Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B055608.257ON60560532600.0
Kpol_392.98.257ON59458618110.0
CAGL0B01727g8.257ON57758317770.0
KLTH0G13794g8.257ON72552117860.0
Kwal_56.236078.257ON72552117690.0
NDAI0J014008.257ON58858817550.0
YDR109C8.257ON71551617570.0
NCAS0B038708.257ON59658317450.0
Suva_2.2698.257ON72555417400.0
SAKL0H17160g8.257ON73952117390.0
Skud_4.3708.257ON71451617290.0
TBLA0E044008.257ON58959017120.0
TDEL0F038408.257ON72652417210.0
Smik_4.3558.257ON70451617100.0
KLLA0F19041g8.257ON76351917090.0
Ecym_43138.257ON59759416920.0
ZYRO0C01782g8.257ON73053216930.0
KNAG0H032608.257ON58058416530.0
AGR092W8.257ON59659215690.0
TPHA0B032408.257ON58558215630.0
Skud_14.891.111ON5696095943e-68
YNL249C (MPA43)1.111ON5425965784e-66
Suva_14.931.111ON5436085671e-64
Smik_14.861.111ON5436075636e-64
SAKL0C03432g1.111ON5475965216e-58
KLTH0F03080g1.111ON5335895031e-55
Kwal_33.135301.111ON5346085004e-55
TDEL0C059001.111ON5435994962e-54
ZYRO0F16016g1.111ON5425974733e-51
KNAG0F006601.111ON5356164452e-47
KLLA0C02937g1.111ON5164943297e-32
NCAS0A007801.111ON5495191973e-15
NDAI0H002204.9ON8101581082e-04
NCAS0C059004.9ON703124920.017
TPHA0K022804.9ON667102900.028
Skud_8.124.9ON710174880.047
Kpol_1062.15.63ON806143880.053
YHL032C (GUT1)4.9ON709201880.058
CAGL0E03916g4.9ON672138850.12
TBLA0E013504.9ON69462830.18
TBLA0G025902.235ON1453244830.21
KLLA0E00595g4.9ON661108820.25
Smik_8.94.9ON708135810.31
SAKL0H25938g4.9ON685110810.36
Suva_8.194.9ON732135810.40
SAKL0E08910g2.235ON1280244810.44
KAFR0I015104.9ON705137770.93
NDAI0B03840singletonON1363244771.0
TDEL0C045202.235ON1313242771.1
TDEL0G018204.9ON698108771.1
Kwal_23.47772.235ON1301242761.4
TDEL0D064903.581ON487103751.6
Kpol_1039.152.235ON1385243761.7
Suva_9.652.235ON1363244751.9
KAFR0J016802.235ON1328169751.9
KLTH0G09196g2.235ON1308244724.1
KLTH0G06028g5.317ON35281714.1
KLTH0C09768g3.97ON42670714.5
NDAI0I017906.99ON44778705.7
Skud_9.412.235ON1359201716.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05560
         (605 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...  1260   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   702   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   689   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   692   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   686   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   680   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   681   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    676   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   674   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   674   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   670   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   664   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   667   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   663   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   662   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   656   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   656   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   641   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   608   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   606   0.0  
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   233   3e-68
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   227   4e-66
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   223   1e-64
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   221   6e-64
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   205   6e-58
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   198   1e-55
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   197   4e-55
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   195   2e-54
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   186   3e-51
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   176   2e-47
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   131   7e-32
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    80   3e-15
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    46   2e-04
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    40   0.017
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    39   0.028
Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON} Y...    39   0.047
Kpol_1062.1 s1062 complement(1522..3942) [2421 bp, 806 aa] {ON} ...    39   0.053
YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}  GU...    39   0.058
CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} simila...    37   0.12 
TBLA0E01350 Chr5 complement(297302..299386) [2085 bp, 694 aa] {O...    37   0.18 
TBLA0G02590 Chr7 complement(680382..684743) [4362 bp, 1453 aa] {...    37   0.21 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    36   0.25 
Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON} YH...    36   0.31 
SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} simi...    36   0.36 
Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON} Y...    36   0.40 
SAKL0E08910g Chr5 complement(730567..734409) [3843 bp, 1280 aa] ...    36   0.44 
KAFR0I01510 Chr9 (318409..320526) [2118 bp, 705 aa] {ON} Anc_4.9...    34   0.93 
NDAI0B03840 Chr2 complement(965694..969785) [4092 bp, 1363 aa] {...    34   1.0  
TDEL0C04520 Chr3 (814803..818744) [3942 bp, 1313 aa] {ON} Anc_2....    34   1.1  
TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9...    34   1.1  
Kwal_23.4777 s23 (860942..864847) [3906 bp, 1301 aa] {ON} YIL126...    34   1.4  
TDEL0D06490 Chr4 complement(1163375..1164838) [1464 bp, 487 aa] ...    33   1.6  
Kpol_1039.15 s1039 (41383..45540) [4158 bp, 1385 aa] {ON} (41383...    34   1.7  
Suva_9.65 Chr9 (112765..116856) [4092 bp, 1363 aa] {ON} YIL126W ...    33   1.9  
KAFR0J01680 Chr10 complement(315123..319109) [3987 bp, 1328 aa] ...    33   1.9  
KLTH0G09196g Chr7 (759594..763520) [3927 bp, 1308 aa] {ON} simil...    32   4.1  
KLTH0G06028g Chr7 complement(475975..477033) [1059 bp, 352 aa] {...    32   4.1  
KLTH0C09768g Chr3 complement(808196..809476) [1281 bp, 426 aa] {...    32   4.5  
NDAI0I01790 Chr9 complement(421537..422880) [1344 bp, 447 aa] {O...    32   5.7  
Skud_9.41 Chr9 (95085..99164) [4080 bp, 1359 aa] {ON} YIL126W (R...    32   6.6  

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score = 1260 bits (3260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/605 (100%), Positives = 605/605 (100%)

Query: 1   MGRFQNPLTNGKEKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFI 60
           MGRFQNPLTNGKEKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFI
Sbjct: 1   MGRFQNPLTNGKEKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFI 60

Query: 61  TQSSEEIWDSICFCVRKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKN 120
           TQSSEEIWDSICFCVRKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKN
Sbjct: 61  TQSSEEIWDSICFCVRKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKN 120

Query: 121 DQNIIMWMDHRASQETDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVF 180
           DQNIIMWMDHRASQETDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVF
Sbjct: 121 DQNIIMWMDHRASQETDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVF 180

Query: 181 FDLPDYLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFER 240
           FDLPDYLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFER
Sbjct: 181 FDLPDYLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFER 240

Query: 241 IGGPGNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESA 300
           IGGPGNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESA
Sbjct: 241 IGGPGNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESA 300

Query: 301 RTQDDANGQDLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQ 360
           RTQDDANGQDLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQ
Sbjct: 301 RTQDDANGQDLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQ 360

Query: 361 SCTGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFL 420
           SCTGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFL
Sbjct: 361 SCTGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFL 420

Query: 421 YGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHS 480
           YGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHS
Sbjct: 421 YGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHS 480

Query: 481 IRSIYMSGGQCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETND 540
           IRSIYMSGGQCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETND
Sbjct: 481 IRSIYMSGGQCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETND 540

Query: 541 DRVPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
           DRVPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD
Sbjct: 541 DRVPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

Query: 601 SLSVQ 605
           SLSVQ
Sbjct: 601 SLSVQ 605

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/586 (57%), Positives = 438/586 (74%), Gaps = 6/586 (1%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           H+IGVDVGTGSVRACVI+ KG+IL+L  K I++EELKP +ITQSS EIW  IC CV  V+
Sbjct: 3   HYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVL 62

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
            +++I  + V+GIGFDATCSL V+DK+T + + VGP F  +++NII+WMDHRA +ETDEI
Sbjct: 63  QESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEI 122

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           N+  D  LKYVGGKMS+EME+PKIKWLKN++    F    FFDL DYLT+KAT    RS 
Sbjct: 123 NATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSF 182

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSR---NFLSAGE 256
            S VCKQGLLP+GVEGS  GWS+ F +   L EL  + F  IGG  ++ +   N  S GE
Sbjct: 183 SSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGE 242

Query: 257 YVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDE--SARTQDDANGQDLQNA 314
           YV  LS+ S ++LGL  +C+VGSG+IDAYAG +GT+AA+++E  +    DDA+ + L ++
Sbjct: 243 YVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSK-LDSS 301

Query: 315 IGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTH 374
           IG LA +AGTSTCHITLS KPIFVNG+WGPY+D+L+ ++WCAEGGQSCTG LL+H++TTH
Sbjct: 302 IGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTH 361

Query: 375 PAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADP 434
           PAY EL  +  K  +  FE LN  + +L ++    +I+ L K  FLYGDYHGNRSPI+D 
Sbjct: 362 PAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDE 421

Query: 435 RMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNN 494
            MRA+IIGQSMDT+++SLA++YL+ACEFI+ Q+R II+++ +AGH+I+ IYMSGGQ RN 
Sbjct: 422 SMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQ 481

Query: 495 ILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAM 554
           +LM LLAD TGLPVVIP+YIDA+V+FG+A++GA A D +N    + ++      TLWN M
Sbjct: 482 LLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKM 541

Query: 555 VKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
            K+T  GT I P    H  + LLN KYKI++DMA+TQ+KYR  ID+
Sbjct: 542 CKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDE 587

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 426/583 (73%), Gaps = 9/583 (1%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           ++IGVDVG+GSVRACV+D +G +L++  + IS+EE  PG +TQSS EIWD++C+CV+  I
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
            ++ +    ++GIGFDATCSL V++KD+ E +A GP F  N+QNIIMWMDHRA +ET EI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           N   D  LKYVGG+MS+EME+PKIKWLKNHM  E F+K VF DLPDYLTF A+G+  RS 
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVS 259
           CSAVCKQG LP GVEGS++GWS  FL+  GL E+ ++ F  +GGP N S NF  AG  +S
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241

Query: 260 TLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGRLA 319
           T+S+S  +   +   C+VGSG+IDAYAG IGT+A+   E    ++     D++   GRLA
Sbjct: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVV---DIEECAGRLA 298

Query: 320 AVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEE 379
           AVAGTSTCHI LS   IFV GVWGPY+D+L  DYWCAEGGQS TG LL H+++ HP+  E
Sbjct: 299 AVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANE 358

Query: 380 LKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRAS 439
           L     +  +D F  LN  I +L+ +    T L LTK  FLYGDYHGNRSPIADP MRA+
Sbjct: 359 LSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAA 418

Query: 440 IIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILMEL 499
           IIGQSMDT+++ LA  YLAACEFIAHQT+HII  +  AGH+I++IYMSGGQCRNNILM+L
Sbjct: 419 IIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQL 478

Query: 500 LADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKMTG 559
           +A+ TGLP++IPKYID+AVVFG+A++GA A   ++  + N D+       LW+ M  MT 
Sbjct: 479 IANCTGLPLIIPKYIDSAVVFGSAILGAMA---YSSSKNNSDK--GGADLLWSTMSNMTP 533

Query: 560 NGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDDSL 602
           +GTT+ P       + L+N K+KI++DMAKTQ+ YR L+++++
Sbjct: 534 DGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAI 576

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/521 (61%), Positives = 400/521 (76%), Gaps = 5/521 (0%)

Query: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78
            +++GVDVGTGS RAC+ID  G+IL+L ++PI RE+LK  FITQSS+EIW ++C CV+ V
Sbjct: 33  LYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSV 92

Query: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138
           + D+ +PA K+ GIGFDATCSL VV++ T + +AVGP FS  DQNII+WMDHRA +ET  
Sbjct: 93  VRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQL 152

Query: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198
           IN+  D  LKYVGG+MS+EME+PKIKWLKNH+P   F +  FFDL DYLTFKA+G + RS
Sbjct: 153 INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRS 212

Query: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNS---RNFLSAG 255
            CS VCKQGLLP+GVEGS EGWSR FL+  GL ELIE++F RIGG   NS   +NFLSAG
Sbjct: 213 FCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAG 272

Query: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ARTQDDANGQDLQN 313
           E++  +  +  E+LGL+  CVVGSG+IDAYAG +GT+AAR D S  A  + D     +  
Sbjct: 273 EFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDR 332

Query: 314 AIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITT 373
           A GRLAAVAGTSTCHI +S  PIFV+GVWGPY+D LA ++WCAEGGQSCTG LL HV+TT
Sbjct: 333 ATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTT 392

