Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B055708.255ON66966933930.0
YDR108W (TRS85)8.255ON69868620980.0
Suva_2.2688.255ON69568020790.0
NCAS0B038808.255ON70669120690.0
Skud_4.3698.255ON69868320570.0
Smik_4.3548.255ON69867820510.0
TDEL0F038208.255ON68767920190.0
ZYRO0C01826g8.255ON69969920130.0
NDAI0J014108.255ON71670020070.0
Kpol_392.118.255ON67568119630.0
CAGL0B01705g8.255ON67268119110.0
Kwal_56.235838.255ON70070216650.0
KLTH0G13860g8.255ON70870516620.0
TPHA0B032608.255ON71455216530.0
KNAG0H032708.255ON64869715920.0
SAKL0H17226g8.255ON71973115660.0
TBLA0E043808.255ON88962614840.0
AGR096C8.255ON62366512491e-164
Ecym_43168.255ON62366812261e-160
KLLA0F18953g8.255ON64767811361e-146
KAFR0L017107.387ON1151126790.72
NDAI0H005704.91ON90347708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05570
         (669 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...  1311   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   812   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   805   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   801   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   796   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   794   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   782   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   780   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   777   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   760   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   740   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   645   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   644   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   641   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   617   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   607   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   576   0.0  
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   485   e-164
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   476   e-160
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   442   e-146
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...    35   0.72 
NDAI0H00570 Chr8 complement(129018..131729) [2712 bp, 903 aa] {O...    32   8.7  

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/669 (95%), Positives = 638/669 (95%)

Query: 1   MINFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDS 60
           MINFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDS
Sbjct: 1   MINFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDS 60

Query: 61  LYMLLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRF 120
           LYMLLRFFGGCVSDRDQASESKANAPH                   LFQRDSTQSQYIRF
Sbjct: 61  LYMLLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTRARSRSNSLFQRDSTQSQYIRF 120

Query: 121 TRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAI 180
           TRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAI
Sbjct: 121 TRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAI 180

Query: 181 SSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDML 240
           SSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDML
Sbjct: 181 SSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDML 240

Query: 241 PVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLD 300
           PVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLD
Sbjct: 241 PVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLD 300

Query: 301 EMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS 360
           EMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS
Sbjct: 301 EMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS 360

Query: 361 KFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATY 420
           KFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATY
Sbjct: 361 KFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATY 420

Query: 421 EILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANT 480
           EILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANT
Sbjct: 421 EILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANT 480

Query: 481 HLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINYLESILEESRL 540
           HLSNKKIGPTNESTSLEPVLSYETRC            DTWTSTPYAINYLESILEESRL
Sbjct: 481 HLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAINYLESILEESRL 540

Query: 541 GPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNSQDDLNPSNIV 600
           GPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNSQDDLNPSNIV
Sbjct: 541 GPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNSQDDLNPSNIV 600

Query: 601 SQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE 660
           SQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE
Sbjct: 601 SQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE 660

Query: 661 YNIAVSDSK 669
           YNIAVSDSK
Sbjct: 661 YNIAVSDSK 669

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/686 (58%), Positives = 501/686 (73%), Gaps = 29/686 (4%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
           FSYEHYMNLLFHL+ S E +P EIA+RI+S+AIAPVITVTSTP  DKHIQ+TY +DSLYM
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESKANA----------------PHXXXXXXXXXXXXXXXXXXXL 107
           LLRFFGGCVSDRDQA+E+K                    +                   L
Sbjct: 63  LLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNSL 122

Query: 108 FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLL 167
           FQRDSTQSQYIRFTRPL DL+E  D NDMLF++HSLE +L  YL+LV   T +   H LL
Sbjct: 123 FQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNLL 182

Query: 168 KKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTI 227
           KKS+YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+N + YEDA+ LL+ FKNL++  
Sbjct: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242

Query: 228 DKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNS--YQT 285
           + FPI++NT +MLPVFLLCYN DS EE ++C+ L+ K+KKQLFVESI L LWK+S  Y  
Sbjct: 243 ENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYDE 302

Query: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345
              I+LHQPVMSSL+E+++FLQ+  Q TL + L N+ YDML+ LVY L+IPFM+RK++FW
Sbjct: 303 NSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFW 362

Query: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405
           EET+LQP+KS+F+G+KF KK M++   + + Q N LT+D  GNEYFASSS E L+RKLAD
Sbjct: 363 EETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLAD 422

Query: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465
           WS+MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ+IVTVKM+KNDI+PL
Sbjct: 423 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 482

Query: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSL---EPVLSYETRCXXXXXXXXXXXXDTWT 522
           I+RAL  Y+ C      S  + G   ES SL   EPV SYETRC            +TWT
Sbjct: 483 IERALATYENC------SRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWT 536

Query: 523 STPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPAD 582
           STPYAI YLE+IL+E +LGPCS+IM+WERLSDCY+LRVDPRIK +V  ++K     E   
Sbjct: 537 STPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLR 596

Query: 583 NEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYS 642
            EH+   S D     +I+S+GLTR+RKAAFFRL+AAK WAEQ QW+QV WCL +I   YS
Sbjct: 597 GEHKY--STDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYS 654

Query: 643 RVGLVNRDDLILTRLREEYNIAVSDS 668
            +  ++ + LIL++L+ + N+   DS
Sbjct: 655 EIKFLHGNGLILSKLKNQLNLKDVDS 680

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/680 (58%), Positives = 502/680 (73%), Gaps = 20/680 (2%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
           FSYEHYMNLLFHL+ S E +P EIA+RIVS+AIAPVITVTSTP  DKHIQ+ YS+DSLYM
Sbjct: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESK-------------ANAPHXXXXXXXXXXXXXXXXXXXLFQR 110
           LLRFFGGCVSDRDQA+E K             +++ +                   LFQR
Sbjct: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQR 122

Query: 111 DSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKS 170
           DSTQSQY+RFTRPL DL+E  D NDMLF++HSLE +L  YL+LV   T +   H LLKKS
Sbjct: 123 DSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKKS 182

Query: 171 LYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKF 230
           +YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+  + YEDA+ LL+ FKNL++  + F
Sbjct: 183 IYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTESF 242

Query: 231 PIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQ--TEPF 288
           PI++NT +MLPVFLLCYN +S EE ++C+ L+ K+KKQLFVESI LPLWK+S+       
Sbjct: 243 PIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVENSN 302

Query: 289 IKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEET 348
           I+LHQPVMSSL+E+++FL++  Q  L + L N+ YDML+ LVY L+IPFM+RKI+FWEET
Sbjct: 303 IQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEET 362

Query: 349 VLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSI 408
           +LQP+KS+F+G+KF KK M++A  + + Q N LTKD+ GNEYFASSS E L+RKLADWS+
Sbjct: 363 ILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSM 422

Query: 409 MLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDR 468
           MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ+IVTVKM+KNDI+PLI+R
Sbjct: 423 MLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIER 482

