146
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 147 TYD-NVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 204
            +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHQPP 184

Query: 205 KVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVF 264
             I          S  L+    +E  K + F  +++  +LID+  + +V NP++  + + 
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNE-FPTLKVQHQLIDSAAMILVKNPTQL-NGII 242

Query: 265 VCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNKANP 319
           +  N++GDI                    A++ DK     ++E  HGSAPD+  +NK NP
Sbjct: 243 ITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNP 301

Query: 320 TAXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
            A                  G  IE+AV K + A    RTGDLGG+ +T    +AV
Sbjct: 302 IATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAGI--RTGDLGGSNSTIEVGDAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 147/355 (41%), Gaps = 32/355 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTT------IPDEAVKSI 99
           +  + GD +G EI+     + +A +        D    L+ G         +PDEA+++ 
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSVRGFKTTYDN 150
             +   L G +  P  G G     + L L +RK   L+AN+RP    ++S+ G       
Sbjct: 66  KNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGLSPLRPE 124

Query: 151 V----DLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPK 205
           +    D +++RE   G Y G  +     GV    +  +    +R+ R A   A     P 
Sbjct: 125 IAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPL 184

Query: 206 VIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265
            I          S  L+    +E  K + F  + +  +LID+  + +V NP++  + + +
Sbjct: 185 PIWSLDKANVLASSRLWRKTVEETIKNE-FPTLTVQNQLIDSAAMILVKNPTQL-NGIII 242

Query: 266 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGD---KISIFEAVHGSAPDIAGQNKANPT 320
             N++GDI                    A++ D      ++E  HGSAPD+  + K NP 
Sbjct: 243 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPI 301

Query: 321 AXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           A                + GD IE AV K + A    RTGDLGG+ +TT   +A+
Sbjct: 302 ATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGI--RTGDLGGSNSTTEVGDAI 354

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 130/308 (42%), Gaps = 27/308 (8%)

Query: 91  IPDEAVKSINKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAKSVR--- 142
           +PDE +++  ++   L G +  P  G G     + L L +RK   L+ N+RP K +    
Sbjct: 58  LPDETLEAAKQSDAVLLGAVGGPKWGTGKVRPEQGL-LKIRKELGLYGNLRPCKFISDKL 116

Query: 143 -GFKTTYDNV----DLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAFE 196
            G     + V    D V++RE   G Y G  +     GV    +  + +  +R+ + A  
Sbjct: 117 IGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMAAF 176

Query: 197 YAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNP 256
            +     P  I          S  L+     E   E  F N+++  +LID+  + +V NP
Sbjct: 177 LSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAE--FPNLKVQHQLIDSAAMMLVKNP 234

Query: 257 SKYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDI 311
           ++  + + +  N++GDI                    A++ DK     ++E  HGSAPD+
Sbjct: 235 TQL-NGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDL 293

Query: 312 AGQNKANPTAXXXXXXXXXXXXXXN-EYGDKIENAVLKTIAASSKNRTGDLGGTATTTSF 370
           A + K NP A                + G+ IE AV  ++      RT DLGG +TT+  
Sbjct: 294 A-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAV--SVVLDRGIRTADLGGNSTTSEL 350

Query: 371 TEAVIDNL 378
            +AV   L
Sbjct: 351 GDAVAQEL 358

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 126/306 (41%), Gaps = 26/306 (8%)

Query: 89  TTIPDEAVKSINKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK---- 139
           T +PDEA+++  K    L G +  P  G G     + L L +RK   L+AN+RP      
Sbjct: 54  TPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASD 112

Query: 140 ---SVRGFKTTY-DNVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYA 194
               +   K  Y    D V++RE   G Y G  +     GV    +  +    +R+ R A
Sbjct: 113 SLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA 172

Query: 195 FEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVM 254
              A     P  I          S  L+    +E  K + F  + +  +LID+  + +V 
Sbjct: 173 AFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKTE-FPQLTVQHQLIDSAAMILVK 231

Query: 255 NPSKYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGD---KISIFEAVHGSAP 309
           +P+K  + V +  N++GDI                    A++ D      ++E  HGSAP
Sbjct: 232 SPTKL-NGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAP 290

Query: 310 DIAGQNKANPTAXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTT 368
           D+   NK NP A                E G  +E AV   + A    RTGDLGG+ +TT
Sbjct: 291 DLPA-NKVNPIATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAGV--RTGDLGGSNSTT 347

Query: 369 SFTEAV 374
              +A+
Sbjct: 348 EVGDAI 353

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 150/360 (41%), Gaps = 34/360 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTT------IPDEAVKSI 99
           +  + GD +G EI+     + +A S     +  +    L+ G         +PD ++++ 
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSVRGFK----T 146
            K+   L G +  P  G G     + L L +RK   L+AN+RP    ++S+         
Sbjct: 67  KKSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPE 125