Query: 374 HPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIAD 433
           HPAY EL   A  + +  F+ LN  +  LA+Q+   +++ L K LF YGDYHGNRSPIAD
Sbjct: 393 HPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIAD 452

Query: 434 PRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRN 493
           P MRA+IIGQSMD +++ LAL+YL ACEFIA QTR I+ KM  +GH + +I+MSGGQCRN
Sbjct: 453 PSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRN 512

Query: 494 NILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
            +LM LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + F+
Sbjct: 513 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (73%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDDSL 602
           +WN M  MTG G  + P    +A + LLN KYKI++DMA+TQ+KYR+++DD++
Sbjct: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAV 723

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/521 (60%), Positives = 402/521 (77%), Gaps = 5/521 (0%)

Query: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78
            ++IGVDVGTGS RAC+ID  G+IL+L ++PI RE+LKP FITQSS+EIW ++C CV+ V
Sbjct: 33  LYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSV 92

Query: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138
           + D+ +P+ K+ GIGFDATCSL VV++ + + +AVGP F   +QNII+WMDHRA +ET++
Sbjct: 93  VRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQ 152

Query: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198
           IN+  D  LKYVGG+MS+EME+PKIKWLKNH+P   F +  FFDL DYLTFKA+G + RS
Sbjct: 153 INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRS 212

Query: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNS---RNFLSAG 255
            CS VCKQGLLP+GVEGS EGWSR FL+  GL + IE++F +IGG   NS   +NFLSAG
Sbjct: 213 FCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAG 272

Query: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ARTQDDANGQDLQN 313
           E+V  +  +  E+LGL+  CVVGSG+IDAYAG +GT+AAR D S  A  + D     +  
Sbjct: 273 EFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDR 332

Query: 314 AIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITT 373
           A GRLAAVAGTSTCHI +S  PIFV+GVWGPY+D LA ++WCAEGGQSCTG LL HV+TT
Sbjct: 333 ATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTT 392

Query: 374 HPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIAD 433
           HPAY EL   A  + +  F+ LN  +  LA+Q+ + +++ L + LF YGDYHGNRSPIAD
Sbjct: 393 HPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIAD 452

Query: 434 PRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRN 493
           P MRA+IIGQSMD +++ LAL+YL ACEFIA QTR I+ KM  +GH + +I+MSGGQCRN
Sbjct: 453 PSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRN 512

Query: 494 NILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
            +LM LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + F+
Sbjct: 513 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
           +WN M  MTG G  + P    +  + LL+ KYKI++DMA+TQ+KYR+L+++
Sbjct: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNE 721

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/588 (55%), Positives = 434/588 (73%), Gaps = 12/588 (2%)

Query: 17  DNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVR 76
           D +++IGVDVGTGSVRAC+ID  G I +  +  I R+ELK   ITQSS+EIW ++CFCV+
Sbjct: 4   DIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVK 63

Query: 77  KVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQET 136
           KV+ +     ++V GIGFDATCSL VVDK T  G+AVGP F+ ++Q+II+WMDHRA +ET
Sbjct: 64  KVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKET 123

Query: 137 DEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQN 196
            EINS  D  LKYVGG+MSIEME+PKIKWLK HM ++ F +  F+DL DYLTFKATG + 
Sbjct: 124 KEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKT 183

Query: 197 RSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP--GNNSRNFLSA 254
           RS CS VCKQG++P+GVEGS  GWS+ FL N  L EL  N++ ++GG   G++ RNFL+A
Sbjct: 184 RSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTA 243

Query: 255 GEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAA---RIDESARTQDDANGQDL 311
           GEY++ L+  + E+L L++ C+VGSG+IDAYAG +GT+ +    +++  R         +
Sbjct: 244 GEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRV-------GM 296

Query: 312 QNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVI 371
            NAIGRLAAVAGTSTCHI LS  PIFV GVWGPYKD + K YWC EGGQSCTG LL+HV+
Sbjct: 297 ANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVL 356

Query: 372 TTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPI 431
            THP+Y+EL+  + K+ ++ F+ LN  + ++A++    ++L L K +F YGD HGNRSP+
Sbjct: 357 QTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPL 416

Query: 432 ADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQC 491
           ADP M+ +I+G SMDT++++LA  YLAACEFIA Q R II  M +AGH I +IYMSGGQC
Sbjct: 417 ADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQC 476

Query: 492 RNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLW 551
           RN++LM+LLAD +GL V+IP+YID+AVVFGAA++GA+A  ++    +  D V   E+ LW
Sbjct: 477 RNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILW 536

Query: 552 NAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           + M KMT  G+ I P    H  + LL+ KYKI++DMA  QK+YR+++D
Sbjct: 537 STMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/516 (61%), Positives = 401/516 (77%), Gaps = 2/516 (0%)

Query: 21  FIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80
           ++GVDVGTGS RACVID+ G++L+L +KPI RE+L   FITQSS EIW+++C+CVR V+ 
Sbjct: 40  YVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99

Query: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEIN 140
           ++ +   +V GIGFDATCSL VV     E +AVGP F+ NDQNII+WMDHRA +ET+EIN
Sbjct: 100 ESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 159

Query: 141 SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLC 200
           S  D  LKYVGG+MS+EME+PKIKWLKN++    F+   FFDLPDYLTFKATG +NRS C
Sbjct: 160 SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFC 219

Query: 201 SAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVST 260
           SAVCKQG LP+GVEGS  GWS+ FL++ GL EL +N+FER+GG     +NFL+AGE +S 
Sbjct: 220 SAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISP 279

Query: 261 LSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQDLQNAIGRL 318
           L K +  QLGLTE CVV SG+IDAYAG +GT+AA+ + + +   + +   +D   AIGRL
Sbjct: 280 LDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRL 339

Query: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378
           AAVAGTSTCHI LS  PIFV+GVWGPY+D+LA+ +W AEGGQSCTG LL H+ITTHPA+ 
Sbjct: 340 AAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFT 399

Query: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438
           EL   A  + +  FE LN+I+  L E++   +++ L K LF YGDYHGNRSPIADP MRA
Sbjct: 400 ELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRA 459

Query: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498
            IIGQSMD ++E LA++YL+ACEFI+ QTR II  M ++GH I +I+MSGGQCRN++LM 
Sbjct: 460 CIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMR 519

Query: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
           LLAD TGLP+VIP+Y+DAAVVFG+AL+GA A + F+
Sbjct: 520 LLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           LW  M ++TGN   + P    H  + LL+TKY+I++DM +TQ+KYR ++D
Sbjct: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/583 (55%), Positives = 429/583 (73%), Gaps = 7/583 (1%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           +++G+DVGTGSVRACV+D  G++L+LV+K I+REELKP FITQS+ EIW + CFCV+  I
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
              K+  + V+GIGFDATCSL  ++K T + + VGP F   D N+I+WMDHRA +E +EI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           N+  D  LKYVGG MS+EM++PKIKWLKN+M    F+K  FF+L DYLTFKATG + RS 
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSR--NFLSAGEY 257
           CS VCKQG LP GVEGS+EGWS+ FLS+ GL +L  N ++ +GG   N    NF S+G+ 
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255

Query: 258 VSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR 317
           +  LS  +  +LGL+E+CVVG+G+IDAYAGLIGTIAA  + S + ++D++   LQNAIGR
Sbjct: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSS-IGLQNAIGR 314

Query: 318 LAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAY 377
           LA+VAGTSTCH+ LS  P+FV GVWGPY+D++A  YWCAEGGQ+CTGELL +V++ HPA+
Sbjct: 315 LASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAF 374

Query: 378 EELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMR 437
           +EL   +  +K+D F+ LN ++ +L  +    + L+L K +F YGDY GNRSP ADP M 
Sbjct: 375 KELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMS 434

Query: 438 ASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILM 497
           A+IIGQSM+  +E+LA+ YLAACEFIA QTR I+  + +AG  +  IYMSGGQCRN +LM
Sbjct: 435 AAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLM 494

Query: 498 ELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKM 557
           +LL+D TGLP+++PKY+DAAVVFGAA++GATA       E   D        LW  M +M
Sbjct: 495 KLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECD----FGFMLWETMDRM 550

Query: 558 TGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
           T +GT + P    H  + LL+ KY+I++DMA+TQ+KYR ++DD
Sbjct: 551 TPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/554 (58%), Positives = 412/554 (74%), Gaps = 13/554 (2%)

Query: 5   QNPLTNGKEKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSS 64
           Q  L + +EK    FH +GVDVGTGS RAC+ID+ G IL+L +KPI REE++  FITQSS
Sbjct: 33  QTSLQDSQEK----FH-VGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSS 87

Query: 65  EEIWDSICFCVRKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNI 124
           +EIWD++C CV+ V+ ++++   KV GIGFDATCSL VV    L+G+AVGP FS NDQNI
Sbjct: 88  KEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNI 147

Query: 125 IMWMDHRASQETDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLP 184
           I+WMDHRA +ET+EINS  D  LKYVGG+MS+EM++PKIKWLKN++  E F+   FF+LP
Sbjct: 148 ILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLP 207

Query: 185 DYLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP 244
           DYLTFKATG +NRS  SAVCKQG LP GVE S  GWS  FL++ GL EL  N+FER+GG 
Sbjct: 208 DYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGS 267

Query: 245 GNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ART 302
             + +NFLSAGE V  L  +S  +LGLT+ C+VGSG+IDAYAG +GT+AA+   +    +
Sbjct: 268 LRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLS 327

Query: 303 QDDANGQDLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSC 362
           +++    D+ +AIGRLAAVAGTSTCHI LS  PIFV+GVWGPY+D+LA+++W AEGGQSC
Sbjct: 328 ENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSC 387

Query: 363 TGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYG 422
           TG LL HVI THPA+ EL   A  + + +FE LN ++  L +++   +++ L K  F YG
Sbjct: 388 TGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYG 447

Query: 423 DYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIR 482
           DYHGNRSPIADP MRA IIGQSMD +VE LA+ YL ACEFI+ QTR II  M E GH I 
Sbjct: 448 DYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRID 507

Query: 483 SIYMSGGQCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGAT---AWDVFNQ---C 536
           +I+MSGGQCRN +LM LLAD TGLP++IP+YIDAAVVFG+AL+GA    A D+ N+   C
Sbjct: 508 AIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKTIC 567

Query: 537 ETNDDRVPQVEHTL 550
           +T    + Q E  +
Sbjct: 568 QTRRSSLSQKEKVV 581

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           LW  M ++TG    + P    H  + LL+TKY+I++DMA+ Q+KYR+++D
Sbjct: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/521 (59%), Positives = 399/521 (76%), Gaps = 6/521 (1%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           +++GVDVGTGS RAC+ID  G+IL+L ++PI R+ELKP +ITQSS+EIW +IC+CV+ V+
Sbjct: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
            D+ +   K+ GIGFDATCSL VV+ D+ + +AVGP F   +QNII+WMDHRA  ET EI
Sbjct: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           N+  D  LKYVGG+MS+EME+PKIKWLKN++PRE F K  FFDL DYLTFKATG++ RS 
Sbjct: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP----GNNSRNFLSAG 255
           CS VCKQGLLP+GVE S +GWS+ FL+N GL +L +++F ++GG     G+    FLSAG
Sbjct: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTFLSAG 273

Query: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAAR--IDESARTQDDANGQDLQN 313
           E + +L  S+ E+LGL   CVVGSG+IDAYAG +GT+AAR  +D     + D     + +
Sbjct: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333

Query: 314 AIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITT 373
           A GRLAAVAGTSTCHI +S  PIFV+GVWGPY+D++A  +WCAEGGQSCTG LL HV+T 
Sbjct: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393

Query: 374 HPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIAD 433
           HPAY EL   +  + +  F+ LN  +  L +Q+G  +++ L K LF YGDYHGNRSPIAD
Sbjct: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453

Query: 434 PRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRN 493
           P MRA++IGQSMD +++ LA++YL ACEFIA QTR I+ KM+ +GH I +I+MSGGQCRN
Sbjct: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513

Query: 494 NILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
            +LM LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + FN
Sbjct: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 554

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           LW+ M  MTG G  + P  + H  + LL+ KYKI++DMA+TQ++YR  +D
Sbjct: 676 LWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVD 725

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/516 (59%), Positives = 397/516 (76%), Gaps = 2/516 (0%)

Query: 21  FIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80
           ++GVDVGTGS RAC+ID+ G++L+L +KPI REEL+P FITQSS EIWD++C CV+ VI 
Sbjct: 40  YVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99

Query: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEIN 140
           ++++  ++V G+GFDATCSL VV     +G+AVGP F+KNDQNII+WMDHRA +ET+EIN
Sbjct: 100 ESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEIN 159