Query: 469 ALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAI 528
           AL  Y+ C+     ++K++     S  LEPV SYETRC            DTWTSTPYAI
Sbjct: 483 ALATYENCSRMQRRNSKEL---TSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAI 539

Query: 529 NYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRIL 588
            YLE+IL+E +LGPCS+IM+WERLSDCY+LRVDPR+K KV  ++K     E   N+    
Sbjct: 540 QYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEY- 598

Query: 589 NSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVN 648
              D     +I+S+GLTR+RKAAFFRL+AAK WAEQ QW+QV WCL +I + YS +  ++
Sbjct: 599 -DTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657

Query: 649 RDDLILTRLREEYNIAVSDS 668
            + LIL+ L+ + N    DS
Sbjct: 658 GNGLILSNLKNQLNSKDVDS 677

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/691 (57%), Positives = 507/691 (73%), Gaps = 29/691 (4%)

Query: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61
           +NFSYEHYMNLLFHL+   E +PSEIA+RIVS+AI+PVI VTST ELD HI +TY+IDSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 62  YMLLRFFGGCVSDRDQASESKANAPHXXXXXXX----------XXXXXXXXXXXXLFQRD 111
           YMLLRFF GCVSDRDQA+E + +                                LFQRD
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQRD 120

Query: 112 STQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSL 171
           STQSQYIRFT+PL D++   + NDMLFD+HSLE YL+ YL+L++K T D+T ++LLKKS+
Sbjct: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180

Query: 172 YHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFP 231
           YH+FFSLAISSTT LSP+E FNHP++SLIA+DI+  Q+Y+D + LL+ FKNL+++   FP
Sbjct: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240

Query: 232 IYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKL 291
           I++NT DMLPV LLCY+    E+ + C+ L+ KIKKQLFVE ISLPLWK+SY ++P + L
Sbjct: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHL 300

Query: 292 HQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQ 351
           HQPVMSSL+EMIYFL   ++ TLP EL  + Y++L+ LVY L+IPFM+RKIAFW+ET+LQ
Sbjct: 301 HQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQ 360

Query: 352 PKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLS 411
           P+KS+FHG+KFLKK M++  T+   Q+N+LTKD  GNEYF S+S E L+RKLADWS+MLS
Sbjct: 361 PRKSLFHGAKFLKKFMTK--TALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLS 418

Query: 412 DFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALD 471
           DFKT YATYE L+HDLE FPKY ASCLEW AVSLLMGAQNIVTVKM+KNDI+PLI++AL 
Sbjct: 419 DFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALS 478

Query: 472 AYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINYL 531
            Y+ CA     ++K+     +   + PV SYETRC            DTWTSTPYAI+YL
Sbjct: 479 TYENCATVLPETDKR---NTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYL 535

Query: 532 ESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKV-------------EQVQKQDNLE 578
           E+IL E +LG CS+IMIWERLSDCY+LRVDPRIK K               +   Q ++ 
Sbjct: 536 ETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVM 595

Query: 579 EPAD-NEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNI 637
            P+   +  + N  ++    +IVS+G TRKRKAAFFRL+AAK WAEQ +W+QV WCL +I
Sbjct: 596 TPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSI 655

Query: 638 TDIYSRVGLVNRDDLILTRLREEYNIAVSDS 668
            D YS++GL +RDDLIL +++ +   A +++
Sbjct: 656 DDTYSKIGLADRDDLILKKIQNKLKTAETET 686

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/683 (58%), Positives = 503/683 (73%), Gaps = 23/683 (3%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
           FSYEHYMNLLFHL+ S+E +P EIA+RIVS+AIAPVITVTSTP  DKHIQ+TY++DSLYM
Sbjct: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESKAN----------------APHXXXXXXXXXXXXXXXXXXXL 107
           LLRFFGGCVSDRDQA+E K                  + +                   L
Sbjct: 63  LLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSNSL 122

Query: 108 FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLL 167
           FQRDSTQSQYIRFTRPL DL+E  D NDMLF++HSLE YL  YL+LV + T ++  H LL
Sbjct: 123 FQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHDLL 182

Query: 168 KKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTI 227
           KKS+YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+N + YEDA+ LL+ FKNL++  
Sbjct: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242

Query: 228 DKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY--QT 285
           + FPI++NT +MLPVFL+CYN +S EE ++C+ L+ K+KKQLFVESI LPLWK S+    
Sbjct: 243 ENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFIDDE 302

Query: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345
              IKLHQPVMSSL+E+++FLQ+  Q TL + L N+ YD+L+ LVY L+IPFM+RK++FW
Sbjct: 303 NSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSFW 362

Query: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405
           EET+LQP+KS+F+G+KF KK M++   +   Q N LT+D  GNEYF+SSS E L+RKLAD
Sbjct: 363 EETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLAD 422

Query: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465
           WS+MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ+IVTVKM+KNDI+PL
Sbjct: 423 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 482

Query: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTP 525
           I+RAL  Y+ C+       K++     S+  EPV SYETRC            DTWTSTP
Sbjct: 483 IERALATYEKCSQIQRHKGKELS---SSSVTEPVRSYETRCMILASELFLSLSDTWTSTP 539

Query: 526 YAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEH 585
           YAI YLE+IL+E +LGPCS+IMIWERLSDCY+LRVDPRIK +V  ++K  + +E  D  +
Sbjct: 540 YAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKK--SFKETEDLRN 597

Query: 586 RILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVG 645
              +  D     +I+S+GLTR+RKAAFFRL+AAK WAEQ  W+QV WCL +I   YS + 
Sbjct: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657

Query: 646 LVNRDDLILTRLREEYNIAVSDS 668
            ++ +D IL++L+ + N+   DS
Sbjct: 658 FLHCNDSILSKLKSQLNLKDLDS 680

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/678 (57%), Positives = 493/678 (72%), Gaps = 23/678 (3%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
           FSYEHYMNLLFHL+ S E +P EIA+RIVS+AIAPVITVTSTP  DKHIQ+ Y +DSLYM
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXX----------------XXXXXXXL 107
           LLRFFGGCVSDRDQA+E K                                        L
Sbjct: 63  LLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNSL 122

Query: 108 FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLL 167
           FQRDSTQSQYIRFTRPL DL+E  D NDMLF++HSLE +L  YL+LV   T +   H LL
Sbjct: 123 FQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDLL 182

Query: 168 KKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTI 227
           KKS+YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+N + YEDA+ LL+ FKNL++  
Sbjct: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242

Query: 228 DKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY--QT 285
           + FP+++NT +MLPVFLLCYN +S EE ++C+ L+ K+KKQLFVES+ L LWK+S+    
Sbjct: 243 ENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEAN 302

Query: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345
              I+LHQPVMSSL+E+++FLQ+  Q +L + L N+ YDML+ LVY L+IPFM+RK++FW
Sbjct: 303 NSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFW 362

Query: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405
           EET+LQP+KS+F+G+KF KK M++  ++ +   N LT D+ GNEYFASSS E L+RKLAD
Sbjct: 363 EETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLAD 422

