Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B057208.323ON48448419500.0
TDEL0F044908.323ON51048212361e-166
KLTH0G12298g8.323ON5004489501e-123
Kwal_56.239168.323ON4994459071e-116
Suva_2.3068.323ON5411967533e-93
NCAS0B035708.323ON5192067513e-93
Skud_4.4048.323ON5351937508e-93
YDR145W (TAF12)8.323ON5392097482e-92
Smik_4.3898.323ON5251937453e-92
ZYRO0F10384g8.323ON5581957343e-90
Kpol_543.638.323ON5852047112e-86
CAGL0E01397g8.323ON5751716823e-82
SAKL0H15554g8.323ON5361946784e-82
NDAI0J010208.323ON6381716811e-81
TPHA0A015608.323ON5401916741e-81
Ecym_42548.323ON5291886532e-78
AGL195C8.323ON5541686507e-78
KLLA0D16368g8.323ON5111686478e-78
TBLA0A039408.323ON7522056382e-74
KNAG0I008908.323ON5081846224e-74
TBLA0H012808.323ON4051173313e-33
ZYRO0A06600g5.400ON94654713.9
TBLA0E044904.297ON14347674.9
Kwal_47.171404.297ON12350666.0
Kpol_1016.55.435ON81287696.6
KLTH0D15554g4.297ON12347656.9
Kwal_33.145252.88ON30042679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05720
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   755   0.0  
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   480   e-166
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   370   e-123
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   353   e-116
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   294   3e-93
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   293   3e-93
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   293   8e-93
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   292   2e-92
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   291   3e-92
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   287   3e-90
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   278   2e-86
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   267   3e-82
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   265   4e-82
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   266   1e-81
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   264   1e-81
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   256   2e-78
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   254   7e-78
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   253   8e-78
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   250   2e-74
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   244   4e-74
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   132   3e-33
ZYRO0A06600g Chr1 (535933..538773) [2841 bp, 946 aa] {ON} simila...    32   3.9  
TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4....    30   4.9  
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    30   6.0  
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    31   6.6  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    30   6.9  
Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {O...    30   9.1  

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/484 (79%), Positives = 384/484 (79%)

Query: 1   MSSSNAGQSNVPPSDPSANRGITLQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQAS 60
           MSSSNAGQSNVPPSDPSANRGITLQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQAS
Sbjct: 1   MSSSNAGQSNVPPSDPSANRGITLQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQAS 60

Query: 61  KLKALYDNYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIR 120
           KLKALYDNYN                                    GRSGSSAQFATLIR
Sbjct: 61  KLKALYDNYNKQKQEAMAQAQARNNNANTANVNSSSSANSTEANTSGRSGSSAQFATLIR 120

Query: 121 QALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRI 180
           QALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRI
Sbjct: 121 QALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRI 180

Query: 181 ELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQRVXXXXXXXXXXX 240
           ELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQRV           
Sbjct: 181 ELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQRVQQQAASPNAQQ 240

Query: 241 XXXVKTEXXXXXXXXXXXXXXXXXXXXXXXXXKPRSQSQITNVXXXXXXXXXXXKSVIFK 300
              VKTE                         KPRSQSQITNV           KSVIFK
Sbjct: 241 QPPVKTEAQPQPQPQQQATPSQSSSNANLAASKPRSQSQITNVNAAASNSSSSNKSVIFK 300

Query: 301 QSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMS 360
           QSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMS
Sbjct: 301 QSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMS 360

Query: 361 KRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKSDNLETK 420
           KRKLRELVKTIGIDEGDGETVI              FVTNVTSFACKLAKHRKSDNLETK
Sbjct: 361 KRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNLETK 420

Query: 421 DIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDKNGTNIKGTGTSGTGK 480
           DIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDKNGTNIKGTGTSGTGK
Sbjct: 421 DIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDKNGTNIKGTGTSGTGK 480

Query: 481 NASK 484
           NASK
Sbjct: 481 NASK 484

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  480 bits (1236), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 306/482 (63%), Gaps = 30/482 (6%)

Query: 14  SDPSANRGIT-LQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXX 72
           ++ SA++GI   Q+QL+EL+ +F++LV EAK VGE TP GKEL+++ASK+KA+YDNYN  
Sbjct: 12  AEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQ 71

Query: 73  XXXXXXX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQ 121
                                                            S +Q A +I+Q
Sbjct: 72  RQQAAQAFVQGRNGGTPGANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQ 131

Query: 122 ALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIE 181
            LTPEQNQQ++ L QNFQ RAN+I+DKHTFLKQ+I+RL QE+ KQTDA+AKKQL+EK+ E
Sbjct: 132 VLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTE 191

Query: 182 LMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQRVXXXXXXXXXXXX 241
           L  NLK +++EY  LQQ++ NGKK FY+ECA+ NP LQRLLQ+STQ+             
Sbjct: 192 LANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRSTQQQRMAQQQQVQPSE 251

Query: 242 XXVKTEXXXXXXXXXXXXXXXXXXXXXXXXXKP----------------RSQSQITNVXX 285
                E                          P                R+QSQ+TNV  
Sbjct: 252 GSPAGEAGSPGAAGNSAKAQQGTPANITTQKLPQQNQVRSQSTSSNTGSRAQSQVTNVNA 311

Query: 286 XXXXX--XXXXKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTP 343
                      KS IFKQSDP VPISE++++KTP PV Y+ NRPT++GG+AMNAAALNTP
Sbjct: 312 AASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTP 371

Query: 344 IMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTS 403
            MTKLPPYE+DTERVMSKRKLRELVKT+GIDEGDGETVI              FV+NVT 
Sbjct: 372 TMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTG 431