Query: 141 SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLC 200
           S  D  LKYVGG+MS+EME+PKIKWLKN++  E F+   FFDLPDYLTFKATG +NRS  
Sbjct: 160 SSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFS 219

Query: 201 SAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVST 260
           SAVCKQG LP GVEGS  GWS  FL+  GL ELIE++FE++GG   + +NFLSAGE + +
Sbjct: 220 SAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGS 279

Query: 261 LSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQDLQNAIGRL 318
           L   +  +LGLTE+CVV SGLIDAYAG +GT+AA+ +   R   +++ N  +   AIGRL
Sbjct: 280 LDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRL 339

Query: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378
           AAVAGTSTCHI LS  PIFV+G+WGPY+D+LA+ +W AEGGQSCTG LL HVI  HPAY 
Sbjct: 340 AAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYT 399

Query: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438
           EL      + +  FE LN ++  + +++   +++ L + LF YGDYHGNRSPIAD  MRA
Sbjct: 400 ELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRA 459

Query: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498
            IIGQSMD +VE LA+ YL+ACEFI+ QTR I+  M ++GH I +I+MSGGQCRN++L  
Sbjct: 460 CIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTR 519

Query: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
           LLAD +GLP+VIP+YID AVVFG+AL+GA A + F+
Sbjct: 520 LLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFD 555

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 36/51 (70%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
           LW  M ++TG+   + P    H  + LL+TKY+I++DMA+TQK+YR ++D+
Sbjct: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDN 707

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/590 (53%), Positives = 426/590 (72%), Gaps = 15/590 (2%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           ++IGVDVGTGS RAC+ID  GDIL++ +  I R+ELKPG+ITQS+ +IW++IC C+R ++
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 80  ADAKIP--ANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETD 137
            ++ +   ++K+ GIGFDATCSL V++  T + +AVGP F  NDQN+I+WMDHRA  ET 
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 138 EINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNR 197
           EINS     LKYVGG+MS+EME+PKIKWLKN+M    ++   F DLPD+LT+KATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 198 SLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP----GNNSRNFLS 253
           S CSAVCKQGLLP+GVEGST+GW+  FL N GL +L+E+ F ++GGP         +F +
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 254 AGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAAR----IDESARTQDDANGQ 309
           AGE++  LS  S + +G++  C V SG+IDAYAG IGTIAA     I++    QD+ NG 
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302

Query: 310 DLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKH 369
              +  GRLA VAGTSTCHI+L++KPIFV GVWGPY+D+L  ++WCAEGGQSCTG LL+H
Sbjct: 303 ICSS--GRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429
           V+ THPAY+EL   + +  + +FE LN  IR+L  Q+     + L K LF YGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGG 489
           P+AD  MR +IIG SMD+++  L  +YL ACEFIA QTRHI+  M ++G+++ S+YMSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 490 QCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHT 549
           QCRN +LM+L+++  GLPVVIPK ID AVVFG+AL+GA A ++    +++ D   + +  
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASEL---SKSHSDNTKKPDQI 537

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           LW+ M KMTG G  ++P+        LL  KY+IY+DM  TQK+YRS+++
Sbjct: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/524 (59%), Positives = 394/524 (75%), Gaps = 9/524 (1%)

Query: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78
            +++GVDVGTGS RAC+ID  G+IL+L +KPI REELKP +ITQSS+EIW SIC CV+ V
Sbjct: 33  IYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSV 92

Query: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138
           + D+ +P  ++ GIGFDATCSL VVD +  E + VGP F+ NDQNI++WMDHRA  ET+E
Sbjct: 93  VRDSGVPVERIHGIGFDATCSLVVVDDEDKE-VGVGPVFANNDQNIVLWMDHRAIAETNE 151

Query: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198
           IN+  D  LKYVGG+MS+EME+PKIKWLKN++P+E F K  FFDL DYLTFKAT    RS
Sbjct: 152 INATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRS 211

Query: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNS------RNFL 252
            CS VCKQGL+PIGVEGS EGWS+ FL+   LPEL+EN F +   P   +       +FL
Sbjct: 212 FCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFL 271

Query: 253 SAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQD 310
           SAGEYV  L + + E+LGL   CVVGSG+IDAYAG +GT+AA+ D       + D   + 
Sbjct: 272 SAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKG 331

Query: 311 LQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHV 370
           +  A GRLAAVAGTSTCHI LS  P+FVNGVWGPY+D++A  +W AEGGQSCTG LL HV
Sbjct: 332 IDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHV 391

Query: 371 ITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSP 430
           ++THPA+ EL   +  + +  F+ LN  +  L +Q+G  +++ L K L+ YGDYHGNRSP
Sbjct: 392 MSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSP 451

Query: 431 IADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQ 490
           IADP MRA+IIGQSMD +++ LA++YL ACEFIA QTR I+ KM +AGH I +I+MSGGQ
Sbjct: 452 IADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQ 511

Query: 491 CRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
           CRN +LM LLAD TGLP++IP+YIDAAVVFG+AL+GA A + FN
Sbjct: 512 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFN 555

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 544 PQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           P     LW+ M +MTG G  + P       + LLN KYKI++DMA +Q++YR  ID
Sbjct: 663 PNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAID 718

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/516 (59%), Positives = 392/516 (75%), Gaps = 2/516 (0%)

Query: 21  FIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80
           ++GVDVGTGS RAC+ID+ G+IL+L +KPI REEL   FITQSS EIW+++C+CVRKVI 
Sbjct: 31  YVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90

Query: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEIN 140
           +A +   ++ GIGFDATCSL VV     + +AVGP F+ NDQNII+WMDHRA +ET+EIN
Sbjct: 91  EAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 150

Query: 141 SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLC 200
              +  LKYVGG+MS+EME+PKIKWLKN++    F+   FFDLPDYLTF+ATG +NRS  
Sbjct: 151 FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFS 210

Query: 201 SAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVST 260
           S VCKQG LP GVEGS  GWS+ FL + GL EL +N+FE++GG   N +NFLSAGE +  
Sbjct: 211 SVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAGECIGP 270

Query: 261 LSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQDLQNAIGRL 318
           L   +  QLGLTE CVV SG+IDAYAG +GT+AA+ +   +  T+++    D   AIGRL
Sbjct: 271 LDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGRL 330

Query: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378
           AAVAGTSTCHI LS   IFV+G+WGPY+D+LA+ +W AEGGQSCTG LL HVITTHPA+ 
Sbjct: 331 AAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAFS 390

Query: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438
           +L   A  + +  FE LN ++ +L E++   +++ L K LF YGDY GNRSPIADP MRA
Sbjct: 391 KLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMRA 450

Query: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498
            IIGQSMD +++ LA+IYL ACEFI+ QTR II  M ++GH+I +++MSGGQCRN +LM 
Sbjct: 451 CIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLMR 510

Query: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534
           LLAD TGLP+VIP+YID AVVFG+AL+GA A  VF+
Sbjct: 511 LLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFD 546

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%)

Query: 547 EHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           ++ LW  M ++TGN   I P    H  + LL+TKY+I++DM +TQ+ YR ++D
Sbjct: 644 KNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/519 (59%), Positives = 393/519 (75%), Gaps = 4/519 (0%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           +++GVDVGTGS RACVID  G+IL+L ++PI R ELKP +ITQSS+EIW++IC+CV+ V+
Sbjct: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
            D+ +    + GIGFDATCSL VVD +  E + VGP F+ N QNII+WMDHRA +ET+EI
Sbjct: 96  RDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNIILWMDHRAIEETEEI 154

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           N+  D  LKYVGG+MS+EME+PKIKWLKN++P + F +  FFDL DYLTFKATG + RS 
Sbjct: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVS 259
           CS VCKQGLLP+GVEGS  GWS+ FL   GL ELI ++F ++GG    +  FLSAGE + 
Sbjct: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET-TFLSAGECIG 273

Query: 260 TLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ARTQDDANGQDLQNAIGR 317
           TL++ S  +LGL+  CVVGSG+IDAYAG +GT+AAR D    A  + D     +  A GR
Sbjct: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333

Query: 318 LAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAY 377
           LAAVAGTSTCHI +S  PIFV GVWGPY+D++A  +W AEGGQSCTG LL HV+TTHPAY
Sbjct: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393

Query: 378 EELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMR 437
            EL   +  + +  F+ LN  +  LA+Q+   +++ L K LF YGDYHGNRSPIADP MR
Sbjct: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453

Query: 438 ASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILM 497
           A+IIGQSMD +++ L+++YL ACEFIA QTR I+ +M  +GH + +I+MSGGQCRN +LM
Sbjct: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513

Query: 498 ELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQC 536
            LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + FN C
Sbjct: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNAC 552

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
           LW  M  MTG G  + P       + LLN KYKI++DMA TQ+KYR L+D+
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDE 761

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/594 (53%), Positives = 418/594 (70%), Gaps = 22/594 (3%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           H+IGVDVGT SVRACV+D  G IL+L  KPISR+E++P ++TQSS EIW +ICFC+RK+I
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
            D+++  + +IGIGFDATCSL V+++ T +G+AVGP F   +Q+II+WMDHRA  E +EI
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           NS     LKYVGGKMSIEM++PKIKWLKN++P+  F K  F+DLPD+LT++ATG + RS 
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGG-PGNNSRNFLSAGEYV 258
           CS VCK GLLP+GV+GST+GW +    + GL EL   EF ++GG   + + NFLSAG+YV
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDYV 243

Query: 259 STLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGRL 318
             LS  +   LGLT  C+V SGLIDAYAG +GTIAA I         ++GQ+ + A  RL
Sbjct: 244 GHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLG------SDGQESELASSRL 297

Query: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378
           A VAGTSTCHIT+S  P F++GVWGPY+D L   YW  EGGQSCTG LL HV+ +HPAY+
Sbjct: 298 ATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYD 357

Query: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438
            L   A    +  F+ +N  + +L E++G  ++  L K LF YGDYHGNRSPIADP MRA
Sbjct: 358 TLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRA 417

Query: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498
           +IIGQSMD +V+ LA++ L ACEFIA QTR I+  + ++GH I SIYMSGGQCRN +L++
Sbjct: 418 TIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIK 477

Query: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWD--------------VFNQCETNDDRVP 544
           LLA+ T LP+V+PKYIDAAVVFG+AL+G  A +              + +Q     +  P
Sbjct: 478 LLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKP 537

Query: 545 QVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLI 598
           + +  LW  M  +TG G  I P     +   LL+ KY+I++DM +TQK+YR L+
Sbjct: 538 K-QSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLV 590

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/532 (59%), Positives = 392/532 (73%), Gaps = 11/532 (2%)

Query: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78
            ++IGVDVGTGS RAC+ID  G+I++L +KPI REELKP +ITQSS+EIW +IC+CV+ V
Sbjct: 32  IYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTV 91

Query: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138
           + D+ +   ++ GIGFDATCSL  V+      + VGP F   DQNII+WMDHRA QET E
Sbjct: 92  VRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAE 151

Query: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198
           INS     LKYVGG+MSIEME+PKIKWLKNHMPRE F   VFFDL D+LT+KATG+  RS
Sbjct: 152 INSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRS 211

Query: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP----GNNSR-NFLS 253
             S+VCKQGLLP+GVEGS  GWS  FL+   LPEL+ N+F ++GG     G++ R NFLS
Sbjct: 212 FNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLS 271

Query: 254 AGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES----ARTQDDANGQ 309
           AG+YV  LS  +   LGL + CVVGSG+IDAYAG +GT+AA+ DE     A+ +    G 
Sbjct: 272 AGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGV 331

Query: 310 DLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKH 369
           D   A GRLAAVAGTSTCH+ LS  PIFV GVWGPY+D++A  +WCAEGGQSCTG LL H
Sbjct: 332 D--KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAH 389

Query: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429
           V++THPAY +L+  +  + L  F+ LN  +  L   +   +++ L K LF YGDYHGNRS
Sbjct: 390 VLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRS 449

Query: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGG 489
           PIAD  MRA+IIGQSMD +V+ LAL YL ACEFIA QTR I+  M ++GH+I SI+MSGG
Sbjct: 450 PIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGG 509

Query: 490 QCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDD 541
           QCRN +LM LLAD TGLP++IP+YIDAAVVFG+AL+GA A + +N   T  D
Sbjct: 510 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTD 561

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%)

Query: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           LW  M  MTG G  + P  + +  + LLN KYKI++DMA TQ++YRS ID
Sbjct: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/584 (53%), Positives = 400/584 (68%), Gaps = 12/584 (2%)