Query: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465
           WS+MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ IVTVKM+KNDI+PL
Sbjct: 423 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINPL 482

Query: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTP 525
           I++AL  Y+ C+      ++K   +N   ++EPV SYETRC            D WTSTP
Sbjct: 483 IEKALATYENCSKIQRSKSEKSSSSN---TVEPVRSYETRCMILASELFLSLSDKWTSTP 539

Query: 526 YAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEH 585
           YAI YLE+IL+E +LGPC +IMIWERLSDCY LRVDPRIK +V  ++K   + +  D   
Sbjct: 540 YAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKK--GIRDTEDLRG 597

Query: 586 RILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVG 645
              NS D     +I+S+GLTRKRKAAFFRL+AA+ WAEQ QW+QV WCL +I  IYS + 
Sbjct: 598 GDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIK 657

Query: 646 LVNRDDLILTRLREEYNI 663
            +N D LIL++L  + N+
Sbjct: 658 FLNGDGLILSKLHNQLNL 675

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/679 (56%), Positives = 494/679 (72%), Gaps = 20/679 (2%)

Query: 1   MINFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDS 60
           M+  SYE+YMNLL HL+  D+ +P++IA+RIVS+AI+PVI VTSTPELD+HIQ+T+ +DS
Sbjct: 1   MVKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDS 60

Query: 61  LYMLLRFFGGCVSDRDQASE-SKANAP-------HXXXXXXXXXXXXXXXXXXXLFQRDS 112
           LYMLLRFFG CV DRDQA E + A +P                           LFQRD+
Sbjct: 61  LYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDA 120

Query: 113 TQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLY 172
           TQSQYIRFTRPL DLVE  D NDMLFD+H+LES+L   L L+EK T D T H+LLKKSLY
Sbjct: 121 TQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLY 180

Query: 173 HNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPI 232
           H FFSLAISST  LSP+E+FNHP++SLIALDI   Q YE+A+ LL KFKNL++T   FP+
Sbjct: 181 HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV 240

Query: 233 YINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLH 292
           ++NT D+LPVFLLCYN DS E+ + C+ L+ K+KKQLFVE I LPLWK++Y+T   + LH
Sbjct: 241 FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILH 300

Query: 293 QPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQP 352
           QP+M+SLDE++YFL+   +  L +EL N+ YD+LE L+  L+IPFMQRKI+FWEET+LQP
Sbjct: 301 QPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQP 360

Query: 353 KKSIFHGSKFLKKLMSRASTSS--HQQQNILTKDHDGNEYFASSSPELLLRKLADWSIML 410
           ++S+FHGSKFLK+ MS+ ++ +  HQQ +I  KD +G EYF SSS E L+RKLADWS+ML
Sbjct: 361 RRSLFHGSKFLKRFMSKTTSGTNIHQQASI-AKDANGKEYFVSSSAEFLMRKLADWSMML 419

Query: 411 SDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRAL 470
           SD+KT Y+TY+ LSHDLE +PKYLASCLEW +VS+LMGAQNIVT KM+K DI PLI RA+
Sbjct: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479

Query: 471 DAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINY 530
           + Y+ CA    L + ++  + +S S+ PV SYETRC            DTWTSTPYA+  
Sbjct: 480 ETYENCA----LYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRN 535

Query: 531 LESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNS 590
           LE+IL E RLGPCS+IMIWERLS+CY  R+D RI+ KV      +  EE  +NE    +S
Sbjct: 536 LETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSN--EEKVENED---DS 590

Query: 591 QDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRD 650
           + +   ++IV++GLTR RKAAFF+L+AA  WAEQ QW+Q  WCL +  D Y+ +  VNR 
Sbjct: 591 EKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRK 650

Query: 651 DLILTRLREEYNIAVSDSK 669
           DL L +L+E       DS+
Sbjct: 651 DLALAKLKETLKNVEIDSR 669

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/699 (56%), Positives = 488/699 (69%), Gaps = 53/699 (7%)

Query: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61
           +  SYE+YMNLLFHL+   E +P +IARRIVS+A++PVITV+STPELD+HI+DTY +DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 62  YMLLRFFGGCVSDRDQAS-----------ESKANAPHXXXXXXXXXXXXX---------- 100
           YM LRFFG CVSDRDQA+           E  A  P                        
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 101 --------------XXXXXXLFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESY 146
                               LFQRD TQSQY+RFTRP+ DL+E  D NDMLFD+HSLE +
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 147 LRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITN 206
           L   L LVE++T D+T  +LLKKSLYH FFSLAISSTT LSP+E+FNHP++SLIA+DI+ 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 207 SQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIK 266
            Q YE+A+ LLIKFKNL++T++ FPI+++T D+LPVFLLCYN +S +E   C++L+ ++K
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 267 KQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDML 326
           KQLFVES+ LPLWK SY     ++LHQP+MSSL+EM+YFLQS     LP++L N TY++L
Sbjct: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360

Query: 327 EKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNI-LTKDH 385
           EKLV  L++PFM+RKI+FWEET+LQP+KS+FHG+ F KKLMS+ S  S+  Q I L KD 
Sbjct: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420

Query: 386 DGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSL 445
           +GNEYF +SS E L+RKLADWS+MLSDFKT Y+TYE L HDLE FPKYLASC EW AVS+
Sbjct: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480

Query: 446 LMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETR 505
           LMGAQNIVTVKM+KNDI PLI RAL+ Y+ CAA+   + +++          PV SYETR
Sbjct: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEEL--------YVPVRSYETR 532

Query: 506 CXXXXXXXXXXXXDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIK 565
           C            DTWTSTPYA+N LE+IL E RLGPCS IMIWERLSDCY  R+DPRI+
Sbjct: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592

Query: 566 SKVEQVQKQDNLEEPADNEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQG 625
            K      +   +E A +E          +   IV++GLTRKRKAAFFRL+AA  W EQ 
Sbjct: 593 HKTSAQGAKAMTDELAPDEE---------SNEEIVTRGLTRKRKAAFFRLIAANKWVEQK 643

Query: 626 QWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREEYNIA 664
           QWKQ  WCL  I + Y+ +  VNR+DLIL RL+ + N A
Sbjct: 644 QWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMNEA 682

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/700 (55%), Positives = 497/700 (71%), Gaps = 39/700 (5%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
           FSYEHYMNLLFHL+ + E++P EIA+RIVS+AIAPVITVTSTP+LD HIQ+TY+IDSLYM
Sbjct: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62

Query: 64  LLRFFGGCVSDRDQASE----SKANAPH--------------XXXXXXXXXXXXXXXXXX 105
           LLR+FGGCVSDRDQA+E     + +  H                                
Sbjct: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRSN 122

Query: 106 XLFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQ 165
            LFQRDSTQSQYIRFT+P+ D+V     NDMLFD+HSLE YL QYL+L+   T +ST ++
Sbjct: 123 SLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYE 182