Query: 404 FACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINI 463
           FAC+LAKHRKSDNL+T+DIQLHLERNWNIRIPGYSADEIRSTRKWNP  SYNQK+Q+IN 
Sbjct: 432 FACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINS 491

Query: 464 DK 465
           DK
Sbjct: 492 DK 493

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 199/448 (44%), Positives = 254/448 (56%), Gaps = 15/448 (3%)

Query: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXXXXXXXXXXXXX 87
           L +++ +F     EAK+VG  TP+G+EL+ QAS++KA+YD Y                  
Sbjct: 30  LQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAYRQRQQSAQGFEQGGATSN 89

Query: 88  XXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKD 147
                                + SS      I+  LTP+QN+ Y +L+Q        IK 
Sbjct: 90  TGDNTAGTPTNARSPNGTPNNNMSSN-----IQNLLTPQQNEAYGRLIQTSNENGEKIKG 144

Query: 148 KHTFLKQNIDRLVQEIEK-QTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKA 206
           ++T+LK+ I+ L  EI+K Q D A  KQL+  + E++  L+  S  Y  L Q+    KK 
Sbjct: 145 EYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKK 204

Query: 207 FYIECAKKNPDLQRLLQKSTQRVXXXXXXXXXXXXXXVKTEXXXXXXXXXXXXXXXXXXX 266
           FYIECA  NP+L+R LQ STQ+                 T                    
Sbjct: 205 FYIECAATNPNLKRFLQASTQQQRANSTASQNASPLPAATGANQASSPIQQTGAPSQVQQ 264

Query: 267 XXXXXXKPRS------QSQITNVXXXXXXX---XXXXKSVIFKQSDPAVPISESISSKTP 317
                 +PRS       +Q+T+V              +  IFKQ +P+VP+SE+I+ + P
Sbjct: 265 QTATPSQPRSGVNSRSPTQVTSVNAAAHLANNATSAARQAIFKQPNPSVPVSETITQRMP 324

Query: 318 IPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGD 377
            PV +R NRPTI+GGSAMNAAAL TP+MTKLPPYE+D ERVMSKRKLRELVK++GIDEGD
Sbjct: 325 TPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGD 384

Query: 378 GETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGY 437
           GET I              F+TNVTSFAC+LAKHRKSDNL+ +DIQLHLERNWNIRIPGY
Sbjct: 385 GETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGY 444

Query: 438 SADEIRSTRKWNPTQSYNQKLQSINIDK 465
           +ADE+RSTRKWNPT SYNQKLQ IN  K
Sbjct: 445 AADEVRSTRKWNPTTSYNQKLQGINSAK 472

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  353 bits (907), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 249/445 (55%), Gaps = 15/445 (3%)

Query: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXXXXXXXXXXXXX 87
           + +++ +F     EAK++G  TP+G+EL+ QAS +KA+YD Y                  
Sbjct: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYRQRQQAAQGFDQNAPGAS 89

Query: 88  XXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKD 147
                                + SS      I+  LTP+QN+ Y +L+Q+       IK 
Sbjct: 90  SAGSTSGSPATARAPNGTATNTISSN-----IQNLLTPQQNEAYGRLIQSSNENGEKIKG 144

Query: 148 KHTFLKQNIDRLVQEIEK-QTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKA 206
           ++T+LK+ I+ L  EI+K + D A  KQL+  + E++  LK  S  Y  L Q+    KK 
Sbjct: 145 EYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQKLREDKKK 204

Query: 207 FYIECAKKNPDLQRLLQKSTQRVXXXXXXXXXXXXXXVKTEXXXXXXXXXXXXXXXX--- 263
           FYIECA  NP+L+R LQ STQ+                 +                    
Sbjct: 205 FYIECAATNPNLKRFLQASTQQQRANSATSQNASPLPTNSNGNQTSSPAQQQAAVQVPPP 264

Query: 264 ---XXXXXXXXXKPRSQSQITNVXXXXXXX---XXXXKSVIFKQSDPAVPISESISSKTP 317
                         RS +Q+T+V              +  IFKQ +P+VP+SE+I+ K P
Sbjct: 265 QNGTPGQTRSAASSRSPTQVTSVNAAAHLANNATSAARRAIFKQPNPSVPVSETITQKMP 324

Query: 318 IPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGD 377
             +  R NRPTI+GGSAMNAAAL TP+MTKLPPYE+D ERVMSKRKLRELVK++GIDEGD
Sbjct: 325 TLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGD 384

Query: 378 GETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGY 437
           GET I              F+TNVTSFAC+LAKHRKSDNL+ +DIQLHLERNWNIRIPGY
Sbjct: 385 GETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGY 444

Query: 438 SADEIRSTRKWNPTQSYNQKLQSIN 462
           +ADE+RSTRKWNPT SYNQKLQ IN
Sbjct: 445 AADEVRSTRKWNPTASYNQKLQGIN 469

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  294 bits (753), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 139/196 (70%), Positives = 158/196 (80%), Gaps = 2/196 (1%)

Query: 275 RSQSQITNVXXXXXXXXXXXKSV--IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGG 332
           +++SQ+TNV            S   IFKQ++PA+PISE+IS+K P PVPYR NRPTI+GG
Sbjct: 331 KTKSQVTNVNATASMMSNASSSKSAIFKQTEPAIPISENISTKAPAPVPYRSNRPTITGG 390

Query: 333 SAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXX 392
           SAMNA ALNTP+ TKLPPYE+DT+RVMSKRKLRELVKT+GIDEGDGETVI          
Sbjct: 391 SAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLD 450

Query: 393 XXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQ 452
               FVTNVT+FAC+LAKHRKSDNLE +DIQLHLERNWNIRIPGYSADEIRSTRKWNP+Q
Sbjct: 451 LADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ 510