Query: 16  GDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCV 75
           G+  ++IGVDVGTGS RA ++   G  LAL + PI R+EL+  FITQSS EIW ++C CV
Sbjct: 2   GEAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCV 61

Query: 76  RKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQE 135
           R V+  + +    V GIGFDATCSL  VD  T + + VGP F  + QNII+WMDHRA++E
Sbjct: 62  RGVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRE 121

Query: 136 TDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQ 195
           TD IN+  D  LKYVGG+MS+EME+PKIKWLK HMPR  F K  FFDLPDYLTF AT   
Sbjct: 122 TDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKD 181

Query: 196 NRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAG 255
            RS CSAVCKQGLLP GV+GS   WS  FL   GL ELI+  F ++GG   +   FL+AG
Sbjct: 182 RRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAG 241

Query: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAI 315
           + V  L+  + EQ GL+ SC+V SG+IDAYAG IG++ A+ D+S ++    +G D+  AI
Sbjct: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKS----SGLDV--AI 295

Query: 316 GRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHP 375
            RLA +AGTSTCHI LS  P FV GVWGPY+D+L   YWCAEGGQSCTG LL H++ THP
Sbjct: 296 TRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHP 355

Query: 376 AYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPR 435
           A+EEL   AAK ++  FE L  ++  L  ++    +LEL++  FLYGD+HGNRSP+ADP 
Sbjct: 356 AHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPS 415

Query: 436 MRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNI 495
           MRA++IGQSMD ++ESLA+ YLAACEFIA QTR I+  M   GH +  +YMSGGQCRN++
Sbjct: 416 MRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSL 475

Query: 496 LMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMV 555
           LM+L+AD  G+PVV+PKY D  VVFGAAL+   A    +  E +          LW+ M 
Sbjct: 476 LMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQST------RLWDIMT 529

Query: 556 KMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
            MT  GT + P  +    +  ++ KY I++DM + QK YRS +D
Sbjct: 530 AMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMD 573

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/592 (51%), Positives = 396/592 (66%), Gaps = 20/592 (3%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           +++GVDVGT   RAC+ID+ G ILA    PISR + K   ITQSS EIW ++C  VR  +
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
           A++++  ++V GI FDATCSL V+D+D+   +AVGP FS N QN+I+WMDHRA  E  EI
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           NS   + L+YVGGKMS+EM+MPKIKWL+ HMPR  F K  F+DLPD+LT++ATG+++RS 
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGG----PGNNSRNFLSAG 255
           CS VCK GL+P GV+ ST GWSR FL   GL EL E+ F R+GG    PG+    F SAG
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGS---EFRSAG 245

Query: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAI 315
           E V  LS+++   LGLT  CVVGSG+IDAYAG +GT+ A  D  AR   ++ G  ++   
Sbjct: 246 EPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPD-GAR---ESGG--VEELA 299

Query: 316 GRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHP 375
           GRLAAVAGTSTC I LS  P FV GVWGPY+D+LA+ YWC EGGQSCTG LL H + THP
Sbjct: 300 GRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHP 359

Query: 376 AYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPR 435
           AY EL   A +  L  F+ +N  +  L  + G  +I  L K  FLYGDYHGNRSP+ADP 
Sbjct: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419

Query: 436 MRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNI 495
           MRA+++G SMD + + LAL  L A EFIA Q RHI+  M  AG  + ++Y+SGGQ RN +
Sbjct: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPL 479

Query: 496 LMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVF--NQCETNDDRVPQVE-----H 548
           L +LLAD    PVV P+++ AAVVFG+AL+ A A + +  N   T    +P        H
Sbjct: 480 LTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMH 539

Query: 549 TLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
            LW  M ++T  G  ++P  +      LL  KYK++++MA+ QK YR L+DD
Sbjct: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/582 (50%), Positives = 402/582 (69%), Gaps = 3/582 (0%)

Query: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79
           ++IGVDVGTGS RAC+ ++ G+ILA+  K IS++EL+ GFITQSS EIWD+I   +++VI
Sbjct: 3   NYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVI 62

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139
             + +  + + GI FDATCSL V DK++LE +AVGP F  ++QNII+WMDHRA+ ETD I
Sbjct: 63  DISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLI 122

Query: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199
           NS  D  LKYVGGKMS+E E+PKIKWLK+H+  ETF + VF DL D+LT+KATG    S 
Sbjct: 123 NSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSF 182

Query: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGN-NSRNFLSAGEYV 258
            SAVCKQGLLP GVEGS  GWS+ FL   GL EL  N FE++GG  N    NFL  G+ V
Sbjct: 183 SSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLV 242

Query: 259 STLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGRL 318
             + K       L   CVVG+G+IDAY+G +GT+A+ + +   +        ++ ++GR+
Sbjct: 243 GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRI 302

Query: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378
           A V+GTSTCHI LS +P+F++GVWGPY+D+LA++ W  EGGQS TG LL ++I THPAY+
Sbjct: 303 AVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQ 362

Query: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438
           EL+   ++   ++F  L+E + +L   +   ++  LTK +F+YGDY+GNRSP+ADP M  
Sbjct: 363 ELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSG 422

Query: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498
            IIGQ+MD+++  LA+ YLAACEFIA QTRHII  +   GH I +IYMSGG C+N +LME
Sbjct: 423 MIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLME 482

Query: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKMT 558
           L+++   LP+V+ KYID++VVFGAA++G+ A  + +  E   +    +   LW+ M  MT
Sbjct: 483 LISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEY--SLNDVLWSQMKLMT 540

Query: 559 GNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
             GT + PK  +   +  L  KY++Y+DM  T  KYR  +++
Sbjct: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEE 582

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  233 bits (594), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 182/609 (29%), Positives = 289/609 (47%), Gaps = 104/609 (17%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPI------SREELKPGFITQSSEEIWDSICFC 74
           IG+DVG+ S R  + + + D +L +  +P+      SR   K     Q S EI  ++  C
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWK---FWQRSTEIIKALQKC 90

Query: 75  VRKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQ 134
           ++K+    KI    V   G  ATCSLA+ +KD   G  +      N+ N+I WMD  A  
Sbjct: 91  LQKL----KITEYNVKSCGVSATCSLAIFEKDKRNGSLIP---YPNEDNVIFWMDSSAID 143

Query: 135 ETDEINS-IYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATG 193
           E  ++N+      L ++GG    EM +PK+K+  N       ++   FDL  Y+ ++ + 
Sbjct: 144 ECKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSH 203

Query: 194 MQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSN-TGLPELIENEFERIGGPGNNSRNFL 252
           +   +    + ++    +GV+G   GWS +F  N   LP  +      IG  G   +   
Sbjct: 204 LYQWNNEVLLKRENNKMVGVDGEASGWSPSFYENIMHLPSNV-----IIGSNGATCKKIA 258

Query: 253 SAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQ 312
           S+                +  SC      ID+YA      +  ++ S             
Sbjct: 259 SSA---------------IVRSC------IDSYASWFAVSSPHLETS------------- 284

Query: 313 NAIGRLAAVAGTSTCHI---TLSDKPIFVNGVWGPYKDILAKD--YWCAEGGQSCTGELL 367
                L  +AGTSTC++    ++D  I + GVWGP+  IL  +  +     GQSCTG+L+
Sbjct: 285 -----LFMIAGTSTCYMYGTPITD--IKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLI 337

Query: 368 KHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGN 427
           +H+  THP  +E+  + A    D+++ L   I D+ +Q G  ++   TK +F YGDY GN
Sbjct: 338 EHLFVTHPCAKEILKRGA----DIYQVLERTIHDIEKQNGQ-SVHVFTKDIFFYGDYEGN 392

Query: 428 RSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIIT--KMNEAGHSIRSIY 485
           R+P ADPRM+ S IG++ DT++ +L   Y+   EF++ QTR II   K    G  I+ + 
Sbjct: 393 RTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELR 452

Query: 486 MSGGQCRNNILMELLADF-TGLPVVIPK-YIDAAVVFGAALIGATA------WDVFNQCE 537
           +SG Q +N  L+ L++    G+ +  PK  +D   V GA L+  +A       DV  + +
Sbjct: 453 ISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQIIDVIRERD 512

Query: 538 TNDDR---VPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKY 594
           T+DD     P  E+ L N                +    + LL  KY+I++DMAK Q++Y
Sbjct: 513 TSDDNEKFEPLPEYQLLN----------------DSSLLRRLLWAKYRIHLDMAKQQQRY 556

Query: 595 RSLIDDSLS 603
             LID+  S
Sbjct: 557 HKLIDEVFS 565

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  227 bits (578), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 177/596 (29%), Positives = 287/596 (48%), Gaps = 84/596 (14%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISREE---LKPGFITQSSEEIWDSICFCVRK 77
           IG+DVG+ S R  V +   D +L +  +P+   +    K     Q S EI  ++  C++K
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 78  VIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETD 137
           +     I   +V   G  ATCSLA+ ++D    + +      N+ N+I WMD  A  E  
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLIP---YPNEDNVIFWMDSSAVNECQ 121

Query: 138 EIN-SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQN 196
            +N       L Y+GGK   EM +PK+K+  +       +    FDL  Y+ ++ + +  
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYE 181

Query: 197 RSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNS--RNFLSA 254
            ++   + ++ L  IG +G   GWS +F  N             I  P N S     L A
Sbjct: 182 WNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI------------INLPSNVSIGTTSLVA 229

Query: 255 GEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNA 314
            +++ST          +  SC      ID+YA      +  ++ S               
Sbjct: 230 NKHIST---------TVVRSC------IDSYASWFAVASPHLETS--------------- 259

Query: 315 IGRLAAVAGTSTCHI---TLSDKPIFVNGVWGPYKDILAK--DYWCAEGGQSCTGELLKH 369
              L  +AGTS+C++   T+SD  I   GVWGP+  IL    D+     GQSCTG+L++H
Sbjct: 260 ---LFMIAGTSSCYMYGTTISDTRI--PGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEH 314

Query: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429
           +  +HP       K  K   D+++ L + IRD+ +  G  +I  LTK +F YGDY GNR+
Sbjct: 315 LFESHPCAR----KILKDGADIYQVLEQTIRDIEKNNG-LSIHILTKDMFFYGDYEGNRT 369

Query: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHII-TKMNEAGH-SIRSIYMS 487
           P ADPR++ S IG+S DT++ +L   Y+   EF++ QT+ II T  NE  +  I+ + +S
Sbjct: 370 PFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRIS 429

Query: 488 GGQCRNNILMELLADF-TGLPVVIPKY-IDAAVVFGAALIGATAWDVFNQCETNDDRVPQ 545
           G Q +N  L+ L++    G+ ++ PK  +D   + GA ++  +A +     +   +R   
Sbjct: 430 GSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADVITERDIS 489

Query: 546 VEHTLWNAMVKMT-GNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
            +   + ++ +   GN + +  K        LL  KY I++DMAK QK+Y  L+D+
Sbjct: 490 NDSEKFESLAEYRLGNDSILLRK--------LLCVKYHIHLDMAKQQKRYHKLVDE 537

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  223 bits (567), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 180/608 (29%), Positives = 288/608 (47%), Gaps = 100/608 (16%)

Query: 22  IGVDVGTGSVRACVIDRKGDIL-ALVDKPISR---EELKPGFITQSSEEIWDSICFCVRK 77
           IG+D+G+ S R  + D   D+L A+  +P+        K     Q S EI  ++  C ++
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQE 68

Query: 78  VIADAKIPANKVIGIGFDATCSLAVVDKDTLEG-LAVGPQFSKNDQNIIMWMDHRASQET 136
           +    KI    V   G  ATCSLA+  KD   G L   P    N+ N+I WMD  A  E 
Sbjct: 69  L----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYP----NEDNVIFWMDSSAVDEC 120

Query: 137 DEINS-IYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQ 195
           + +N       L Y+GGK   EM +PK+K+  N       ++   FDL  Y+ ++   + 
Sbjct: 121 EWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRLY 180

Query: 196 NRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSN-TGLPELIENEFERIGGPGNNSRNFLSA 254
             +      ++ +  IG +G   GWS +F ++   LP  +      IG  G         
Sbjct: 181 RWNTDELSARENINGIGNDGEASGWSSSFYNDIMKLPSNV-----TIGLTG--------- 226

Query: 255 GEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNA 314
                 L+ ++        SC      ID+YA      +  ++ S               
Sbjct: 227 ------LNSNNSSSTTTVCSC------IDSYASWFAVSSPNLEAS--------------- 259