Query: 166 LLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHN 225
           LLK S+YHNFFSLAISSTT LSP+E+FNHPI+SLIA+DI+  Q+Y+D + LL++FKNL+ 
Sbjct: 183 LLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNT 242

Query: 226 TIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQT 285
           T   FPI++NT DMLP+FLLCY+A+  E+ + C+ L+ ++KKQLFVES+ LPLW   Y+ 
Sbjct: 243 TTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEI 302

Query: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345
           +  + LHQP+MSSL+EMIYFLQ+     L I L N+ Y++L+ L+Y L++PFM+RK+ FW
Sbjct: 303 DIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLLFW 362

Query: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405
           EET+LQP++S+FHG+KFLKK M++   ++  Q+NILTKD +GNEYFA SS ELL+RKLAD
Sbjct: 363 EETILQPRRSLFHGAKFLKKFMTK--NNNGPQENILTKDSEGNEYFAFSSTELLMRKLAD 420

Query: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465
           WS+M+SDFKT Y+TYE LS DL+ FPKYLASCLEW A SLLMGAQ+IVTVKM+KNDI+PL
Sbjct: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480

Query: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTP 525
           I+RAL  Y+ CA    L            S+EP+ SYETRC            DTWTSTP
Sbjct: 481 IERALQTYENCAIT--LIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTP 538

Query: 526 YAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDN--------- 576
           YAI YLE+IL E +LGPCS+I IWERLSDCY LR+DPRI+ K+                 
Sbjct: 539 YAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADK 598

Query: 577 -LEEPADNEHRILNSQDDL-----NPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQV 630
            +  P+ ++ + +  + DL     +  NI+S+G TR+RK+AFFRL+AAK WAEQ QW+QV
Sbjct: 599 VVATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQV 658

Query: 631 KWCLDNITDIYSRVGLVNRDDLILTRLRE--EYNIAVSDS 668
            WCL ++  IY    L  RDDLI+ +LR   + NI   D 
Sbjct: 659 AWCLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDG 698

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/681 (54%), Positives = 484/681 (71%), Gaps = 38/681 (5%)

Query: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61
           + FSYE+YMNL++HL+  +E +P +I++RIVS+AIAPVITV ST ELD+H+QD+Y+IDSL
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 62  YMLLRFFGGCVSDRDQASE--SKANAPHXXXXXXX----------------XXXXXXXXX 103
           Y+L+R+FGGC+SDRDQA+E   KAN  +                                
Sbjct: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123

Query: 104 XXXLFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTS 163
              LFQRDSTQS YIRFT+P+ DL+   D +DMLFD+HSLE YL + L L++K T D T 
Sbjct: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183

Query: 164 HQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNL 223
           H+ LK SL+H FFS AISSTT LSP+ESFNHP++SL+ALDI+  Q+YEDA+ LLIKFKN 
Sbjct: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243

Query: 224 HNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY 283
           +N +++FP +++T D+L VFLLCY+ DS E+ + C+++  K+KKQLF ES+ LPLW  S+
Sbjct: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303

Query: 284 QTEPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIA 343
             +  ++LHQP MSSLDEM+YF +    + LP+ L NT YD++EKLV  L+IPFMQRKI+
Sbjct: 304 SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKIS 363

Query: 344 FWEETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKL 403
           FWEET+LQP+KS+FHG+K  +K M+R+S+ +  Q N + KD  GNEYF SSSPE LLRKL
Sbjct: 364 FWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKL 423

Query: 404 ADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDIS 463
           ADWS+M+SDFKT Y+TYE L  DLE  PKYLASCLEW A+S+LMGAQNIVT KM+KND++
Sbjct: 424 ADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVN 483

Query: 464 PLIDRALDAYDACA--ANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTW 521
           PLI+R+LD Y+ C+  A   L N ++         EPV SYETRC            DTW
Sbjct: 484 PLIERSLDTYEQCSILAQNSLENDELLS-------EPVRSYETRCMLLTSELFLSLNDTW 536

Query: 522 TSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPA 581
           TSTPYA++ LE+IL E +LG CS+IMIWERLSDCY++R DPRI+ +VE V K +N E   
Sbjct: 537 TSTPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENNE--- 593

Query: 582 DNEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIY 641
                       L   +IVS+GL RKRKAAFFRLLAAK WAEQ QW+QV WCL ++  IY
Sbjct: 594 --------GGQQLQTDDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIY 645

Query: 642 SRVGLVNRDDLILTRLREEYN 662
             +    R +LI  +L++E N
Sbjct: 646 DDLSFSKRPELIYQKLKDELN 666

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/681 (52%), Positives = 484/681 (71%), Gaps = 29/681 (4%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
           FSYEHYMNL++HL+ ++E +PS+IA+R+VS+A+APVITVTST  LD+HI++TY IDSLYM
Sbjct: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESK-------------ANAPHXXXXXXXXXXXXXXXXXXXLFQR 110
           LLRFFGGCVSDRDQA+E K              N                      L+QR
Sbjct: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQR 122

Query: 111 DSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKS 170
           D+TQSQY+RFT+PL DL+   D NDMLFD+HSLE YL++YL +V+K       H LLK S
Sbjct: 123 DATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKTS 182

Query: 171 LYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKF 230
           +YH+FF+LAISST+ LSPFE FNHPI+SL+A+DIT ++ YE A   L +FK+++N I  F
Sbjct: 183 IYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPSF 242

Query: 231 PIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIK 290
           P +INT D+LPVFLLCYN D+  E ++C+ L+ K+KKQLFVESI LPLW   +     + 
Sbjct: 243 PSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVVS 302

Query: 291 LHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVL 350
           LHQPVMSS++E+++FLQ+   + LP++L N  YD ++ +VY L+ PFM+RK+ FWEET+L
Sbjct: 303 LHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETIL 362

Query: 351 QPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIML 410
            P+KS+FHG+KF KK M++ ST +  Q N L K++ G+ Y +S+SPE L+RKLADWS+M+
Sbjct: 363 TPRKSLFHGAKFFKKFMNK-STQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMV 421

Query: 411 SDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRAL 470
           SDFKT Y TYE L  D E  PKYLASC EW AVSLLMGAQNIVT KM+KN+I+P I+RAL
Sbjct: 422 SDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERAL 481

Query: 471 DAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINY 530
            AY+ CA  ++ +++K G +++ ++  PV SYETRC            DTWTSTP+AI Y
Sbjct: 482 GAYELCATESN-AHRKFGDSDDLSA--PVRSYETRCMFLASELFLSLSDTWTSTPFAIAY 538

Query: 531 LESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQ----KQDNLEEPADNEHR 586
           LE+IL E +LGP S IMIWERLSDCY +R+DPRIK ++  ++    K++N+++P +    
Sbjct: 539 LETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKN---- 594

Query: 587 ILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGL 646
                D     +I+S+GLTR RKAA F+L+AA+ W EQ QW+++ WCLD++   YS +  
Sbjct: 595 ----ADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKC 650