Query: 147 TYDNVDLVLIRENTEGEYSGIEHVVT-PGVVQSIKLITRDASERVIRYAFEYAKAIGRP- 204
                D V++RE   G Y G     T  GV    +  +    +R+ R A   A     P 
Sbjct: 126 CARGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPL 185

Query: 205 KVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVF 264
            V  + K+ +   S  L+    +E  K + F  + +  +LID+  + +V NP++  + V 
Sbjct: 186 PVWSLDKANVLA-SSRLWRKTVEETIKNE-FPTLTVQHQLIDSAAMILVKNPTQL-NGVI 242

Query: 265 VCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNKANP 319
           +  N++GDI                    A++ D      ++E  HGSAPD+  + K NP
Sbjct: 243 ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNP 301

Query: 320 TAXXXXXXXXXXXXXXN-EYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
            A                E G  +E AV K +   S  RT DL GT+TT+   EAV+  L
Sbjct: 302 IATILSAAMMLKLSLDMFEEGAAVEEAVRKVL--DSGVRTADLKGTSTTSEVGEAVVKAL 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 112/267 (41%), Gaps = 20/267 (7%)

Query: 123 LTLRKTFNLFANVRPAK-------SVRGFKTTY-DNVDLVLIRENTEGEYSGI-EHVVTP 173
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 174 GVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEK 233
           GV    +  T+   +R+ R A   A     P  I          S  L+    +E  K +
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 234 NFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXXXXX-----XXXX 288
            F  ++L+ +LID+  + +V +P++  + + +  NL+GDI                    
Sbjct: 212 -FPQLKLNHQLIDSAAMILVKSPTQL-NGIVLTSNLFGDIISDEASVIPGSLGLLPSASL 269

Query: 289 XXXANIGDKISIFEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXX-XNEYGDKIENAVL 347
               +  +   ++E  HGSAPD+  + K NP A               ++ G+ +E AV 
Sbjct: 270 ASLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVK 328

Query: 348 KTIAASSKNRTGDLGGTATTTSFTEAV 374
           + +   S  RTGDLGG+ +T+   +A+
Sbjct: 329 QVL--DSGVRTGDLGGSNSTSEVGDAI 353

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 145/357 (40%), Gaps = 33/357 (9%)

Query: 45  TVSFIEGDGIGPEISRSVKDIFQAAS------VPITWETCDVSPILVDGL-TTIPDEAVK 97
           T+  + GD +G EI+     +  A        V   ++   +    +D     +PDEA++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 98  SINKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSVRGFKTTY 148
           +  K    L G +  P  G G     + L L +RK   L+AN+RP    + S+       
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 149 DNV----DLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGR 203
             +    D V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNP 184

Query: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAV 263
           P  I          S  L+    +E  K + F  + +  +LID+  + +V NP+ + + +
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIKNE-FPQLTVQHQLIDSAAMILVKNPT-HLNGI 242

Query: 264 FVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGDK---ISIFEAVHGSAPDIAGQNKAN 318
            +  N++GDI                    A++ DK     ++E  HGSAPD+  + K N
Sbjct: 243 IITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVN 301

Query: 319 PTAXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           P A                E G+ IE AV K +   S  RT DL GT +TT   +AV
Sbjct: 302 PVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL--DSGIRTADLKGTNSTTEVGDAV 356

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 110/267 (41%), Gaps = 20/267 (7%)

Query: 123 LTLRKTFNLFANVRP----AKSVRGFKTTYDNV----DLVLIRENTEGEYSG-IEHVVTP 173
           L +RK   L+AN+RP    ++ + G       +    D +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 174 GVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEK 233
           GV    +  +    ER+ R A  +      P + +        L+         E   + 
Sbjct: 155 GVAWDSEKYSVPEVERITRMA-AFLALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKN 213

Query: 234 NFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXX 291
            F  + +  +LID+  + +V NP++  + + +  N++GDI                    
Sbjct: 214 EFPTLTVQNQLIDSAAMILVKNPTQL-NGIIITSNMFGDIISDEASVIPGSLGLLPSASL 272

Query: 292 ANIGDK---ISIFEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXXXN-EYGDKIENAVL 347
           A++ D      ++E  HGSAPD+  +NK NP A                + G+ +E AV 
Sbjct: 273 ASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVR 331

Query: 348 KTIAASSKNRTGDLGGTATTTSFTEAV 374
           + + A    RTGDLGG+ +T    +A+
Sbjct: 332 RVLDAGV--RTGDLGGSNSTQEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 109/268 (40%), Gaps = 20/268 (7%)