Query: 453 SYNQKLQSINIDKNGT 468
           SYNQKLQ+IN DK  T
Sbjct: 511 SYNQKLQNINSDKVAT 526

 Score =  190 bits (483), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/210 (46%), Positives = 133/210 (63%), Gaps = 9/210 (4%)

Query: 25  QKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXXXXXXXXXX 84
           QKQL+E++ +FK+LV EA+ VGETTP GKEL+ QA+K+K++YD +N              
Sbjct: 35  QKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQAAQAYKNAS 94

Query: 85  XXXXXXXX--------XXXXXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQQYDKLVQ 136
                                          RS S+ +F+ +I+Q LT E+NQQY+KL Q
Sbjct: 95  VGNTTPNAGNPVSLPTEKPPSLSQQQQQQQARSNSN-KFSNMIKQVLTSEENQQYEKLWQ 153

Query: 137 NFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAISVEYTNL 196
           NFQ RA ++K+K TFLKQNIDRLVQE+ KQTD A KKQL++K+ EL+ N K + +EY NL
Sbjct: 154 NFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNL 213

Query: 197 QQQYNNGKKAFYIECAKKNPDLQRLLQKST 226
            + + N KK FY+ECA+ NP LQ+ LQ+ST
Sbjct: 214 LKGFQNSKKTFYVECARHNPALQKFLQEST 243

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  293 bits (751), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 140/206 (67%), Positives = 159/206 (77%), Gaps = 3/206 (1%)

Query: 277 QSQITNVXXXXXXXXXXX--KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSA 334
           +SQ+TNV             K  IFKQSDP VP+S++IS+K PI VPYR NRPT++GGSA
Sbjct: 312 KSQVTNVNAAASMSDSSNSSKQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSA 371

Query: 335 MNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXX 394
           M+A+ALNTP+MTKLPPYELDTERVMSKRKLRELVK+IGIDEGDGETVI            
Sbjct: 372 MSASALNTPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMA 431

Query: 395 XXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSY 454
             F+TNVTSFAC+LAKHRKSDNLE +DIQLHLERNW+IRIPGYSADEIRS RKWNP Q+Y
Sbjct: 432 DDFITNVTSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTY 491

Query: 455 NQKLQSINIDKNGTNIKGTGTSGTGK 480
           NQKLQ IN DKN     G  T+ + K
Sbjct: 492 NQKLQQINNDKNNA-ASGNSTTASSK 516

 Score =  201 bits (512), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 141/230 (61%), Gaps = 10/230 (4%)

Query: 7   GQSNVPPSDPSANRGITLQ-KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKAL 65
           G  N P       R I LQ  Q+ EL+A+FK+LV EAK+VGE T  GKEL++QASKLKA+
Sbjct: 4   GNQNTPAPSNGQPRNIILQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAM 63

Query: 66  YDNYNXXXXXXXXXXXX--------XXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFAT 117
           YDNYN                                              + SS Q A 
Sbjct: 64  YDNYNRQRQQQLQQQQAVNNKVQNPSNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLAN 123

Query: 118 LIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAA-AKKQLD 176
           ++RQ LT EQN  +DKL Q F++RA+ +KDKHTFLKQNI+RL QEI KQ D   A+KQL+
Sbjct: 124 IMRQVLTDEQNANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLE 183

Query: 177 EKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKST 226
           EKR EL+ NLKAI++E+  L Q+Y NGKKAFYIECAK NPDLQ+LLQKST
Sbjct: 184 EKRGELLRNLKAITMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKST 233

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  293 bits (750), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 135/193 (69%), Positives = 157/193 (81%), Gaps = 2/193 (1%)

Query: 275 RSQSQITNVXXXXXXXX--XXXKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGG 332
           +S++++TNV             KS IFKQ++PA+PISE+IS+K P PV YR NRPT++GG
Sbjct: 325 QSKAKVTNVNATASMMSNVSANKSAIFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGG 384

Query: 333 SAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXX 392
           SAMNA+ALNTP+ TKLPPYE+DT+RVMSKRKLRELVKT+GIDEGDGETVI          
Sbjct: 385 SAMNASALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLD 444

Query: 393 XXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQ 452
               FVTNVT+FAC+LAKHRKSDNLE +DIQLHLERNWNIRIPGYSADEIRSTRKWNP+Q
Sbjct: 445 LADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ 504

Query: 453 SYNQKLQSINIDK 465
           SYNQKLQ+I  DK
Sbjct: 505 SYNQKLQNITSDK 517

 Score =  175 bits (443), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 93/224 (41%), Positives = 132/224 (58%), Gaps = 15/224 (6%)

Query: 17  SANRGITLQ-KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDN------- 68
           +A + +TLQ +QL E++A+F++L+ EA+ VGETTP GKEL+ QA+K+K +YD        
Sbjct: 26  AAQQNLTLQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRR 85

Query: 69  ------YNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQA 122
                 Y                                      R+ S+ +F+ +I+Q 
Sbjct: 86  QQAAQAYKNASMGNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSN-KFSNMIKQV 144

Query: 123 LTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIEL 182
           LTPE+NQ+Y+KL QNFQ R  +IK++  FLKQN+DRL QEI KQTD   K+QL+EK+ EL
Sbjct: 145 LTPEENQEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEINKQTDEGTKQQLEEKKNEL 204

Query: 183 MTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKST 226
           + + K + +EYT L   Y N KK FY+ECA+ NP L + LQ+ST
Sbjct: 205 LNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 248

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  292 bits (748), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 140/209 (66%), Positives = 162/209 (77%), Gaps = 8/209 (3%)