Query: 647 VNRDDLILTRLREEYNIAVSD 667
            N+++L+ TRLR E   A  D
Sbjct: 651 FNKENLLYTRLRNELIAARQD 671

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/702 (48%), Positives = 452/702 (64%), Gaps = 59/702 (8%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
            SYE YMNL+ HL+ + E +PSEI+R+IVS+A++PV+TVTS+  LDKHIQ++Y +DSLYM
Sbjct: 3   LSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRFTRP 123
           LLR+FG C+SDRDQA   + +                      LFQR +  SQ++RFTRP
Sbjct: 63  LLRYFGDCISDRDQADSEQESG-------VEPNKSRARSRSGSLFQRQA--SQFLRFTRP 113

Query: 124 LPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISST 183
           L D++   +  D+LFD+HSLE +L++YLELV+  T   T H LL+ S+YH FF+ AISST
Sbjct: 114 LSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQHSIYHKFFTTAISST 173

Query: 184 TTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVF 243
             LSP+E FNHP+ SL+ALDI+ ++ YEDA+ LL+ FKN+HN    FP +IN  D+LPVF
Sbjct: 174 AHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTPHFPSFINVNDILPVF 233

Query: 244 LLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTE--PFIKLHQPVMSSLDE 301
           LLCY   S E+ + C+ L+  +KKQLFVES+ LP W  ++  +  P   LHQP+MSSL+E
Sbjct: 234 LLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDTPTRVLHQPIMSSLEE 293

Query: 302 MIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSK 361
            ++ +  D    LP+      YD L KLV  L+IPFM+RKI+FWEE++LQP++SIF  SK
Sbjct: 294 TMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWEESILQPRRSIFPNSK 353

Query: 362 FLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYE 421
           F +KL+S+A T S    +  T    G  YFA++S ELLLRKLADWS MLSDFKT Y+TYE
Sbjct: 354 FFRKLISKAPTPSTNNDSA-THSEQGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYE 412

Query: 422 ILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACA---- 477
           +LS D E  P+YLA CLEW A+S+LMGAQ+IVTVKM+KNDI PLI RAL +Y+ CA    
Sbjct: 413 LLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAK 472

Query: 478 -------------------------ANTHLSNKKIGPTN---ESTSLEPVLSYETRCXXX 509
                                    +N+H  ++  G T+    ST  +   SYETRC   
Sbjct: 473 ERNGLLKSKLQNRDHDKSLNGFETISNSH-DDRVSGTTDFEISSTPSQSAQSYETRCMLL 531

Query: 510 XXXXXXXXXDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKV- 568
                    DTWT+TPYAI YLE+IL++  +G  S I+IWERL+ CY LRVDPR+KS++ 
Sbjct: 532 AAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCYALRVDPRVKSRLT 591

Query: 569 -------EQVQKQDNLEEPADN----EHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLA 617
                  +Q +K D   E +DN    E ++   Q  ++ S I S GLTRKRKA  FRL+A
Sbjct: 592 ASEIQSSDQNEKLDEESEGSDNDSGDESQVC--QHKMSQSCIASSGLTRKRKATLFRLIA 649

Query: 618 AKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLRE 659
            K W E  QW+Q  W   ++  +YS +   NR+DLIL +L +
Sbjct: 650 TKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEK 691

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/705 (47%), Positives = 441/705 (62%), Gaps = 65/705 (9%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
            S+  YMNL FHL+ + E +P+EI+R+IVS A++PV+TVTST  LD+HIQ++Y +DSLYM
Sbjct: 3   LSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSLYM 62

Query: 64  LLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRFTRP 123
           LLR+FG CVSDRDQA                            LFQR +  S Y+RFTRP
Sbjct: 63  LLRYFGDCVSDRDQAEAGP-------ELGTESGKNRNRARSNSLFQRQA--SHYLRFTRP 113

Query: 124 LPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISST 183
           L DL++  +  D+LFD+HSLE +L +YL LVE  T   T H LL+ S+YH FF+ AISST
Sbjct: 114 LTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISST 173

Query: 184 TTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVF 243
             LSP+ESFNHP+ SL+ALDI+  Q YE+A+ LLI FKN+HNT   FP +IN  D+LPVF
Sbjct: 174 AHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVF 233

Query: 244 LLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQ--TEPFIKLHQPVMSSLDE 301
           LLCY  DS E+ + C+ LS  IKKQLFVES+ LP W  +      P   LHQP+MSSL+E
Sbjct: 234 LLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEE 293

Query: 302 MIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSK 361
            +Y +  +   TLP+ L N  YD L  L+  L+IPFM+RKI+FW+E++LQP+KSIF  SK
Sbjct: 294 TMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSK 353

Query: 362 FLKKLMSR-------ASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFK 414
           F +KL+S+       + +++H QQ        G  YFA++S E +LRKLADWS MLSDFK
Sbjct: 354 FFRKLISKTPAPPPASDSATHSQQ--------GVAYFAATSNEFILRKLADWSFMLSDFK 405

Query: 415 TGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYD 474
             Y+TYE+LS D E  P+YLASCLEW A+S+LMGAQ+IVTVKM+KNDI PLI+RAL +Y+
Sbjct: 406 NAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYE 465

Query: 475 ACAANTHLSN---------KKIGPTNESTSLEPVLS----------------------YE 503
             A      N         KK    ++S +L   +S                      YE
Sbjct: 466 LSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYE 525

Query: 504 TRCXXXXXXXXXXXXDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPR 563
           TRC            DTWT+TPYAI YLE+IL+E  LG  S I++WERL+ CY LRVDPR
Sbjct: 526 TRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPR 585

Query: 564 IKSKVEQVQKQDNLEEPADNEHRILNSQDD--------LNPSNIVSQGLTRKRKAAFFRL 615
           +K K+  +  Q    E    E    +  DD        ++ + + S GL R+RK+  FRL
Sbjct: 586 VKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGLARRRKSTLFRL 645

Query: 616 LAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE 660
           +A K W E  QW+Q  W L +I  +YS +   NRDDLIL +LR++
Sbjct: 646 IATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKK 690

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/552 (56%), Positives = 397/552 (71%), Gaps = 10/552 (1%)

Query: 107 LFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQL 166
           LFQRDSTQSQ+IRFTRP+ DL+      DMLFD+H+LE +L   L++VEK+T D   H+ 
Sbjct: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223

Query: 167 LKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNT 226
           L+KSLYH FFS AISST  LSP+ESFNHPI+SLIA+DIT  Q+YE A+ LLI FKN + T
Sbjct: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283

Query: 227 IDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTE 286
           I+ FPI+++T D+LPVF+LCYN  S EE ++  ELS KIKKQLF E I +PLW   Y  +
Sbjct: 284 INNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDD 343

Query: 287 PFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWE 346
             +KLHQP MSSLDEM+Y  Q+ + + LP+ L N  YD LE L   L+IPFMQRKI FWE
Sbjct: 344 ITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWE 403