Query: 315 IGRLAAVAGTSTCHITLSDKPIF---VNGVWGPYKDILAK--DYWCAEGGQSCTGELLKH 369
              L  +AGTSTC++  S  P+    + GVWGP+  IL    +Y     GQSCTG+L++H
Sbjct: 260 ---LFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGKLIEH 314

Query: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429
           +  +HPA  +++    +S  D++E L   I+D+ E+K   +I  L K +F YGDY GNR+
Sbjct: 315 LFKSHPAARKIQ----RSGEDIYEVLENSIQDI-EKKNRKSIHILAKHMFFYGDYEGNRT 369

Query: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKM--NEAGHSIRSIYMS 487
           P AD +MR S IG+S DT++ +L   Y++  EF++ QT+ II       +G  I  + +S
Sbjct: 370 PFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELRVS 429

Query: 488 GGQCRNNILMELLADFT-GLPVVIP-KYIDAAVVFGAALIGATA------WDVFNQCETN 539
           G Q +N  L+ L++    G+ +  P + ID   V GA ++G +A       D+  + + N
Sbjct: 430 GSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKKQIIDIIRERDAN 489

Query: 540 DDR---VPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRS 596
            D     P   + L N  + +                + LL+ KY+I++DMAK Q++Y  
Sbjct: 490 ADSEEFEPFGTYQLGNDCILL----------------KRLLSVKYRIHLDMAKQQQQYHR 533

Query: 597 LIDDSLSV 604
           L+D++L+V
Sbjct: 534 LVDEALNV 541

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  221 bits (563), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 178/607 (29%), Positives = 288/607 (47%), Gaps = 100/607 (16%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISREE---LKPGFITQSSEEIWDSICFCVRK 77
           IG+D+G+ S R  +     D +L +  +P+   +    K     Q S EI +++  C +K
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 78  VIADAKIPANKVIGIGFDATCSLAVVDK-DTLEGLAVGPQFSKNDQNIIMWMDHRASQET 136
           +    KI    V   G  ATCSLA+ ++  T E L   P    N+ N+I WMD  A+ E 
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALIPYP----NENNVIFWMDSSATDEC 120

Query: 137 DEINS-IYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQ 195
           + +N+      L Y+GG+   EM +PK+K+  N       ++   FDL  Y+ ++   + 
Sbjct: 121 EWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLY 180

Query: 196 NRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSN-TGLPELIENEFERIGGPGNNSRNFLSA 254
             ++   +  + +  IG +G   GWS +F  N   +P  +      I GP       L +
Sbjct: 181 QWNIDGLLRGENINGIGNDGEASGWSSSFYKNIMNIPSNV------IIGPVG-----LVS 229

Query: 255 GEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNA 314
            + +ST          +  SC      ID+YA         ++ S               
Sbjct: 230 KKVISTT---------VVRSC------IDSYASWFAVSPPFLERS--------------- 259

Query: 315 IGRLAAVAGTSTCHITLSDKPIF---VNGVWGPYKDIL--AKDYWCAEGGQSCTGELLKH 369
              L  +AGTS+C+  +   P+    + GVWGP+ +IL    D+     GQSCTG+L++H
Sbjct: 260 ---LFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLIEH 314

Query: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429
           +  +HP       K  KS  D+++ L + I  + ++KG  +I  L K +F YGDY GNR+
Sbjct: 315 LFESHPCAR----KILKSGADIYQVLEQTIHGIEKKKG-LSIHILAKDMFFYGDYEGNRT 369

Query: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIR--SIYMS 487
           P ADPRM+ S IG++ DT++ +L   Y++  EF++ QT+ II         IR   + +S
Sbjct: 370 PFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRIS 429

Query: 488 GGQCRNNILMELLADF-TGLPVVIPK-YIDAAVVFGAALIGATA------WDVFNQCETN 539
           G Q RN  L+ L++    G+ +  P+  +D   + GA ++  +A       DV  + +  
Sbjct: 430 GSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRERDVG 489

Query: 540 DDR---VPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRS 596
           DD     P  E+ L        GN +T+         + LL  KY+I++DMAK QK Y  
Sbjct: 490 DDNEKFQPLSEYCL--------GNDSTLL--------KNLLCVKYRIHLDMAKQQKYYYK 533

Query: 597 LIDDSLS 603
           L+D+ +S
Sbjct: 534 LVDEVIS 540

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  205 bits (521), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 169/596 (28%), Positives = 271/596 (45%), Gaps = 84/596 (14%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISREEL-KPGFITQSSEEIWDSICFCVRKVI 79
           +GVD+G+ SVR  +   + D +L +V++P+        G  TQS+ EI  ++  C+ ++ 
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL- 71

Query: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFS----KNDQNIIMWMDHRASQE 135
              +     ++  G  ATCS+AV   +  +G       S     +D+N++ WMD  AS+ 
Sbjct: 72  -GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASEA 130

Query: 136 TDEINSIYDAPLKY-VGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGM 194
            D ++      +K  + G    EM +PK+  L    P  +      FDL  Y+ +     
Sbjct: 131 CDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSLE---VFDLHKYIAYDLARR 187

Query: 195 QNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNT-GLPELIENEFERIGGPGNNSRNFLS 253
               + +   +     IG +G   GW + F  N   LP  +                   
Sbjct: 188 YGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNVLKLPATVA------------------ 229

Query: 254 AGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQN 313
               V   S   G+++G+  SC      ID YA   G  + + ++S              
Sbjct: 230 ----VGPASTFKGQRVGVA-SC------IDCYASWFGVCSTQPEQS-------------- 264

Query: 314 AIGRLAAVAGTSTCHITLSD-KPIFVNGVWGPYKDIL--AKDYWCA-EGGQSCTGELLKH 369
               L  VAGTSTC++  S      + G+WGP+ ++L   +  W   E GQS TG LL+H
Sbjct: 265 ----LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLLEH 320

Query: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429
           +  THPA  +      +    LF+ L + I D+    G C+I  L + +FLYG+  GNR+
Sbjct: 321 LFETHPAARDYAGDTGR----LFKDLEDRIADMEADSG-CSIHHLARHMFLYGELQGNRT 375

Query: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE-AGHSIRSIYMSG 488
           P ADPRM    +G++ DT+  +LAL Y+   EF+A QTR I+      A  +I  + ++G
Sbjct: 376 PYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGELRVAG 435

Query: 489 GQCRNNILMELLADFTG-LPVVIP-KYIDAAVVFGAALIGATAW---DVFNQCETNDDRV 543
            Q RN  L+ L++   G +PV +P +    A V GA L+G   +    + +        +
Sbjct: 436 SQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKARYLDVSLLDVVRKPGATI 495

Query: 544 PQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
           P VE         +T +    A    +   + LL  KY I++DMA+ Q++YRS ID
Sbjct: 496 PTVE---------VTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEID 542

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  198 bits (503), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 167/589 (28%), Positives = 265/589 (44%), Gaps = 79/589 (13%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80
           +G+D+G+ +VR  + D K D ++ +V KP+         +TQSS +I  +I  C++ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDLNP 70

Query: 81  DAKIPANKVIGIGFDATCSLAVVDKDT--LEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138
           D K     V+  G  ATCSLAV  +D   L+ L +     +   N++ WMD  A+ E + 
Sbjct: 71  DLK----SVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198
           +N       +++GG    EM +PK+  +    P     K   FDL  Y+ ++        
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYGWD 185

Query: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNT-GLPELIENEFERIGGPGNNSRNFLSAGEY 257
               + K     IG +G  +GW   F ++   LP  ++       GP             
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFYNDVLKLPANVKI------GP------------- 226

Query: 258 VSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR 317
           +  L+         TES V  +  ID Y+      ++  + S                  
Sbjct: 227 IHALN---------TESPVRVASCIDCYSNWFSMCSSSPNNS------------------ 259

Query: 318 LAAVAGTSTCHITL-SDKPIFVNGVWGPYKDIL----AKDYWCAEGGQSCTGELLKHVIT 372
           L   AGTSTC++   ++    + GVWGP+ +IL    AK++   E GQS TG+L++H+  
Sbjct: 260 LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFE 319

Query: 373 THPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIA 432
           THPA     +  +K    LF  +   I  L +  G       +K +F YG+  GNR+P  
Sbjct: 320 THPAARAYSMDKSK----LFSAIESAIEKLEQDFGESVHFR-SKHMFTYGELQGNRTPYC 374

Query: 433 DPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCR 492
           D  M    IG++ DT+ + L L Y+   EF+A Q +HI          I+ I ++G Q +
Sbjct: 375 DSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIKDIRIAGSQAK 431

Query: 493 NNILMELLADFTG-LPVVIP-KYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTL 550
           N  L+ L +     + V IP +  D   V GA L+G  A    N  +  D R     H L
Sbjct: 432 NTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINIIDLIDKRDRLQSHIL 491

Query: 551 WNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
               +K+  + T +         + LL  KYKIY+DMA+TQ +YR+++D
Sbjct: 492 ELGPMKLGNHNTKL---------KQLLEAKYKIYLDMAQTQMRYRAMVD 531

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  197 bits (500), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 185/608 (30%), Positives = 277/608 (45%), Gaps = 107/608 (17%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80
           +G+D+G+  VR    + + D  +A+V + ++  E + G  TQSS EI  +I  C   +  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESLNI 67

Query: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSK----NDQNIIMWMDHRASQET 136
           D       V   G  ATCSLAV  +++ +GL     +      NDQN++ WMD  A +E 
Sbjct: 68  DIW----AVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 137 DEINSIYDAPLKYVGGKMSIEMEMPKIKWL-----KNHMPRETF--RKAVFFDLPDYLTF 189
             IN +      Y GG    EM +PK+        KN+   E F     V +DL +   +
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNNSDFEVFDLHTYVAYDLANRYGW 183

Query: 190 KATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNT-GLPELIENEFERIGGPGNNS 248
            A+ + NR   +         IG +G  +GW   F   T  LP  +     RIG P   +
Sbjct: 184 DASFLINRPNHNG--------IGHDGEIKGWKDEFYEKTLKLPPNV-----RIG-PLCIN 229

Query: 249 RNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANG 308
           R F                      S V  +  ID Y+      ++  + S         
Sbjct: 230 RRF----------------------SPVKVASCIDCYSSWFSMFSSTPERS--------- 258

Query: 309 QDLQNAIGRLAAVAGTSTCHITLSDKPI-FVNGVWGPYKDIL-AKD--YWCA-EGGQSCT 363
                    L   AGTSTC++  ++KP   + G+WGP+ DIL +KD   W   E GQS T
Sbjct: 259 ---------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTT 309

Query: 364 GELLKHVITTHPAYEELKIKAAKSKLD----LFECLNEIIRDLAEQKGTCTILELTKGLF 419
           G+L++H+  +HPA        AK  L+    LF  L   I +L EQ+   ++   TK +F
Sbjct: 310 GKLIEHLFESHPA--------AKPYLEDRNVLFNRLETEI-NLIEQQSAESVHFKTKHMF 360

Query: 420 LYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGH 479
            YG+  GNR+P  DP M    IG+S DT+   L L Y+   EF+A Q RHI   +   G 
Sbjct: 361 NYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GA 417

Query: 480 SIRSIYMSGGQCRNNILMELLADFT-GLPVVIP-KYIDAAVVFGAALIGATAWDVFNQCE 537
            I  I ++G Q +NN L+ L++    G  V IP    D   V GA L+G       N  E
Sbjct: 418 PINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKAKHLGLNVVE 477

Query: 538 --TNDDRVPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYR 595
             T ++     E  + +  V++  N          +  +AL   KYKIY++MA+TQ++YR
Sbjct: 478 LITQEN---GGESPMKDIEVRIEKN--------EENKLRALFEIKYKIYLNMAQTQRQYR 526

Query: 596 SLIDDSLS 603
            +++ +L+
Sbjct: 527 EMVNAALT 534

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  195 bits (496), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 174/599 (29%), Positives = 271/599 (45%), Gaps = 90/599 (15%)

Query: 22  IGVDVGTGSVRACVIDRKGDILA-LVDKPISREELKPGFI---TQSSEEIWDSICFCVRK 77
           IG+D+G+ SVR  +   + D++   V + IS        +   TQS++EI   I  C+  
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQKISYYYHGDSALWEYTQSTDEIMKVIERCLH- 64

Query: 78  VIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETD 137
              D KI    +   G  ATCS+A+  K+             + QN+I WMD+ +  E  
Sbjct: 65  ---DLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTECK 121