Query: 275 RSQSQITNVXXXXXXXX--XXXKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGG 332
           +S++++TNV             KS IFKQ++PA+PISE+IS+KTP PV YR NRPTI+GG
Sbjct: 329 QSKAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGG 388

Query: 333 SAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXX 392
           SAMNA+ALNTP  TKLPPYE+DT+RVMSKRKLRELVKT+GIDEGDGETVI          
Sbjct: 389 SAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLD 448

Query: 393 XXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQ 452
               FVTNVT+F+C+LAKHRKSDNLE +DIQLHLERNWNIRIPGYSADEIRSTRKWNP+Q
Sbjct: 449 LADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ 508

Query: 453 SYNQKLQSINIDK------NGTNIKGTGT 475
           +YNQKLQSI  DK      NG N+    T
Sbjct: 509 NYNQKLQSITSDKVAAAKNNGNNVASLNT 537

 Score =  176 bits (446), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/217 (42%), Positives = 128/217 (58%), Gaps = 8/217 (3%)

Query: 18  ANRGITLQ-KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXX 76
           A + + LQ +QL E++A+F++L+ EA+ VGETTP GKEL+ QA+K+K +YD         
Sbjct: 27  AQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQ 86

Query: 77  XXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQ 129
                                                    +S +F+ +I+Q LTPE+NQ
Sbjct: 87  QAAQAYNNTSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVLTPEENQ 146

Query: 130 QYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAI 189
           +Y+KL QNFQ R  +IK+K T+LKQNIDRL QEI KQTD   K+QL EK+IEL+ + K +
Sbjct: 147 EYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVL 206

Query: 190 SVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKST 226
            +EYT L   Y N KK FY+ECA+ NP L + LQ+ST
Sbjct: 207 KIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  291 bits (745), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 135/193 (69%), Positives = 156/193 (80%), Gaps = 2/193 (1%)

Query: 275 RSQSQITNVXXXXXXXX--XXXKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGG 332
           +S++++TNV             KS IFKQ++PA+PISE+IS+K P PV YR NRPTI+GG
Sbjct: 315 QSKAKVTNVNATASMMNNVSSSKSAIFKQTEPAIPISENISAKAPAPVAYRSNRPTITGG 374

Query: 333 SAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXX 392
           SAMNA+ALNTP  TKLPPYE+DT+RVMSKRKLRELVKT+GIDEGDGETVI          
Sbjct: 375 SAMNASALNTPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLD 434

Query: 393 XXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQ 452
               FVTNVT+F+C+LAKHR+SDNLE +DIQLHLERNWNIRIPGYSADEIRSTRKWNP+Q
Sbjct: 435 LADDFVTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ 494

Query: 453 SYNQKLQSINIDK 465
           SYNQKLQSI  DK
Sbjct: 495 SYNQKLQSITSDK 507

 Score =  176 bits (447), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 130/224 (58%), Gaps = 14/224 (6%)

Query: 17  SANRGITLQ-KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDN------- 68
           +A + + LQ +QL E++A+F +L+ EA+ VGETTP GKEL+ QA+K+K +YD        
Sbjct: 26  AAQQNMVLQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRR 85

Query: 69  ------YNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQA 122
                 Y                                         +S +F+++I+Q 
Sbjct: 86  QQAAQAYRNASMGNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQV 145

Query: 123 LTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIEL 182
           LTPE+NQ+Y+KL QNFQ R  +IK+K TFLKQNIDRL QEI KQT+  AK+QL EK+ EL
Sbjct: 146 LTPEENQEYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEINKQTEEGAKQQLQEKKNEL 205

Query: 183 MTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKST 226
           + + K + +EYT L   Y N KK FY+ECA+ NP L + LQ+ST
Sbjct: 206 LNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 249

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  287 bits (734), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 155/195 (79%), Gaps = 2/195 (1%)

Query: 276 SQSQITNVXXXXXXXXXXX--KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGS 333
           ++SQ+TNV             KS IFKQSDP VPISE+++ K P PV Y+ NRPT++GG+
Sbjct: 345 NKSQVTNVNATASMANNNAANKSAIFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGA 404

Query: 334 AMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXX 393
           AMNA+ LNTP +TKLPPYE+DTERVMSKRKLRELVKT+GID+GDGETVI           
Sbjct: 405 AMNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDL 464

Query: 394 XXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQS 453
              FVTNVT FAC+LAKHRKSDNL+T+DIQLHLERNWNIRIPGYSADEIRSTRKWNP+QS
Sbjct: 465 ADDFVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQS 524

Query: 454 YNQKLQSINIDKNGT 468
           YNQK+QSIN DK  T
Sbjct: 525 YNQKMQSINTDKTNT 539

 Score =  159 bits (402), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 96/112 (85%)

Query: 115 FATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQ 174
            A +I+Q LTPEQNQQYD L+Q FQTR NNI+DKH FL+Q+++ L QEI K+T+ AAKKQ
Sbjct: 139 LANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQ 198

Query: 175 LDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKST 226
           L++K++EL+TNLK++++EY+ L+Q++ NGKK FY+ECA+ NP LQRLLQKST
Sbjct: 199 LEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 1/51 (1%)

Query: 20 RGITLQ-KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNY 69
          +G  LQ +QL+EL  +F+ LV E+K VGE T  GKEL++QASK+KA+Y NY
Sbjct: 30 QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNY 80

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  278 bits (711), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 159/204 (77%), Gaps = 5/204 (2%)

Query: 277 QSQITNVXXXXXXXXX--XXKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSA 334
           +SQ+TNV             KS IFKQSDP+VPISESI+ K P  V Y  NRP+++GG+A
Sbjct: 374 RSQVTNVNATASSANKNIQSKSAIFKQSDPSVPISESITVKAPEAVSYISNRPSLTGGTA 433