Query: 347 ETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADW 406
           ET+LQPKKS+F G+K  +K M R S ++ +Q+NI  KD+ GNEYFAS+S   LLRKLADW
Sbjct: 404 ETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADW 463

Query: 407 SIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLI 466
           S+M+SDFKT Y T+E L  D+E++PKYLASCLEW AV +LMGAQNIVT KM+KND++PLI
Sbjct: 464 SMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLI 523

Query: 467 DRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPY 526
           +R+LD Y  CA    L    I  + ES   EPV SYETRC            DTWTSTPY
Sbjct: 524 ERSLDVYGNCA----LLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPY 579

Query: 527 AINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHR 586
           A++ LE+IL E +LG CS+IMIWERLSDCY+LR DPR+K K   ++   +    ++    
Sbjct: 580 ALSNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVKHK---LRSNISTSSVSEVSEE 636

Query: 587 ILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGL 646
            +  QD    S+IV +GLTR+RKA+FFRLLAAK WAEQ QW+QV WCL++I+++Y     
Sbjct: 637 EIKKQD---VSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVF 693

Query: 647 VNRDDLILTRLR 658
             R+ LI  +L+
Sbjct: 694 GKRESLIYQKLK 705

 Score =  119 bits (298), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 51/79 (64%), Positives = 67/79 (84%)

Query: 2  INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61
          + F+YE+YMNL+FHL+   EN+P +I++RIVS+AIAPVITVT+T ELD HI + Y IDS 
Sbjct: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 62 YMLLRFFGGCVSDRDQASE 80
          Y LLR+FGGC+SDRDQ++E
Sbjct: 61 YTLLRYFGGCISDRDQSNE 79

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/697 (47%), Positives = 428/697 (61%), Gaps = 93/697 (13%)

Query: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61
           + FSYEHYMNLL HLEC+ E +P +IARRIVSHA+APVITVTS+  LD HI ++Y + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 62  YMLLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRFT 121
           Y+L R FGGC+SDRDQ  E                          LFQRD+TQSQ+IRF 
Sbjct: 61  YLLFRLFGGCISDRDQLME-------HYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFA 113

Query: 122 RPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTS------------------ 163
           +PLPDL+  + +   LFD+ SLE YL  YL  ++K T                       
Sbjct: 114 QPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRG 173

Query: 164 ----HQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIK 219
               H+LL+ ++YHNFF+LA+SSTT +SPFE+FN P+M+LIA+D++  Q YE  + L+  
Sbjct: 174 KPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTT 233

Query: 220 FKNLHNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLW 279
           FKNL+  ++ FP++IN  D+LP+ +LCY+A    ++  CE+L  KIKK LFV+SI L LW
Sbjct: 234 FKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALW 293

Query: 280 KNSYQTEPFIKLHQPVMSSLDEMIYFLQS------DEQNT-------LPIELTNTTYDML 326
               ++ P + LH+P+MSSLDE++ F  S      DE  T       LP+ +    Y  L
Sbjct: 294 DEDPES-PLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQAL 352

Query: 327 EKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS-KFLKKLMSRASTSSHQQQNILTKDH 385
           + LV  +LIPFM RK  +WEE +LQP+KSIFHGS  F KK + + +T          +D 
Sbjct: 353 DVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQ---------RDP 403

Query: 386 DGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSL 445
              ++F +SS E LLRKLADWS+MLSDFKT Y TY+ LS+DL+  P YLASCLEW AVSL
Sbjct: 404 SDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSL 463

Query: 446 LMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETR 505
           L+GAQNIVTVKM+K +I+PLI+RA+  Y           ++ G +          SYETR
Sbjct: 464 LLGAQNIVTVKMIKTEITPLIERAVATY-----------RQQGRS----------SYETR 502

Query: 506 CXXXXXXXXXXXXDTWTSTPYAINYLESILEES-RLGPCSRIMIWERLSDCYDLRVDPRI 564
           C            DTWTSTPYAI YLE+IL +  +LG CS++MIWERLSDCY  R DPR+
Sbjct: 503 CMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSRTDPRV 562

Query: 565 KSKVEQVQKQDNLEEPADNEHRILNSQDDLNPSN-IVSQGLTRKRKAAFFRLLAAKMWAE 623
            S +                     S     P N I++QG TRKRKAAFFRL+AAK WAE
Sbjct: 563 ASALSTN-----------------TSPGSAQPGNEILAQGFTRKRKAAFFRLIAAKKWAE 605

Query: 624 QGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE 660
           QGQW+QV+WCL +I DIY+   L ++  L++ RL  E
Sbjct: 606 QGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTE 642

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/731 (45%), Positives = 457/731 (62%), Gaps = 91/731 (12%)

Query: 2   INFSYEHYMNLLFHLECSDENIP--SEIARRIVSHAIAPVITVTSTPELDKHIQDTYSID 59
           +  SYE+YMNLL+H++ S E++   SE+A++IVS+A++PV+ VTST  LD H+Q+ Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 60  SLYMLLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIR 119
           S+YMLLRFFG CV+DRDQ +E++ N                      LFQR+S  S ++R
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETN-------------FKGRPRSNSLFQRES--STFVR 105

Query: 120 FTRPLPDLVE-RHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSL 178
           FTRPL DLV+ R   + MLFD+HSLE +L +YL LV+     +T H+LLK S+YH FF+ 
Sbjct: 106 FTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTA 165

Query: 179 AISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDK---FPIYIN 235
           AISST  LSP+ESFNHP+MSL+ALDI+   +YE+A+ LLI+FKN+++       FP +IN
Sbjct: 166 AISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFIN 225

Query: 236 TYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY---QTEPFIKLH 292
             D+LPVFLLCYN  S E+ + C+ L+  +KKQLFVESI LPLW++S      EP   LH
Sbjct: 226 INDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILH 285

Query: 293 QPVMSSLDEMIYFLQSDEQNT----------------LPIELTNTTYDMLEKLVYALLIP 336
            P+MSSL+EM+YFL  +                    LP+ L  T YD L  L+  L+IP
Sbjct: 286 PPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIP 345

Query: 337 FMQRKIAFWEETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDG----NEYFA 392
           FM+RKI+FWEET+LQP+KSIF  +KFL++ +S+++ ++      +    DG    + +F 
Sbjct: 346 FMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAP--INSKSDGAVQRSNFFP 403

Query: 393 SSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNI 452
           +SS E LLRKLADWS MLSD++T YATY+ LS DLE   +YLA CLEW AVS+LMGAQ+I
Sbjct: 404 ASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSI 463

Query: 453 VTVKMMKNDISPLIDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXX 512
           VTVKM+KNDI PLI ++L  Y+ CA+   L++  +   +     +P  SYETRC      
Sbjct: 464 VTVKMIKNDIDPLISKSLQCYEKCASK--LTSPHVAEADSPVDSKPAQSYETRCMLLSAE 521

Query: 513 XXXXXXDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRI-----KSK 567
                 DTWT+TPYAI YLE+IL+   LGP S++++WE+L+ CY+LRVDPR+     K +
Sbjct: 522 LFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQR 581