Query: 138 EINSIYDAPLK-YVGGKMSIEMEMPKIKWLKNHMPRETFRK---AVFFDLPDYLTFKATG 193
            +N++ +  L+ ++GGK   EM +PKI  L N++      +    V  DL  YL ++   
Sbjct: 122 LLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEIAK 181

Query: 194 MQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNT-GLPELIENEFERIGGPGNNSRNFL 252
               +    +       IG +G   GWS  F  +T  +P  I      IG       +F 
Sbjct: 182 RFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNI-----TIGPEPPLEDDF- 235

Query: 253 SAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQ 312
              EY            G+  SC      ID Y+  +   +   +ES             
Sbjct: 236 ---EYCK----------GIVASC------IDCYSSWLSLCSPTPEES------------- 263

Query: 313 NAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDIL--AKDYWCAEGGQSCTGELLKHV 370
                L  V GTSTC++  + +   + GVWGP+ DIL  +  Y   EGGQSCTG+L++H+
Sbjct: 264 -----LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTGKLIEHL 318

Query: 371 ITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSP 430
           + THPA   +   A      L E + + I  + EQ G  +I   TK +F YGD+ GNR+P
Sbjct: 319 LQTHPASSSI---AKDDWPLLLEKIEQEISAIEEQTGR-SIHFKTKHMFFYGDFQGNRTP 374

Query: 431 IADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEA--GHSIRSIYMSG 488
            ADP M    IG++ D +  +L L Y+   EF+A Q +++I+  N+A     I  I + G
Sbjct: 375 YADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKITEIRICG 434

Query: 489 GQCRNNILMELLADF-TGLPVVIPKY-IDAAVVFGAALIGATAWDVFNQC------ETND 540
            Q +N  L+ L++    G  + +PK  ++ + V GA L+G +A  + N+       E +D
Sbjct: 435 SQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSA--LLNKSPLDLIQEKDD 492

Query: 541 DRVPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599
            +   +  T                P         LL  KY+I++DMAK Q  YR +I+
Sbjct: 493 QKQVDIFET----------------PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMIN 535

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  186 bits (473), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 173/597 (28%), Positives = 270/597 (45%), Gaps = 93/597 (15%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISR---EELKPGFITQSSEEIWDSICFCVRK 77
           IG+D+G+ SVR  + + + D I+A   K +      E      TQSS EI  +I  C ++
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 78  VIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETD 137
           +     I  +++   G  ATCSLA+    T +   +       D+N++ WMD  A +ET 
Sbjct: 70  L----NIDKHEIKSCGVGATCSLAIFQ--TKDNALIPWNLDDPDKNVVFWMDSIAIKETQ 123

Query: 138 EINSIYDAPLK-YVGGKMSIEMEMPKIKW----LKNHMPRETFRKAVFFDLPDYLTFKAT 192
           E+N +    ++ ++GG    EM +PK++     LKN     TF      DL  Y+   + 
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAM-SL 179

Query: 193 GMQNRSLCSAVCK-QGLLPIGVEGSTEGWSRTFLSNT-GLPELIENEFERIGGPGNNSRN 250
             QN    + VC    L  IG +G   GWS  F  N   LP  I      + GP  +S++
Sbjct: 180 AQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENVLQLPPNI------VIGPTKHSQH 233

Query: 251 FLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQD 310
               G  VS              SC      ID Y+     + +               +
Sbjct: 234 SSKQGLKVS--------------SC------IDCYSNWFALLPS---------------N 258

Query: 311 LQNAIGRLAAVAGTSTCHITLSDK-PIFVNGVWGPYKDILAK--DYWCAEGGQSCTGELL 367
           LQN+   L  V GTSTC++  S +    + GVWGP+ +I  +   +   E GQSCTG+L+
Sbjct: 259 LQNS---LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLI 315

Query: 368 KHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGN 427
           +H+  THPA   +  +       LF  +N+ I  + EQ    +I   TK +F YGD  GN
Sbjct: 316 EHLFKTHPASSHIDTRDWPH---LFSQINDFIEKV-EQNTQDSIHMQTKHMFFYGDLDGN 371

Query: 428 RSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMN--EAGHSIRSIY 485
           R+P ADP M    IG++ DT+  +L   Y++  EFIA Q +H++   N       I ++ 
Sbjct: 372 RTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQ 431

Query: 486 MSGGQCRNNILMELLADFTGLPVVIPKYIDAAVV--FGAALIGATAWDVFNQCETNDDRV 543
             G   +N  L+ LLA       +    +D A++  +G+ L+G        +  T+D  +
Sbjct: 432 FCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMG--------KASTSDKSI 483

Query: 544 PQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600
            +V H             +   P+        LL  KY+IY +MA+ Q+KYR  +++
Sbjct: 484 VEVAH---------NQTYSYRPPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNN 531

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 169/616 (27%), Positives = 271/616 (43%), Gaps = 124/616 (20%)

Query: 22  IGVDVGTGSVRACVIDRKGD-ILALVDKPISREELKPGFITQSSEEIWD------SICFC 74
           IG+D+G+ SVR  +     D +L +  KP+      P +   +   +W+       I   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPV------PYYYESNRTSLWEYTQDSAEILTA 61

Query: 75  VRKVIADAKIPANKVIGIGFDATCSLAVVDK---DTLEGLAVGPQFSKNDQNIIMWMDHR 131
           +++    A +    V   G  ATCSL + ++   DT +          + +N++ WMD  
Sbjct: 62  IKECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTFQ------HCEGDSRNVVFWMDSM 115

Query: 132 ASQETDEINSIYDAP---LKYVGGKMSIEMEMPKI-KWLKN--HMPRETFRKAVFFDLPD 185
           A +ET+ +N+    P   L ++GG    EM +PK+ ++LK+    P+   +  VF DL  
Sbjct: 116 AKEETNSLNA--RCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVF-DLHK 172

Query: 186 YLTFKATGMQNRSLCSAVCKQGLLP----IGVEGSTEGWSRTFLS---------NTGLPE 232
           Y+ +K      +  C    +    P    IG +G   GWS++F             G P+
Sbjct: 173 YVAYKLA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKIVRLPPNVTIGCPK 228

Query: 233 LIENEFERIGGPGNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTI 292
            IENE                             + L + +SC      ID Y+     +
Sbjct: 229 TIENE-----------------------------DSLVIVDSC------IDCYSSWFSPL 253

Query: 293 AARIDESARTQDDANGQDLQNAIGRLAAVAGTSTCHI----TLSDKPIFVNGVWGPYKDI 348
                           Q L      L  VAGTSTC+I    T+  +   V G+WGP+ DI
Sbjct: 254 ----------------QSLNK--NTLFLVAGTSTCYIYSPGTMKTE-TSVKGIWGPFTDI 294

Query: 349 LAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGT 408
           L  +    E G SC+G+L++H+ T+HP+   L +   +    L   L E I     Q  T
Sbjct: 295 LGANKVVYESGSSCSGKLIEHLFTSHPSAISLNLSTGQ----LISKLEEEINIWETQNAT 350

Query: 409 CTILELTKGLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTR 468
               E     FLYGD  GNR+P  DP MR   IG+S DT+   L + Y+   E +A QT+
Sbjct: 351 SIHFEACNN-FLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTK 409

Query: 469 HIITKMNEAGHSIRSIYMSGGQCRNNILMEL--LADFTGLPVVIPKYIDAAVVFGAALIG 526
            ++    E  +SI  +++ G Q +N  L++L  L +   L +V  +  D   V GA L+G
Sbjct: 410 LMVDNF-EKLNSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

Query: 527 ATAWDVFNQCETNDDRVPQVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMD 586
              +       T+ D VP  E   + + VK T +    + K+ +     LL TKY I+++
Sbjct: 469 KAGY-----LGTSVDLVPVSEPREYIS-VKYTND----SDKIQQTKLYKLLLTKYIIHLE 518

Query: 587 MAKTQKKYRSLIDDSL 602
           MA+ Q+++R ++  +L
Sbjct: 519 MAEQQQRFRKMVSKAL 534

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  131 bits (329), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 139/494 (28%), Positives = 212/494 (42%), Gaps = 79/494 (15%)

Query: 22  IGVDVGTGSVRACVIDRKGDILALVDK---PISREELKPGFITQSSEEIWDSICFCVRKV 78
           IGVD+G+   R  + D   D L    K   P  R     G ITQ + +I  +    V K 
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRH--GNGIITQCTSDILTA----VEKA 59

Query: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQ--NIIMWMDHRASQET 136
                I    +  +G  ATCS+ V  +     +       KN +  +II WM   A +ET
Sbjct: 60  FNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 137 DEINSIYD-APLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQ 195
           + +N+I D + L + GGK   EM +PK+  L N + ++        DL  +L +K +   
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHL-NKLYKDD--GLTVLDLHIWLLWKISLKL 176

Query: 196 NRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAG 255
                  V +     IG +G   GWS+ F  +  L ++           GNN+       
Sbjct: 177 GHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIF---------IGNNA------- 220

Query: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAI 315
                + K+  EQ G  +SC      ID YA      +  +    RT             
Sbjct: 221 ----VIKKN--EQFG--DSC------IDCYASWFQCWSTAM--LNRT------------- 251

Query: 316 GRLAAVAGTSTCHITLSD-KPIFVNGVWGPYKDILAK--------DYWCAEGGQSCTGEL 366
             L  VAGTSTC +  SD    F+ G+WGP+KDIL          +Y   E G S TG L
Sbjct: 252 --LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGVL 309

Query: 367 LKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHG 426
           L+ +++THPA ++       S ++  E +   I DL EQ  T +I  + K  F + DY  
Sbjct: 310 LEKLLSTHPAVKD-------SDVNFLETVEHKI-DLIEQSDTQSIHLMIKNTFFHEDYEE 361

Query: 427 NRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYM 486
             S         SI+ +  + T++ LAL Y+   E +A Q   +I    E   +I  + +
Sbjct: 362 FESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITISKLLI 421

Query: 487 SGGQCRNNILMELL 500
           +G Q +N+ L+++L
Sbjct: 422 TGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 126/519 (24%), Positives = 213/519 (41%), Gaps = 100/519 (19%)

Query: 22  IGVDVGTGSVRACVIDRKG--DILALVDKPISREE--LKPGFITQSSEEIWDSICFCVRK 77
           IG+DVG+ SVR  + + +    I  +V + + + E   K    TQ++  + DSI   + +
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTALEE 64

Query: 78  VIADAKIPANKVIGIGFDATCSLAVVDKDT----LEGLAVGPQFSKNDQNIIMWMDHRAS 133
           +  ++ I   K+ G+   ATCS+  + +D+    L  L +  + + N  +II W DH A 
Sbjct: 65  LHVNSYIV--KICGVS--ATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 134 QETDEINSIYDAPLKYVGGKMSI-------------EMEMPKIKWLKNHMPRETFRKAVF 180
            E   +N+      + + GK +              EM +PK+  L N +    +     
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 181 FDLPDYLTFKATGMQNRSLCSAVC---KQGLLPIGVEGSTEGWSRTFLSNTGLPELIENE 237
            ++ D   + A  +  +   + V    K  +  IG++G  +GW  +F     LP   E  
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFYV-WALP---ETS 236

Query: 238 FERIGGPGNNSRNFLSAGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARID 297
           F    GP                 SK   E      S V     ID YA    T      
Sbjct: 237 FPICIGP-----------------SKVINET-----SIVRPKSCIDCYASWFST------ 268

Query: 298 ESARTQDDANGQDLQNAIGRLAAVAGTSTC-----------HITLSDKPIFVNGVWGPYK 346
             A T+DD            L   AGTSTC           +     +P+ +   WGP+ 
Sbjct: 269 -DACTKDDT-----------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSL--FWGPFT 314

Query: 347 DILAKDYWCA-EGGQSCTGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEIIRDLA-- 403
           ++L KD   + E G S TG LL+ +   H      +I A+ S   + E +N +   +A  
Sbjct: 315 NVLDKDKKSSFEIGFSETGILLEKLFNKH------QITASWS---VAESINYVENQIAIY 365

Query: 404 EQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALI--YLAACE 461
           E+K + +I  L   ++L+  Y     P          +  +   T  +L LI  Y+A  E
Sbjct: 366 ERKKSHSIY-LEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILE 424

Query: 462 FIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILMELL 500
           ++A+Q  ++I +  +    I  + +SG Q +N  L++L+
Sbjct: 425 YLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 72/158 (45%), Gaps = 30/158 (18%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMN- 475
           G+     ++G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 609 GVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSG 665