Query: 335 MNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXX 394
           MNA+ LNTP +TKLPPYE+DTERVMSKRKLREL+K++GIDEGDGETVI            
Sbjct: 434 MNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGDVEELLLDLA 493

Query: 395 XXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSY 454
             FVTNVTSFAC+LAKHRKSD+LE +DIQLHLERNWNIRIPGYS DEIRSTRKW PTQSY
Sbjct: 494 DDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRSTRKWIPTQSY 553

Query: 455 NQKLQSINIDKNGTNI-KGTGTSG 477
           +QK+QSIN +K  +NI K +G++G
Sbjct: 554 SQKMQSINNEK--SNIAKNSGSTG 575

 Score =  195 bits (496), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 101/211 (47%), Positives = 130/211 (61%), Gaps = 17/211 (8%)

Query: 32  SARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXXXXXXXXXXXXXXXX- 90
           + +FK LV EAK+VG+ T  GKEL++QAS LKA+YDNYN                     
Sbjct: 31  TTKFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSSQTP 90

Query: 91  ----------------XXXXXXXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQQYDKL 134
                                             +   +Q A LI+Q LTPE+NQQYDKL
Sbjct: 91  AGTTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKL 150

Query: 135 VQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAISVEYT 194
           +QNFQ+RA++IKD+HTFLKQ+IDRL QEI +QTD AAKKQL+  R EL+TNL+ ++ EY+
Sbjct: 151 LQNFQSRASSIKDQHTFLKQHIDRLSQEINQQTDEAAKKQLEVNRAELLTNLRTLNTEYS 210

Query: 195 NLQQQYNNGKKAFYIECAKKNPDLQRLLQKS 225
           NL +   N KKAFY+ECA++NP+LQRLLQKS
Sbjct: 211 NLYEDIKNKKKAFYVECARQNPELQRLLQKS 241

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  267 bits (682), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 124/171 (72%), Positives = 137/171 (80%)

Query: 295 KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELD 354
           KS IFK SDP VPI++++S K P P+ +R NRPTIS GSAMNAAALNTP+MT LPPYE+D
Sbjct: 383 KSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEID 442

Query: 355 TERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKS 414
           T+RVMSKRKLRELVK+IGIDEGDGETVI              FVTNVT FAC+LAKHRKS
Sbjct: 443 TDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKS 502

Query: 415 DNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDK 465
           DNLE  DIQLHLERNWNIRIPGYSADEIRS  KWN + +Y QKL SIN DK
Sbjct: 503 DNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553

 Score =  219 bits (557), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 153/244 (62%), Gaps = 18/244 (7%)

Query: 1   MSSSNAGQS--NVPPSDPSANRG-----ITLQKQLMELSARFKSLVQEAKKVGETTPEGK 53
           MSS N+ Q   N   S PS + G        QKQ+ EL+ARFK LV EAKKVGETTP GK
Sbjct: 1   MSSQNSAQDSKNDNTSAPSGSGGPPSKSAIQQKQIQELTARFKQLVTEAKKVGETTPRGK 60

Query: 54  ELIMQASKLKALYDNYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSS- 112
           EL++QA+KLKA+Y+NY                                       SGS+ 
Sbjct: 61  ELLLQAAKLKAVYENYTRRQQALARAQQLQQQGSNTNAAASSGSSTTGTTGTANSSGSAS 120

Query: 113 ----------AQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQE 162
                     AQ A +I+Q LTPEQNQQY++L+QNFQ RA+ IKDKHTF+KQNIDRLV E
Sbjct: 121 TSGNNSSNSSAQLANIIKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVE 180

Query: 163 IEKQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLL 222
           I KQTD  AKKQL+EK+ EL+ N+KAI +E+  LQQ+  NGKK FY+ECA++NP LQRLL
Sbjct: 181 INKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLL 240

Query: 223 QKST 226
           Q+ST
Sbjct: 241 QRST 244

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  265 bits (678), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 147/194 (75%), Gaps = 3/194 (1%)

Query: 275 RSQSQITNVXXXXXXXXXXX---KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISG 331
           RS +Q+T+V              +  IFKQ +P++P+SE+++ K P  V YR NRPTI+G
Sbjct: 302 RSPTQVTSVNAAALLANNNTAAARQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITG 361

Query: 332 GSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXX 391
           GSAMNAAALNTP+MTKLPPYE+D+ERVMSKRKLRELVK++G+DEGDGET I         
Sbjct: 362 GSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVGVDEGDGETTIDGDVEELLL 421

Query: 392 XXXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPT 451
                F++NVT FAC+LAKHRKSDNL+ +DIQLHLERNWNIRIPGYSADEIRSTRKWN T
Sbjct: 422 DLADDFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNST 481

Query: 452 QSYNQKLQSINIDK 465
            +Y QKLQ IN  K
Sbjct: 482 TNYTQKLQGINAAK 495

 Score =  115 bits (288), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 110/200 (55%), Gaps = 2/200 (1%)

Query: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXXXXXXXXXXXXX 87
           + +L+ RF +L +EA ++G  T EG+EL+ QA+K+KA+YD YN                 
Sbjct: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQAFGQTNNRP 89

Query: 88  XXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKD 147
                                + ++   ++ IR  LTPEQ++ Y+KL + F   A NI+ 
Sbjct: 90  PAPAAGNPPQVAQNTQQRQNSNSANNP-SSNIRTLLTPEQSEAYNKLTKTFGDSAKNIRG 148