Query: 568 VEQVQKQD--------------------------NLEEPADNE-------HRILNSQDDL 594
             Q ++++                          N EE +D +       +R     D +
Sbjct: 582 HLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFV 641

Query: 595 NPS-----NIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNR 649
           NP+     +I   GLTR+RKAAFFRL+AA  W EQ QWKQ  W L ++  +YS +    R
Sbjct: 642 NPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYR 701

Query: 650 DDLILTRLREE 660
             LIL RL  E
Sbjct: 702 KGLILERLVGE 712

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/626 (48%), Positives = 405/626 (64%), Gaps = 71/626 (11%)

Query: 107 LFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQL 166
           LFQRDSTQSQYIRFT+P+PDLV   D  D LFDH SLE+ L+ YL+++E  T     H  
Sbjct: 191 LFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTPDMPHNA 250

Query: 167 LKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNT 226
           LKKSLYH FFS+ ++STT L PFESF+HPI+SL+++D+T +Q+Y+ AK +LIKFKN+H+ 
Sbjct: 251 LKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIKFKNIHSK 310

Query: 227 IDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNS-YQT 285
              FP+Y+N  D+LPVFLLCY+A SPE++   +++S KIKKQLF ESI LPLW +  Y  
Sbjct: 311 TPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLWNDKIYNN 370

Query: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQ-------NTLPIELTNTTYDMLEKLVYALLIPFM 338
           + F+KLH+P+MSS+DE +YFLQ   Q       N LP+ L    Y+M+  L   L+IPFM
Sbjct: 371 DKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSVNLIIPFM 430

Query: 339 QRKIAFWEETVLQPKKSIFHGSKFLKKLMSR---------------ASTSSHQQQNILTK 383
           QRKI FW+ET+LQP+KSIF   K  K  M+R               +++ S    ++LTK
Sbjct: 431 QRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNSISKHHHSLLTK 489

Query: 384 DHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAV 443
           D +G+EYF++ S E  LRKLADWS+M+SDFKT Y TYE LS DLE   KY+ASCLEW AV
Sbjct: 490 DSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASCLEWWAV 549

Query: 444 SLLMGAQNIVTVKMMKNDISPLIDRALDAYDA---CAANTHLSNKKIG----------PT 490
           S+LMGAQNIVT KM+KND+ PLI+ AL++Y+       N+ L +  I            T
Sbjct: 550 SILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSRSSISSAT 609

Query: 491 NESTSL----EPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINYLESILEESRLGPCSRI 546
               SL      + SYE RC            DTWTSTPYA+ YLE+IL + +LGPCS+ 
Sbjct: 610 KAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILSDYKLGPCSQT 669

Query: 547 MIWERLSDCYDLRVDPRIKSK------------------------VEQVQKQDNLEE--P 580
           ++WERLS CYDLRVDPRIK K                        V +  + D  +E   
Sbjct: 670 ILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYS 729

Query: 581 ADNEHRIL---NSQDDLNPS-NIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDN 636
            D ++ ++   NS ++ +   +I+S G TRKRKAAFF+L+AAK W+EQ QW+Q+ WCL +
Sbjct: 730 IDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQLDWCLKD 789

Query: 637 ITDIYSRVGLVNRDDLILTRLREEYN 662
           I ++Y  VG  +R DLIL +L+++ N
Sbjct: 790 IENVYKEVGFSDRKDLILIKLKDQLN 815

 Score =  129 bits (325), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 74/84 (88%)

Query: 4  FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
          FSYE+YMNLLFHL+ ++E IP++IA+RIV ++IAP+I+VT+TPELDKH+QD+Y+IDSLYM
Sbjct: 3  FSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSLYM 62

Query: 64 LLRFFGGCVSDRDQASESKANAPH 87
          LLR+FGGC+SDRDQ  E     P+
Sbjct: 63 LLRYFGGCISDRDQYHEPHHQHPN 86

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  485 bits (1249), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/665 (41%), Positives = 397/665 (59%), Gaps = 73/665 (10%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
            SYE YMNL+ + E   + +P EI+RR++ +A++P ++V ST  L+ H+ + +S  SLYM
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 64  LLRFFGGCVSDRDQ--ASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRFT 121
           LLR+F   V +R +   S S    P                    ++QR +  S+Y+RF 
Sbjct: 62  LLRYFADYVRERGEEVGSVSGQRRP------------------GSVYQRQT--SRYVRFQ 101

Query: 122 RPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAIS 181
           RPL +++E  ++  +  D   LE  L Q+L  +E  T + +  +LLK S++H F ++   
Sbjct: 102 RPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSELLKHSIFHKFITML-- 157

Query: 182 STTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLP 241
           S+T LSP+ + NHPIM+L+ALD+T  + Y  A+ LL++FKNL +   KFP YINT D+LP
Sbjct: 158 SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSSKFPSYINTNDVLP 217

Query: 242 VFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLDE 301
           VF+LC++  S E+ +  + L   IKKQLFVES+ LP++ N Y+++P + LH P+ +SL E
Sbjct: 218 VFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTN-YESDPVV-LHPPITNSLQE 275

Query: 302 MIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSK 361
            +Y         L  +L +  Y+ +  +V  L+IPFM RKI+FW+ET+LQP+KSIFHG+K
Sbjct: 276 QVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDETILQPRKSIFHGNK 335

Query: 362 FLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYE 421
           FLK+ M++ ++S+      L+   DG  YF +SS E LLRKLADWS MLSD+KT Y+ Y 
Sbjct: 336 FLKRFMNKTNSSA---AGTLSTSSDG--YFLASSNEFLLRKLADWSFMLSDYKTAYSIYY 390

Query: 422 ILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTH 481
           IL  D EL+P+YL+SC E+ A+SLLMGA +IVT KM+KNDI PLI + +D+    A+  +
Sbjct: 391 ILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDS--TVASLNY 448

Query: 482 LSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINYLESIL--EESR 539
           L                    + RC            DTWTS P+AI YLE IL  E+ +
Sbjct: 449 LG-------------------KFRCLVYMAELFLSLSDTWTSAPFAIKYLELILQNEQLK 489

Query: 540 LGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNSQDD--LNPS 597
           LGP SR M+WER+S  Y LR+DPRI +  E +   DN  E        L ++DD  +NP+
Sbjct: 490 LGPLSRTMLWERISYAYQLRIDPRIHTDDEYL--SDNFME--------LTTEDDFCMNPN 539

Query: 598 N-----IVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDL 652
                 I S GLTR RK A FRLLAAK W E G  +Q  W L     +Y  +G  N D  
Sbjct: 540 KLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADGT 599

Query: 653 ILTRL 657
           +L+RL
Sbjct: 600 LLSRL 604

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  476 bits (1226), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/668 (41%), Positives = 396/668 (59%), Gaps = 54/668 (8%)