Query: 123 LTLRKTFNLFANVRPAK-------SVRGFKTTY-DNVDLVLIRENTEGEYSG-IEHVVTP 173
           L +RK   L+AN+RP          +   K  Y    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 174 GVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEK 233
           GV    +  +    +R+ R A   A     P  I          S  L+    +E  K +
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 234 NFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXX 291
            F  + +  +LID+  + +V +P+K  + + +  N++GDI                    
Sbjct: 214 -FPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASL 271

Query: 292 ANIGDK---ISIFEAVHGSAPDIAGQNKANPTAXXXXXXXXXXXXX-XNEYGDKIENAVL 347
           A++ D      ++E  HGSAPD+  +NK NP A                E G+ +E AV 
Sbjct: 272 ASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVR 330

Query: 348 KTIAASSKNRTGDLGGTATTTSFTEAVI 375
           + + A    RT DL G  +T+   +AV+
Sbjct: 331 RVLDAGI--RTADLRGENSTSEVGDAVV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/357 (22%), Positives = 143/357 (40%), Gaps = 35/357 (9%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQAAS------VPITWETCDVSPILVDGL-TTIPDEAVKS 98
           +  + GD +G E++     I +A        V   +E   +    +D     +PDE++++
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 99  INKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRPAK-------SVRGFKT 146
             +    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 67  SKRADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKE 125

Query: 147 TY-DNVDLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRP 204
            Y    D  ++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 126 KYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHNPP 185

Query: 205 -KVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAV 263
             +  + K+ +   S      V + +Q E  F ++++  +LID+  + +V NP++  + +
Sbjct: 186 LPIWSLDKANVLASSRLWRKTVEETIQNE--FPSLKVSHQLIDSAAMILVKNPTQL-NGI 242

Query: 264 FVCPNLYGDIXXXXXXX-----XXXXXXXXXXXANIGDKISIFEAVHGSAPDIAGQNKAN 318
            +  N++GDI                        +      ++E  HGSAPD+  + K N
Sbjct: 243 IITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVN 301

Query: 319 PTAX-XXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374
           P                  E G  +E AV + +   +  RT DLGG+ +T+   +AV
Sbjct: 302 PIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL--DNNIRTADLGGSNSTSDIGDAV 356

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 84/363 (23%), Positives = 142/363 (39%), Gaps = 48/363 (13%)

Query: 46  VSFIEGDGIGPEISRSVKDIFQA-----ASVPITWETCDVSPILVDGL-TTIPDEAVKSI 99
           +  + GD +G EI+     + +A     +SV   ++   +    +D     +PD ++++ 
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 100 NKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP---------------AK 139
            K    L G +  P  G G     + L L +RK   L+AN+RP               A+
Sbjct: 67  KKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAE 125

Query: 140 SVRG--FKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEY 197
             RG  F    + V  +   E  E E  G+        V  ++ ITR A+   +++    
Sbjct: 126 HARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQH---- 181

Query: 198 AKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPS 257
                 P + V        L+         E   +  F  + +  +LID+  + +V NP+
Sbjct: 182 -----NPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPT 236

Query: 258 KYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGD---KISIFEAVHGSAPDIA 312
           +  + V +  N++GDI                    A++ D      ++E  HGSAPD+ 
Sbjct: 237 QL-NGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE 295

Query: 313 GQNKANPTAXXXXXXXXXXXXXXN-EYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFT 371
            + K NP A                E G  +E AV + +   S  RTGDL G+ +T    
Sbjct: 296 -KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVL--DSGIRTGDLRGSNSTQEVG 352

Query: 372 EAV 374
           +AV
Sbjct: 353 DAV 355

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 126/306 (41%), Gaps = 26/306 (8%)

Query: 89  TTIPDEAVKSINKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AK 139
           T +PDEA+ +   +   L G +  P  G G     + L L +RK   L+AN+RP    + 
Sbjct: 56  TPLPDEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSD 114

Query: 140 SVRGFKTTYDNV----DLVLIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYA 194
           S+ G     + +    D  ++RE   G Y G  +     G     +  T    +R+ R A
Sbjct: 115 SLLGLSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMA 174

Query: 195 FEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVM 254
              A     P  I          S  L+    +E  K + F N+++  +LID+  + +V 
Sbjct: 175 AFLALQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNE-FPNLKVQHQLIDSAAMILVK 233

Query: 255 NPSKYSDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGD---KISIFEAVHGSAP 309
           +P +  + + +  N++GDI                    A++ D      ++E  HGSAP
Sbjct: 234 SPRQL-NGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 310 DIAGQNKANPTAXXXXXXXXXXXXX-XNEYGDKIENAVLKTIAASSKNRTGDLGGTATTT 368
           D+  + K NP A                + G  IE AV + + A    RT DL G+ +T+
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAGI--RTADLKGSNSTS 349