Query: 148 KHTFLKQNIDRLVQEIE-KQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKA 206
           +  +L++NI+ L  EI+ ++++  A ++L+  + EL+T L+ +   +  L Q+++  KK 
Sbjct: 149 ESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQKFHEAKKK 208

Query: 207 FYIECAKKNPDLQRLLQKST 226
           FYIECA  NP+L+R LQ ST
Sbjct: 209 FYIECAASNPNLKRFLQAST 228

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  266 bits (681), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 143/171 (83%)

Query: 295 KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELD 354
           KS++FK ++P V IS++IS+K PI VPYR NRP+++GGSAMNA+AL TP+ TKLPPYE+D
Sbjct: 436 KSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEID 495

Query: 355 TERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKS 414
           TERVMSKRKLRELVK+IG+DEGDGETVI              FVTNVTSFAC+LAKHR S
Sbjct: 496 TERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNS 555

Query: 415 DNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDK 465
           D+LE +DIQLHLE+NWNIRIPGYSADEIRS RKW+P Q+YNQKLQ IN DK
Sbjct: 556 DSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHINNDK 606

 Score =  133 bits (335), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 84/119 (70%), Gaps = 1/119 (0%)

Query: 107 GRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEK- 165
           G   SS Q A++++Q LTPEQNQ+YDKLV  FQTRA  IK+KH+F+KQNI+RL QE+ K 
Sbjct: 155 GNRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKP 214

Query: 166 QTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQK 224
             D   K QL+ K+ EL   ++AI+VE+  L QQ+  G+K FY+ECAK NP LQ   +K
Sbjct: 215 NLDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQNCYKK 273

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 5/60 (8%)

Query: 16 PSANRG---ITLQ-KQLMELSARFKSLVQEAKKVG-ETTPEGKELIMQASKLKALYDNYN 70
          P+ ++G   ITLQ  Q++ELS +FK+LV EAK++G + +  GKEL++QASK+KA+YD YN
Sbjct: 25 PAGHQGGPPITLQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYN 84

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  264 bits (674), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 126/191 (65%), Positives = 153/191 (80%), Gaps = 5/191 (2%)

Query: 295 KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELD 354
           KSVIFKQSDP VPIS++++ +    +PY+ NRP+++GG+AM+AAALN P +T LPPYE+D
Sbjct: 351 KSVIFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEID 410

Query: 355 TERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKS 414
           TERVM+KRKLREL+K +GIDEGDGETVI              FVTNVTSFAC+LAKHRKS
Sbjct: 411 TERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKS 470

Query: 415 DNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDK-NGTNIKGT 473
           +NLE++DIQLHLERNWNIRIPGYS DEIRSTRKW PTQ+++QKLQSIN DK N +N   T
Sbjct: 471 ENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSINNDKSNPSNTSKT 530

Query: 474 GTSGTGKNASK 484
               T KN+S+
Sbjct: 531 ----TAKNSSQ 537

 Score =  122 bits (305), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 80/112 (71%), Gaps = 3/112 (2%)

Query: 114 QFATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKK 173
           Q A +I+Q LT EQNQQYD LV+NF  +  +IKDKH FLKQNID+L QEI   ++     
Sbjct: 147 QIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVN 206

Query: 174 Q---LDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLL 222
               L+ KR EL+TNLK +S+E++ + +++ N KK FY+ECAK+NP LQ+LL
Sbjct: 207 VKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/45 (68%), Positives = 39/45 (86%)

Query: 25 QKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNY 69
          QKQL+EL+ +FK LV EAK VGE TP GKEL++QASKLKA+Y+N+
Sbjct: 27 QKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENF 71

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  256 bits (653), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 120/188 (63%), Positives = 142/188 (75%), Gaps = 1/188 (0%)

Query: 275 RSQSQITNVXXXXXXXXX-XXKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGS 333
           RS +Q+T V            + VIFKQ +P++PI ES+S  +   V YR NRPTI+GGS
Sbjct: 305 RSPTQVTPVNAAANQNSNGAARPVIFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGS 364

Query: 334 AMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXX 393
           AMNAAAL TP+MTKLPPYE+D+ERVMSKRKLRELVK++GID+GDGET I           
Sbjct: 365 AMNAAALTTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDL 424

Query: 394 XXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQS 453
              F+TNVTSFAC+LAKHRKSDNL+ +DIQLHLERNWNIR PGYSADEIRST+KWN T +
Sbjct: 425 ADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPA 484

Query: 454 YNQKLQSI 461
           Y QK+Q I
Sbjct: 485 YGQKMQVI 492

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 76/118 (64%), Gaps = 1/118 (0%)

Query: 112 SAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIE-KQTDAA 170
           ++  A+ I+  L P+Q + Y++L Q F   A NIK ++ FLK+NI+ L  EI+ +Q++  
Sbjct: 126 ASSVASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPI 185

Query: 171 AKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQR 228
             +QL+ K+ EL+  L +++ ++  L +++   KK FYIECA  N +L++ LQ ++Q+
Sbjct: 186 TVRQLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATSQQ 243

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%)

Query: 28 LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYN 70
          L +L+ +F +LV EA++VG  TPEG EL+ +ASK+KA+Y+ YN
Sbjct: 20 LQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETYN 62

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  254 bits (650), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 114/168 (67%), Positives = 137/168 (81%)

Query: 295 KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELD 354
           + VIFKQ +P++PI E+I+  T   V YR NRPTI+ GSAMNA+AL  P+MTKLPPYE+D
Sbjct: 355 RPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVD 414

Query: 355 TERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKS 414
           +ERVMSKRKLRELVKT+GID+GDGET +              F+TNVTSFAC+LAKHRKS
Sbjct: 415 SERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKS 474