Query: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63
            SYE YMNLL + +   + +P EI+R+++ +A++P I+V ST  L++H+++ + I SLY 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 64  LLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRFTRP 123
           LLR+FG  + DRDQ  + K +A                     LFQR+S  S+YIRF  P
Sbjct: 62  LLRYFGDYIQDRDQLDD-KISA--------KLQPNNRRQRQNSLFQRNS--SRYIRFQTP 110

Query: 124 LPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISST 183
           L D++   D + + F+   LE  L ++L+ +E+ T + +  +LLK S++H F ++   S+
Sbjct: 111 LTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITML--SS 166

Query: 184 TTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVF 243
           TTLSP+ SFNHPI++L+ALDIT  + YE A+ LL++FKNL NT+ KFP +INT D+LPVF
Sbjct: 167 TTLSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVF 226

Query: 244 LLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLDEMI 303
           +LC++  SP++ +  + L   IKKQLFVES+ LP++ N       I LH P+ +SL E +
Sbjct: 227 ILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFRDRS--IVLHPPITNSLQEQL 284

Query: 304 YFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSKFL 363
           Y         L   L    YD +  +V  L+IPFM RKI+FW+ET+LQP+KSIFH +K L
Sbjct: 285 YDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLL 344

Query: 364 KKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEIL 423
           K+ +S++S S       +    DG  +F +SS E LLRKLADW  MLSD+KT Y+ YEIL
Sbjct: 345 KRFISKSSGSPTAS---MPTSPDG--HFLASSNEFLLRKLADWCFMLSDYKTAYSIYEIL 399

Query: 424 SHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTHLS 483
             D E +P Y++SC E+ A+SLLMGA +IVT KM+KNDI PLI + LD     A N  +S
Sbjct: 400 IRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDY----AVNNIIS 455

Query: 484 NKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINYLESILEES--RLG 541
             +I                 RC            DTWTS P+AI YLE IL++   +LG
Sbjct: 456 LDQI-----------------RCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKENLKLG 498

Query: 542 PCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNSQDDLNPSNIVS 601
           P  R +IWER+S  Y LR+DPRI +  +     D+     D E  +  +   L+   I +
Sbjct: 499 PVCRNLIWERISFAYRLRIDPRIHADDDSTSDCDH-----DLEEELYLNPHKLHCGKIQN 553

Query: 602 QGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREEY 661
           QG TR RK A F+LLAAK W + GQ +Q  W L     +Y  +   N +  +L+RL +  
Sbjct: 554 QGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLAD-- 611

Query: 662 NIAVSDSK 669
             AV DS+
Sbjct: 612 --AVVDSE 617

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  442 bits (1136), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/678 (37%), Positives = 382/678 (56%), Gaps = 54/678 (7%)

Query: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61
           + FSYE YMNL+ + E     IP EI+++++ + ++P I V S  ELD H++D Y+IDS+
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 62  YMLLRFFGGCVSDRDQASESKANAPHXXXXXXXXXXXXXXXXXXXLFQRDSTQSQYIRFT 121
            ML R+FG  + DRDQ        P                    LFQR +  S+ +RFT
Sbjct: 63  SMLFRYFGDYIQDRDQI-------PSTTDLKDPGSVSSGRHRSDSLFQRQA--SECVRFT 113

Query: 122 RPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKF-TFDSTSHQLLKKSLYHNFFSLAI 180
           R L DL+   D  D +     ++S+L QYL+ +E     + T  +LLK S+YH FF    
Sbjct: 114 RSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFF--IT 170

Query: 181 SSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDML 240
            S+  LS + SF+HP+++L+ LDIT  Q YE+A+ +LI FKNL+NT++ FP +IN  D+L
Sbjct: 171 LSSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDIL 230

Query: 241 PVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLD 300
           PVF+LCY+ +S E+ +  + L+  +KKQLFVES+S+ L+   +  +    LH P+  SL 
Sbjct: 231 PVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLF-TPHDNQKSTTLHSPITVSLH 289

Query: 301 EMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS 360
           E ++ +       +P  L    YD +  +V  ++IPFM RK+ FW+ETVLQP+KSIF  +
Sbjct: 290 EQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSN 349

Query: 361 KFLKKLMSRASTSSHQQQNILTKDHD---GNEYFASSSPELLLRKLADWSIMLSDFKTGY 417
           KF ++ +S    S+H   + +    D   G+  F +SSPE LLRKLADWS MLSDFK  Y
Sbjct: 350 KFFRRFIS--PKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAY 407

Query: 418 ATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACA 477
           + Y++L+ D E +P+YLA CLE++ +SLLMGAQNI+T K +K ++ PL+ RA++ Y    
Sbjct: 408 SIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKK-- 465

Query: 478 ANTHLSNKKIGPTNESTSLEPVLSYETRCXXXXXXXXXXXXDTWTSTPYAINYLESILEE 537
                        +E  SL  +      C            DTW S+P A+NYL  I + 
Sbjct: 466 ------------QDEKHSLRVI-----HCILTFSDLLLSLSDTWVSSPLAVNYLTYIQKS 508

Query: 538 SRLGPCSRIMIWERLS----DCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNS--- 590
             LGP + ++I ER++     C DLRV+     K ++  K D   E A+N  +  N    
Sbjct: 509 HLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADE-SEAAENSKKGENGLEV 567

Query: 591 --------QDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYS 642
                   ++ L  +N+ S+GLTR RK + ++L+AAK W E  +  Q KWC+ +    Y 
Sbjct: 568 DDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAPAYE 627

Query: 643 RVGLVNRDDLILTRLREE 660
           ++ L  R D +  RL  E
Sbjct: 628 KLSLSKRPDGLFHRLSME 645

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 60/126 (47%), Gaps = 15/126 (11%)

Query: 111 DSTQSQYIRFTRPLPDLVERHDKND-MLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKK 169
           D+ + Q +     L +  E+  K D  +F+   LE Y + Y+E  ++  FDS S  +L  
Sbjct: 729 DTQKEQILSLEGKLTEEREKSIKTDEKIFE---LEQYFKNYVEKEKESVFDSISIAILSA 785

Query: 170 SLYHNFFSLAISS------TTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNL 223
              H+     + S      + TL+   + N   MSL +L     QS   +K L+ +F+++
Sbjct: 786 KKKHDQIDSGVLSKCSSIISDTLTQINNVND--MSLKSL---AQQSVNSSKALITQFQDV 840

Query: 224 HNTIDK 229
            +TIDK
Sbjct: 841 ADTIDK 846

>NDAI0H00570 Chr8 complement(129018..131729) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 623 EQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREEYNIAVSDSK 669
           EQ +WK+++W L +     SR+ ++NR  ++    RE + + + ++K
Sbjct: 358 EQSRWKKIEWSLSS-----SRILILNRSQMVEVDYRENWQLQIIEAK 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,628,084
Number of extensions: 2971801
Number of successful extensions: 10062
Number of sequences better than 10.0: 42
Number of HSP's gapped: 10304
Number of HSP's successfully gapped: 49
Length of query: 669
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 553
Effective length of database: 40,180,143
Effective search space: 22219619079
Effective search space used: 22219619079
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)