Query: 476 ---EAGH---SIRSIYMSGGQCRNNILMELLADFTGL-------PVVIPKYIDAAVVFGA 522
              E G+   ++ ++ + GG  +++ +M++ AD  G        P+V    + AA+    
Sbjct: 666 DKIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRRSPIVECTALGAAIAANM 725

Query: 523 A------------LIGATAWDVFNQCETNDDRVPQVEH 548
           A            L  A  W ++N   + DD +PQ+ H
Sbjct: 726 AYKNVEDRVLWKDLNDAKKWVMYNGY-SKDDNIPQLMH 762

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 13/124 (10%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     ++G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M  
Sbjct: 502 GVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMGS 558

Query: 477 ---------AGHSIRSIYMSGGQCRNNILMELLADFTGLPVVIPKY-IDAAVVFGAALIG 526
                       ++ ++ + GG  ++N +M++ AD  G  + + +  I      GAA+  
Sbjct: 559 DEVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRRSPIVECTALGAAIAA 618

Query: 527 ATAW 530
             A+
Sbjct: 619 NMAY 622

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMN- 475
           G+     + G  +P  DP  RASI+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 465 GVVFVPAFSGLFAPYWDPNARASIMGMSQYTTAAHIA---RAAVEGVCFQARAILKAMSS 521

Query: 476 ----EAG--------HSIRSIYMSGGQCRNNILMELLADFTG 505
               E+G         ++ ++ + GG  R++ +M++ A+  G
Sbjct: 522 DVLQESGDFEDTYEKSALSTLAVDGGMSRSDEVMQIQANILG 563

>Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON}
           YHL032C (REAL)
          Length = 710

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 64/174 (36%), Gaps = 43/174 (24%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 494 GVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSS 550

Query: 477 AGH---------------------SIRSIYMSGGQCRNNILMELLADFTGLPVVIPKYID 515
                                    +  + + GG  R+N +M++ AD  G  V + +   
Sbjct: 551 DAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPT 610

Query: 516 A-AVVFGAALIGATA------------------WDVFNQCETNDDRVPQVEHTL 550
           A     GAA+    A                  W  +N  E N+   P+V  +L
Sbjct: 611 AECTALGAAIAANMAFKDPKSRPLWKDLHDVKKWVFYNGIEKNEQISPEVHPSL 664

>Kpol_1062.1 s1062 complement(1522..3942) [2421 bp, 806 aa] {ON}
           complement(1522..3942) [2421 nt, 807 aa]
          Length = 806

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 57/143 (39%), Gaps = 33/143 (23%)

Query: 183 LPDYLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWS---------------RTFLSN 227
           +P++   K      +S+C+ V K G L I +  ++E WS               R FLSN
Sbjct: 88  VPEFKIAKMMDPSLKSICNRVVKLGQLYIVLTSASEIWSDSIYGKVLQRLSFEIRQFLSN 147

Query: 228 TGLPELIEN-EFERIGGPGNNSRNFLSAGEYVSTLSKSSGEQLGL-TESCVVGSGLIDAY 285
           T LP +++  EFE    P  + R+                EQL   TE     S L + Y
Sbjct: 148 TYLPFIVDKLEFEFKNNPNFSIRDL---------------EQLAYDTEVYKQMSLLFNIY 192

Query: 286 AGLIGTIAARIDESARTQDDANG 308
             +   I  R +   R Q+D N 
Sbjct: 193 QKIQEEITLR-NSMDRMQEDFNN 214

>YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}
           GUT1Glycerol kinase, converts glycerol to
           glycerol-3-phosphate; glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p; derepression of
           expression on non-fermentable carbon sources is mediated
           by Opi1p and Rsf1p
          Length = 709

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 75/201 (37%), Gaps = 27/201 (13%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 494 GVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSS 550

Query: 477 AGH---------------------SIRSIYMSGGQCRNNILMELLADFTGLPVVIPKYID 515
                                    +  + + GG  R+N +M++ AD  G  V + +   
Sbjct: 551 DAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPT 610

Query: 516 A-AVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKMTGNGTTIAP--KVNRHA 572
           A     GAA+    A+   N+     D     +   +N M K         P  K+ R  
Sbjct: 611 AECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEAHPNLKIFRSE 670

Query: 573 SQALLNTKYKIYMDMAKTQKK 593
           S      K+  Y ++A  + K
Sbjct: 671 SDDAERRKHWKYWEVAVERSK 691

>CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032c GUT1
           glycerol kinase
          Length = 672

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (42%), Gaps = 26/138 (18%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHII----- 471
           G+     + G  +P  DP  R +I+G S  TT   +A    AA E +  Q R I+     
Sbjct: 460 GVVFVPAFSGLFAPYWDPEARGTIMGMSQYTTASHIA---RAAVEAVCFQARAILLAMSN 516

Query: 472 -------------TKMNEAGHSIRSIY----MSGGQCRNNILMELLADFTGLPVVIPKYI 514
                        T+++E G   +S+     + GG  R++ +M++ AD  G  V + +  
Sbjct: 517 DAMGEAEKDSTFKTEISEEGSYQKSLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRRSP 576

Query: 515 DA-AVVFGAALIGATAWD 531
            A     GAA+    A++
Sbjct: 577 TAECTALGAAVAANMAYE 594

>TBLA0E01350 Chr5 complement(297302..299386) [2085 bp, 694 aa] {ON}
           Anc_4.9 YHL032C
          Length = 694

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 415 TKGLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKM 474
           T G+     ++G  SP  DP  RAS+ G ++ TT   +A    AA E + +Q R I+  M
Sbjct: 450 TGGVVFIPSFNGLWSPYWDPHARASMFGVTLYTTANHIA---RAAVEGVCYQVRAILKAM 506

Query: 475 NE 476
           ++
Sbjct: 507 SK 508

>TBLA0G02590 Chr7 complement(680382..684743) [4362 bp, 1453 aa] {ON}
           Anc_2.235 YIL126W
          Length = 1453

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 108/244 (44%), Gaps = 33/244 (13%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIG--VEGSTEGWSRTFLSNT 228
            +K V  DLPD     +  K +G+Q + L   + K   L +G   EG+T+G  +    N 
Sbjct: 687 LKKEVEKDLPDKVEKVIKCKLSGLQ-QQLYEQMLKHNALFVGAGTEGATKGGIKGL--NN 743

Query: 229 GLPEL--------IENEFERIGGPG--NNSRNFLSAGEY-----VSTLSKSSGEQLGLTE 273
            + +L        + +E E +  P   NN+  F  +G++     V    K+SG ++ +  
Sbjct: 744 KIMQLRKICNHPFVFDEVESVINPSKTNNNLLFRVSGKFELLDRVLPKLKASGHRVLMFF 803

Query: 274 SCVVGSGLIDAYAGLIGTIAARIDESARTQD------DANGQDLQNAIGRLAAVAGTSTC 327
                  +++ +  +      R+D S + ++      D N  + +     L+  AG    
Sbjct: 804 QMTQVMDIMEDFLRMKQLQYMRLDGSTKAEERTEMLNDFNAPNSEYFCFLLSTRAGGLGL 863

Query: 328 HITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKS 387
           ++  +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  
Sbjct: 864 NLQTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERAMQ 920

Query: 388 KLDL 391
           KLD+
Sbjct: 921 KLDI 924

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 45/108 (41%), Gaps = 22/108 (20%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 455 GVVFVPAFSGLFAPYWDPDARATIMGMSQYTTASHIA---RAAVEGVCFQARAILKAMSS 511

Query: 477 AGHS-------------------IRSIYMSGGQCRNNILMELLADFTG 505
                                  + ++ + GG  R++ +M++ AD  G
Sbjct: 512 DAFGSEDKDFLEEVVDETYEKTLLSTLAVDGGMSRSDEVMQIQADILG 559

>Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON}
           YHL032C (REAL)
          Length = 708

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 53/135 (39%), Gaps = 25/135 (18%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 494 GVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSS 550

Query: 477 AGH---------------------SIRSIYMSGGQCRNNILMELLADFTGLPVVIPKYID 515
                                    +  + + GG  R+N +M++ AD  G  V + +   
Sbjct: 551 DAFGEGSKDVDFLEEISGVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPT 610

Query: 516 A-AVVFGAALIGATA 529
           A     GAA+    A
Sbjct: 611 AECTALGAAIAANMA 625

>SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032C GUT1
           Glycerol kinase converts glycerol to glycerol-
           3-phosphate glucose repression of expression is mediated
           by Adr1p and Ino2p-Ino4p derepression of expression on
           non- fermentable carbon sources is mediated by Opi1p and
           Rsf1p
          Length = 685

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 24/110 (21%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 471 GVVFVPAFSGLFAPYWDPDARATIMGMSQYTTASHIA---RAAVEGVCFQARAILKAMSS 527

Query: 477 AGH---------------------SIRSIYMSGGQCRNNILMELLADFTG 505
                                   ++ ++ + GG  R++ +M++ AD  G
Sbjct: 528 DAFGEGEKDRDFLEEIEDETYERTALSTLAVDGGMSRSDEVMQIQADILG 577

>Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON}
           YHL032C (REAL)
          Length = 732

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 53/135 (39%), Gaps = 25/135 (18%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 517 GVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILRAMSS 573

Query: 477 AGH---------------------SIRSIYMSGGQCRNNILMELLADFTGLPVVIPKYID 515
                                    +  + + GG  R+N +M++ AD  G  V + +   
Sbjct: 574 DAFGEGSKDRDFLEEISDVTYEKTPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPT 633

Query: 516 A-AVVFGAALIGATA 529
           A     GAA+    A
Sbjct: 634 AECTALGAAIAANMA 648

>SAKL0E08910g Chr5 complement(730567..734409) [3843 bp, 1280 aa]
           {ON} similar to uniprot|P32597 Saccharomyces cerevisiae
           YIL126W STH1 helicase related protein snf2 homolog
          Length = 1280

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 108/244 (44%), Gaps = 33/244 (13%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIG--VEGSTEGWSRTFLSNT 228
            +K V  DLPD     +  K +G+Q + L   + K   L +G   EG+T+G  +    N 
Sbjct: 679 LKKEVEKDLPDKVEKVVKCKLSGLQ-QQLYEQMLKHNALFVGAGTEGATKGGIKGL--NN 735

Query: 229 GLPEL--------IENEFERIGGPG--NNSRNFLSAGEY-----VSTLSKSSGEQLGLTE 273
            + +L        + +E E +  P   N+S  +  +G++     V    ++SG ++ +  
Sbjct: 736 KIMQLRKICNHPFVFDEVEGVINPTRENSSLLYRVSGKFELLDRVLPKFRASGHRVLMFF 795

Query: 274 SCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR------LAAVAGTSTC 327
                  +++ +  +      R+D S + +D      L NA G       L+  AG    
Sbjct: 796 QMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRTGMLKLFNAPGSDYFCFLLSTRAGGLGL 855

Query: 328 HITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKS 387
           ++  +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  
Sbjct: 856 NLQTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERAMQ 912

Query: 388 KLDL 391
           KLD+
Sbjct: 913 KLDI 916

>KAFR0I01510 Chr9 (318409..320526) [2118 bp, 705 aa] {ON} Anc_4.9
           YHL032C
          Length = 705

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 58/137 (42%), Gaps = 26/137 (18%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNE 476
           G+     + G  +P  D   RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 482 GVVFVPAFSGLFAPYWDADARATIMGMSQYTTASHIAR---AAVEGVCFQARAILKAMSS 538

Query: 477 ------------------AGHSIRSIY----MSGGQCRNNILMELLADFTGLPVVIPKY- 513
                             +G+  R+ +    + GG  R+N +M++ AD  G  + + +  
Sbjct: 539 DAYEGEINDDIDLLEESNSGNYERAAFSVLAVDGGMSRSNEVMQIQADILGPCIKVRRSP 598

Query: 514 IDAAVVFGAALIGATAW 530
           +  +   GAA+    A+
Sbjct: 599 VAESTALGAAIAANMAY 615

>NDAI0B03840 Chr2 complement(965694..969785) [4092 bp, 1363 aa] {ON}
           Anc_8.228 YER164W
          Length = 1363

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 107/244 (43%), Gaps = 33/244 (13%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLS--NT 228
            +K V  DLPD     +  K +G+Q + L   + K   L +G    TEG ++T +   N 
Sbjct: 685 LKKEVEKDLPDKVEKVIKCKLSGLQ-QQLYEQMLKHNALFVG--AGTEGATKTGIKGLNN 741