Query: 415 DNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSIN 462
           DNL+ +DIQLHLERNWNIRIPGY+ADEIRST+KWNPT +Y+QKLQ I+
Sbjct: 475 DNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGIS 522

 Score =  112 bits (280), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 120/230 (52%), Gaps = 20/230 (8%)

Query: 1   MSSSNA-GQSNVPPSDPSANRGITLQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQA 59
           MSS+N  G   VP   PS+ R         +L+ +F++LV EA++VG  TPEG EL+ +A
Sbjct: 61  MSSNNQQGNGQVPQLTPSSMR---------QLAYKFRTLVSEAQQVGVRTPEGLELLKKA 111

Query: 60  SKLKALYDNYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATLI 119
           S +KA+Y+ Y+                                     R  SS   A+ I
Sbjct: 112 SNIKAIYETYHRQQAQQAFQVRNPAPAGQLAAAGTGQATAP-------RPTSS--VASNI 162

Query: 120 RQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIE-KQTDAAAKKQLDEK 178
           +  LTP+Q + Y+KL Q F     NI  ++ FLK+NI+ L  EI+ +Q +    KQL+ K
Sbjct: 163 KMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETK 222

Query: 179 RIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQR 228
           + EL+T L  ++ ++  L +++   KK FYIECA  N +L++ LQ ++Q+
Sbjct: 223 KNELLTKLTGLNTQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQ 272

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  253 bits (647), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (81%)

Query: 298 IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTER 357
           IFKQ +P++PISE++++   + V YR NRPTI+GGS MNA AL TP+MTKLPPYE+DTER
Sbjct: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394

Query: 358 VMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKSDNL 417
           VMSKRKLRELVKT+GIDEGDGET I              F+TNVT+FACKLAKHRKSD+L
Sbjct: 395 VMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLADDFITNVTNFACKLAKHRKSDSL 454

Query: 418 ETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDK 465
           + +DIQ+HLERNWNIRIPG++ DEIRST+KWNPT SYNQ + +IN +K
Sbjct: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNK 502

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 109/200 (54%), Gaps = 5/200 (2%)

Query: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNXXXXXXXXXXXXXXXXX 87
           + +L+ R KSLV EAK++G  T EGKEL+ QA+++KALY+ Y+                 
Sbjct: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQAGAQGAV 77

Query: 88  XXXXXXXXXXXXXXXXXXXGR----SGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRAN 143
                               +    + SS      I+  LTP+Q + Y++LVQ ++    
Sbjct: 78  NNNATNVKSMDQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRLVQKYEDDGQ 137

Query: 144 NIKDKHTFLKQNIDRLVQEIE-KQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNN 202
           NIK +  FLK+NI  L QEI  ++ ++ + +QL+  R EL+  ++A+S +Y+ LQQ+Y  
Sbjct: 138 NIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQQKYQE 197

Query: 203 GKKAFYIECAKKNPDLQRLL 222
            ++ FYIEC++ N DL+R L
Sbjct: 198 DRRKFYIECSQTNADLRRYL 217

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 116/205 (56%), Positives = 147/205 (71%), Gaps = 10/205 (4%)

Query: 275 RSQSQITNVXXXXXXXXXXXKSV--IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGG 332
           R QS ITNV                IFKQ++P +PISE +++K P  +PYR NRPT++GG
Sbjct: 541 RQQSAITNVNAAASTSSKSLTKTMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGG 600

Query: 333 SAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXX 392
           +AMN + LNTP++TKLPPYE+DT+RVM KRKL+E+V+++G+D+GDGETVI          
Sbjct: 601 TAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALLD 660

Query: 393 XXXXFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQ 452
               FVT+VT+FACK+AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IRS+RKWNPT 
Sbjct: 661 LADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTA 720

Query: 453 SYNQKLQSINIDKNGTNIKGTGTSG 477
           SYNQKL S+N         G G+SG
Sbjct: 721 SYNQKLNSLN--------PGKGSSG 737

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 92/118 (77%), Gaps = 1/118 (0%)

Query: 111 SSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEK-QTDA 169
           S+ Q A  I+Q LTPEQN+QYD+LV NFQ RA NIK+KH FLKQ+I R   E+ K    A
Sbjct: 226 SNVQLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPA 285

Query: 170 AAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQ 227
             + +L++K++ELM+NLKAIS++YT L Q++ NGKK+FYI CA++NP+LQRLLQK++ 
Sbjct: 286 LDRVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/46 (71%), Positives = 38/46 (82%)

Query: 25  QKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYN 70
           QKQLMEL A+FK LV EAKKVGE T  GKEL+MQA K+K +YDN+N
Sbjct: 58  QKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFN 103

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  244 bits (622), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 138/184 (75%)

Query: 295 KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELD 354
           K  IFK+S+P+VPI ESI +  P  V Y+VNRPTI+GGS MNA ALNTP+  K+P YE D
Sbjct: 320 KHKIFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEAD 379

Query: 355 TERVMSKRKLRELVKTIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTSFACKLAKHRKS 414
           T+RV+SKRKLRELV+T+G+DEGDGETV+              FV++VT+FAC+LAKHR S
Sbjct: 380 TDRVLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGS 439

Query: 415 DNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDKNGTNIKGTG 474
           D+LE +D+QLHLERNWNIR+PGY+ DEIRSTRKWN T +Y+QKL +I  D+       TG
Sbjct: 440 DSLEARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQDRTAAAGSATG 499

Query: 475 TSGT 478
            S T
Sbjct: 500 GSVT 503

 Score =  171 bits (432), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 93/227 (40%), Positives = 138/227 (60%), Gaps = 4/227 (1%)