Query: 369 SFTEAV 374
              +AV
Sbjct: 350 EVGDAV 355

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 90/361 (24%), Positives = 148/361 (40%), Gaps = 35/361 (9%)

Query: 41  TGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLTT------IPDE 94
           T K+ V  + GD +G EI+     +  A S        D    L+ G         +PDE
Sbjct: 86  TTKHIV-VLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDE 144

Query: 95  AVKSINKNLVGLKGPLATP-IGKG----HRSLNLTLRKTFNLFANVRP----AKSVRGFK 145
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP    + S+    
Sbjct: 145 ALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 203

Query: 146 TTYDNV----DLVLIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAFEYAKA 200
                +    D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A  
Sbjct: 204 PLKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQ 263

Query: 201 IGRP-KVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKY 259
              P  V  + K+ +   S  L+    +E  K + F  + +  +LID+  + +V NP+ +
Sbjct: 264 HNPPLPVWSLDKANVLA-SSRLWRKTVEETIKNE-FPTLTVQHQLIDSAAMILVKNPT-H 320

Query: 260 SDAVFVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGD---KISIFEAVHGSAPDIAGQ 314
            + V +  N++GDI                    A++ D      ++E  HGSAPD+  +
Sbjct: 321 LNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-K 379

Query: 315 NKANPTAX-XXXXXXXXXXXXXNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEA 373
            K NP A                E G  +E AV + +   S  RT DL G+ +T+   +A
Sbjct: 380 GKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL--DSGVRTADLRGSNSTSEVGDA 437

Query: 374 V 374
           +
Sbjct: 438 I 438

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 34.3 bits (77), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 336 NEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378
           NE   +I  AV +TIA   K+ T D+GG+++TT FT  +I+ L
Sbjct: 9   NESATRISKAVHETIA-EGKHTTRDIGGSSSTTDFTNEIINKL 50

>KNAG0L00830 Chr12 complement(145662..149741) [4080 bp, 1359 aa]
           {ON} Anc_7.154 YER008C
          Length = 1359

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 73  ITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLK--GPLATPIGKGHRSLNLTLRKTFN 130
           I WE  D +  L+D L     EA  S NKN++ L+  GP   P G+        +   F+
Sbjct: 657 INWELDDDADTLIDRLNAKMIEANHSFNKNIITLQTIGPELVPYGESVEQECSKMNPAFS 716

Query: 131 LF 132
           LF
Sbjct: 717 LF 718

>KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {ON}
           similar to uniprot|P12945 Saccharomyces cerevisiae
           YDL040C NAT1 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 837

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 77  TCDVSPILVDGL----TTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLF 132
           +  V  I++ GL     + P+EA   I+K L  +KG L +PIG GH  L +  R+  N  
Sbjct: 52  SSHVDSIILKGLNLQFCSTPEEAASYIDKALSKIKGTLVSPIG-GHL-LGIYYRQVKNY- 108

Query: 133 ANVRPAKSVRGFKTTYDN 150
                + +V+ FK   +N
Sbjct: 109 -----SDAVKWFKAALEN 121

>KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {ON} 
          Length = 443

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 60/140 (42%), Gaps = 10/140 (7%)

Query: 56  PEISRSVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIG 115
            ++S    D  QA +  + +    +S + ++ LT++      + N +L  L+    T +G
Sbjct: 218 SDVSSVSFDNLQAVNASLGFLNNTISELKLNNLTSVGQTFTITFNNDLTHLEFSNLTKVG 277

Query: 116 KGHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIR--------ENTEGEYSG- 166
            G    N T  K+ + FAN++           +D++DL  ++        E     +S  
Sbjct: 278 GGFVVANNTNLKSIDAFANLQTVNGALDVIGNFDSLDLTALKSVRGGADVETKSANFSCS 337

Query: 167 -IEHVVTPGVVQSIKLITRD 185
            ++ + + G +Q  K I ++
Sbjct: 338 PLKKLQSKGAIQGDKFICKN 357

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 133 ANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIR 192
           ANV PA ++RG + T D +  V   + +  E S  ++    G + ++K+I  D + +   
Sbjct: 66  ANVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGPIANVKIIV-DKNNKYCN 124

Query: 193 YAF-EYAK 199
           YAF EY K
Sbjct: 125 YAFVEYLK 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,644,772
Number of extensions: 1352955
Number of successful extensions: 4236
Number of sequences better than 10.0: 92
Number of HSP's gapped: 4048
Number of HSP's successfully gapped: 92
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)