Query: 1   MSSSNAGQSN--VPPSDPSANRGITLQKQLMELSARFKSLVQEAKKVGETTPEGKELIMQ 58
           M+ +N G  +    P+ P+A    T Q+QL+EL+ RFK  V EAK+VGETT  GK+L+++
Sbjct: 1   MADANNGNDSGAATPASPAAGSASTPQQQLVELAQRFKLFVGEAKRVGETTEAGKQLLVR 60

Query: 59  ASKLKALYDNYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATL 118
           A+K+KA+YD+                                        + ++ Q A  
Sbjct: 61  AAKIKAVYDSVRGASAGAAAQSQQRTADGATGNVATAPAAAGGGGGAG--NTAATQLAMA 118

Query: 119 IRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEK 178
           +RQALTPEQ QQYDK+  NFQ +A +I+DKH +LKQNID+L  EI KQ D +AK+QL EK
Sbjct: 119 MRQALTPEQVQQYDKIATNFQNKAKSIRDKHNYLKQNIDKLTAEINKQQDRSAKQQLAEK 178

Query: 179 RIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKS 225
           R EL+ +++ ++VE+ +L+  +   +K FY+ECAK NP LQ++LQ++
Sbjct: 179 RNELLRSVRQLTVEHNSLKVNFQLSRKNFYVECAKLNPKLQQILQRT 225

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  132 bits (331), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 84/117 (71%), Gaps = 1/117 (0%)

Query: 351 YELDTERVMSKRKLRELVKTIGIDEGDGETV-IXXXXXXXXXXXXXXFVTNVTSFACKLA 409
           YEL++ERV+SKRKLRELV+++ IDE D + + I              FV+N+TSF+C+L+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 410 KHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDKN 466
           +HR S+ +  +DIQLH+ERNWNIR+PG++ADEI+S +KW  +  Y   L S+N+ K+
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVNLAKH 390

 Score =  109 bits (272), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 116/206 (56%), Gaps = 7/206 (3%)

Query: 25  QKQLMELSARFKSLVQEAK-KVGETTPEGKELIMQASKLKALY----DNYNXXXXXXXXX 79
           QKQL EL+  FK+L+++AK   G+TT +GKEL+++A+K+K L+    + Y          
Sbjct: 12  QKQLNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNKYKNDSSSNDST 71

Query: 80  XXXXXXXXXXXXXXXXXXXXXXXXXXXGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQ 139
                                          S++  + +I+ ALTPEQN+ Y+ L+++FQ
Sbjct: 72  LSRSNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQNESYETLLKDFQ 131

Query: 140 TRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQ 199
            RA  IK +H+ +K+ ID + + +  +T+   ++ L  KR E +  LK +S +YT L QQ
Sbjct: 132 IRAAKIKREHSDVKEKIDNISKLLNSKTNN--QEALTAKRNEYLFQLKKLSKDYTELHQQ 189

Query: 200 YNNGKKAFYIECAKKNPDLQRLLQKS 225
           + N KK FY++ AK+N +LQ++LQ+S
Sbjct: 190 FQNEKKNFYLKSAKQNSELQKVLQES 215

>ZYRO0A06600g Chr1 (535933..538773) [2841 bp, 946 aa] {ON} similar
           to uniprot|P38810 Saccharomyces cerevisiae YHR098C SFB3
           Member of the Sec24p family forms a complex with Sec23p
           that is involved in sorting of Pma1p into COPII vesicles
           peripheral ER membrane protein potential Cdc28p
           substrate
          Length = 946

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query: 142 ANNIKDKHTFLKQNIDR------LVQEIEKQTDAAAKKQLDEKRIELMTNLKAI 189
           ++NI++   FL QN+ +      +VQ +      A +K +D+K +E++T  KA+
Sbjct: 635 SDNIREVFKFLNQNVAQRIMIKDVVQHLGDCDFPAIRKTIDDKMVEILTQYKAL 688

>TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4.297
           YKL192C
          Length = 143

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 398 VTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRS 444
           VTN T FA    K    D+L+T ++ + +E  ++I IP   AD+++S
Sbjct: 86  VTNETQFA----KDLSLDSLDTVELLVAIEEEFDIEIPDNVADDLKS 128

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 30.0 bits (66), Expect = 6.0,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 398 VTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRK 447
           +TN T FA  L      D+L+T ++ + +E  ++I IP   ADEI+S ++
Sbjct: 66  ITNDTHFAKDLGL----DSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 295 KSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALN-TPIMTKLPPYEL 353
           K V  +Q+  AVPIS+++    P P   R+NR  +    ++N  A   T I     P  +
Sbjct: 324 KEVGVEQTTEAVPISKNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPV 383

Query: 354 DTERVMSKRKLRELVKTIGIDEGDGET 380
           +    ++++K +E++K+ G  E + ET
Sbjct: 384 EEANNITRKKDKEVIKSQGKGEINIET 410

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 29.6 bits (65), Expect = 6.9,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 398 VTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRS 444
           +TN T FA  L      D+L+T ++ + +E  ++I IP   ADEI+S
Sbjct: 66  ITNDTHFAKDLGL----DSLDTVELLVAIEEEFDIEIPDKVADEIKS 108

>Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {ON}
           YNL166C (BNI5) - bud neck protein [contig 102] FULL
          Length = 300

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 298 IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAA 339
           ++++  P+ P S S + K P P    V  P + GG A ++AA
Sbjct: 147 LYQEPAPSAPSSVSTTPKAPTPPSPAVTLPKVRGGPAASSAA 188

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,326,044
Number of extensions: 1397484
Number of successful extensions: 5892
Number of sequences better than 10.0: 73
Number of HSP's gapped: 6115
Number of HSP's successfully gapped: 113
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)