Query: 229 GLPEL--------IENEFERIGGP--GNNSRNFLSAGEY-----VSTLSKSSGEQLGLTE 273
            + +L        + +E E +  P  GN+   +  AG++     V    K+SG ++ +  
Sbjct: 742 KIMQLRKICNHPFVFDEVEGVVNPSRGNSDVLYRVAGKFELLDRVLPKFKASGHRVLMFF 801

Query: 274 SCVVGSGLIDAYAGLIGTIAARIDESARTQD------DANGQDLQNAIGRLAAVAGTSTC 327
                  +++ +  +      R+D S +  D      + N  + +     L+  AG    
Sbjct: 802 QMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLKEFNAPNSEYFCFLLSTRAGGLGL 861

Query: 328 HITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKS 387
           ++  +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  
Sbjct: 862 NLQTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERAMQ 918

Query: 388 KLDL 391
           KLD+
Sbjct: 919 KLDI 922

>TDEL0C04520 Chr3 (814803..818744) [3942 bp, 1313 aa] {ON} Anc_2.235
           YIL126W
          Length = 1313

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 105/242 (43%), Gaps = 29/242 (11%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIG--VEGSTEGWSRTFLSNT 228
            +K V  DLPD     +  K +G+Q++ L   + K   L +G   EG+T+G  +   +  
Sbjct: 683 LKKEVEKDLPDKVEKVIKCKLSGLQHQ-LYEQMLKHNALFVGAGTEGATKGGIKGLNNKI 741

Query: 229 GLPELIENE---FERIGGPGNNSRN-----FLSAGEY-----VSTLSKSSGEQLGLTESC 275
                I N    F+ + G  N +R      +  AG++     V    +++G ++ +    
Sbjct: 742 MQLRKICNHPFVFDEVEGVINPTRENSPLLYRVAGKFELLDRVLPKFRATGHRVLMFFQM 801

Query: 276 VVGSGLIDAYAGLIGTIAARIDESARTQD------DANGQDLQNAIGRLAAVAGTSTCHI 329
                +++ +  + G    R+D   +T+D      D N  +       L+  AG    ++
Sbjct: 802 TQVMDIMEDFLRMKGLKYMRLDGGTKTEDRTDMLKDFNAPNSDYFCFLLSTRAGGLGLNL 861

Query: 330 TLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKSKL 389
             +D  I  +  W P++D+ A+D      GQ     +L+ +ITT    EE+ ++ A  KL
Sbjct: 862 QTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-TVEEVILERATQKL 918

Query: 390 DL 391
           D+
Sbjct: 919 DI 920

>TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9
           YHL032C
          Length = 698

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 22/108 (20%)

Query: 417 GLFLYGDYHGNRSPIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMN- 475
           G+     + G  +P  DP  RA+I+G S  TT   +A    AA E +  Q R I+  M+ 
Sbjct: 482 GVVFVPAFSGLFAPYWDPEARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSS 538

Query: 476 --------------EAGHSIRSIY----MSGGQCRNNILMELLADFTG 505
                          AG   +S+     + GG  R++ +M++ A+  G
Sbjct: 539 DALGTKDRDFLEEVSAGTYEKSLLSTLAVDGGMSRSDEVMQIQANILG 586

>Kwal_23.4777 s23 (860942..864847) [3906 bp, 1301 aa] {ON} YIL126W
           (STH1) - helicase related protein, snf2 homolog [contig
           5] FULL
          Length = 1301

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 105/242 (43%), Gaps = 29/242 (11%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIG--VEGSTEGWSRTFLSNT 228
            +K V  DLPD     +  K +G+Q++ L   + K   L  G   EG+T+G  +   +  
Sbjct: 684 LKKEVEKDLPDKVEKVVKCKLSGLQHQ-LYQQMLKHNALFFGAGTEGATKGGIKGLNNKI 742

Query: 229 GLPELIENE---FERIGGPGNNSRN-----FLSAGEY-----VSTLSKSSGEQLGLTESC 275
                I N    F+ + G  N SR      +  AG++     +    K +G ++ +    
Sbjct: 743 MQLRKICNHPFVFDEVEGIINPSRANSPLLYRVAGKFELLDRILLKFKVTGHRVLMFFQM 802

Query: 276 VVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR------LAAVAGTSTCHI 329
                +++ +  + G    R+D + +T+D      L NA         L+  AG    ++
Sbjct: 803 TQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLGLNL 862

Query: 330 TLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKSKL 389
             +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  KL
Sbjct: 863 QTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERALQKL 919

Query: 390 DL 391
           D+
Sbjct: 920 DI 921

>TDEL0D06490 Chr4 complement(1163375..1164838) [1464 bp, 487 aa]
           {ON} Anc_3.581 YGL253W
          Length = 487

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 10/103 (9%)

Query: 11  GKEKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGF-ITQSSEEIWD 69
           G EKG     ++ +D+G  ++R  +I   GD     D   S+  L      TQ+ EE+W 
Sbjct: 76  GTEKG----DYLAIDLGGTNLRVVLISLGGD--RTFDSTQSKYRLPDAMRTTQNHEELWA 129

Query: 70  SICFCVRKVIADA---KIPANKVIGIGFDATCSLAVVDKDTLE 109
            I  C+   I +     +  N  +G  F   CS + +++  L+
Sbjct: 130 FIADCLEAFIIEQFPDGVKGNLPLGFTFSYPCSQSKINEGFLQ 172

>Kpol_1039.15 s1039 (41383..45540) [4158 bp, 1385 aa] {ON}
           (41383..45540) [4158 nt, 1386 aa]
          Length = 1385

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 107/243 (44%), Gaps = 31/243 (12%)

Query: 175 FRKAVFFDLPDYLTF----KATGMQNRSLCSAVCKQGLLP-IGVEGSTEGWSRTFLSNTG 229
            +K V  DLPD +      K +G+Q++     +    L    G EG+T+G  +    N  
Sbjct: 733 LKKEVEKDLPDKIEKVVKCKLSGLQHQLYQQMLNHNALFVGAGTEGATKGGIKGL--NNK 790

Query: 230 LPEL--------IENEFERIGGP--GNNSRNFLSAGEY-----VSTLSKSSGEQLGLTES 274
           + +L        + +E E +  P  GN++  +  +G++     V    K+SG ++ +   
Sbjct: 791 IMQLRKICNHPFVFDEVEGVVNPTRGNSTLLYRVSGKFELLDRVLPKFKASGHRVLIFFQ 850

Query: 275 CVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR------LAAVAGTSTCH 328
                 +++ +  +      R+D + + +D  +   + NA         L+  AG    +
Sbjct: 851 MTQVMDIMEDFLRMRDLKYMRLDGATKAEDRTDMLKVFNAPNSDYFCFLLSTRAGGLGLN 910

Query: 329 ITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKSK 388
           +  +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  K
Sbjct: 911 LQTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERAMQK 967

Query: 389 LDL 391
           LD+
Sbjct: 968 LDI 970

>Suva_9.65 Chr9 (112765..116856) [4092 bp, 1363 aa] {ON} YIL126W
           (REAL)
          Length = 1363

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 106/244 (43%), Gaps = 33/244 (13%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIGVEGSTEGWSRTFLS--NT 228
            +K V  DLPD     +  K +G+Q + L   + K   L +G    TEG ++  +   N 
Sbjct: 698 LKKEVEKDLPDKVEKVIKCKLSGLQ-QQLYEQMLKHNALFVG--AGTEGATKCGIKGLNN 754

Query: 229 GLPEL--------IENEFERIGGP--GNNSRNFLSAGEY-----VSTLSKSSGEQLGLTE 273
            + +L        + +E E +  P  GN    +  AG++     V    K+SG ++ +  
Sbjct: 755 KIMQLRKICNHPFVFDEVEGVVNPSRGNGDLLYRVAGKFELLDRVLPKFKASGHRVLMFF 814

Query: 274 SCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR------LAAVAGTSTC 327
                  +++ +  +      R+D S +T++     +  NA         L+  AG    
Sbjct: 815 QMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPNSDYFCFLLSTRAGGLGL 874

Query: 328 HITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKS 387
           ++  +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  
Sbjct: 875 NLQTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERAMQ 931

Query: 388 KLDL 391
           KLD+
Sbjct: 932 KLDI 935

>KAFR0J01680 Chr10 complement(315123..319109) [3987 bp, 1328 aa]
           {ON} Anc_2.235 YIL126W
          Length = 1328

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 77/169 (45%), Gaps = 16/169 (9%)

Query: 236 NEFERIGGP--GNNSRNFLSAGEY-----VSTLSKSSGEQLGLTESCVVGSGLIDAYAGL 288
           +E E +  P  GN    +  AG++     V T  K++G ++ +         +++ +  +
Sbjct: 755 DEVEGVINPSRGNTDLLYRVAGKFELLDRVLTKFKATGHRVLMFFQMTQVMDIMEDFLRM 814

Query: 289 IGTIAARIDESARTQD------DANGQDLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVW 342
                 R+D S +T+D      D N  + +     L+  AG    ++  +D  I  +  W
Sbjct: 815 RNLKYMRLDGSTKTEDRTGMLKDFNAPNSEYFCFLLSTRAGGLGLNLQTADTVIIFDTDW 874

Query: 343 GPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKSKLDL 391
            P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  KLD+
Sbjct: 875 NPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERAMQKLDI 920

>KLTH0G09196g Chr7 (759594..763520) [3927 bp, 1308 aa] {ON} similar
           to uniprot|P32597 Saccharomyces cerevisiae YIL126W STH1
           helicase related protein snf2 homolog
          Length = 1308

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 108/244 (44%), Gaps = 33/244 (13%)

Query: 175 FRKAVFFDLPD----YLTFKATGMQNRSLCSAVCKQGLLPIG--VEGSTEGWSRTFLSNT 228
            +K V  DLPD     +  K +G+Q++ L   + K   L  G   EG+T+G  +    N 
Sbjct: 689 LKKEVEKDLPDKVEKVVKCKLSGLQHQ-LYQQMLKHNALFFGAGTEGATKGGIKGL--NN 745

Query: 229 GLPEL--------IENEFERIGGP--GNNSRNFLSAGEY-----VSTLSKSSGEQLGLTE 273
            + +L        + +E E I  P  GN+   +  AG++     +    K++G ++ +  
Sbjct: 746 KIMQLRKICNHPFVFDEVEGIINPTRGNSPLLYRVAGKFELLDRILPKFKATGHRVLMFF 805

Query: 274 SCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGR------LAAVAGTSTC 327
                  +++ +  +      R+D + +T++      L NA         L+  AG    
Sbjct: 806 QMTQVMDIMEDFLRMRDLKYLRLDGATKTEERTGMLKLFNAPDSEYFCFLLSTRAGGLGL 865

Query: 328 HITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKS 387
           ++  +D  I  +  W P++D+ A+D      GQ     +L+ +ITT  + EE+ ++ A  
Sbjct: 866 NLQTADTVIIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-LITTD-SVEEVILERALQ 922

Query: 388 KLDL 391
           KLD+
Sbjct: 923 KLDI 926

>KLTH0G06028g Chr7 complement(475975..477033) [1059 bp, 352 aa] {ON}
           similar to uniprot|P38768 Saccharomyces cerevisiae
           YHR034C PIH1 Protein of unresolved function may function
           in protein folding and/or rRNA processing interacts with
           a chaperone (Hsp82p) two chromatin remodeling factors
           (Rvb1p Rvb2p) and two rRNA processing factors (Rrp43p
           Nop58p)
          Length = 352

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 15/81 (18%)

Query: 346 KDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAKSKLDLFECLNEII------ 399
           ++IL +  WC E   SC   L   +   H A+ +L++K    ++   E L E +      
Sbjct: 121 REILVE--WCVE---SCELRLRAEISREHLAFPKLRLKG--DRIPPLEVLTEDLAADFRK 173

Query: 400 --RDLAEQKGTCTILELTKGL 418
             ++LAE +   T+LEL +GL
Sbjct: 174 EAQELAEVRDPATLLELRRGL 194

>KLTH0C09768g Chr3 complement(808196..809476) [1281 bp, 426 aa] {ON}
           highly similar to uniprot|Q12109 Saccharomyces
           cerevisiae YOL097C WRS1 Cytoplasmic tryptophanyl-tRNA
           synthetase aminoacylates tryptophanyl-tRNA
          Length = 426

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 118 SKNDQNIIMWMDHRASQETDEINSI-YDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFR 176
           S  +QNI  W    A  E  +   I YD  +K  G K   E  + + + +  H P    R
Sbjct: 18  SVKEQNITPWDVEGAVDENGQSQDIDYDKLIKQFGTKAVGEETLQRFEQVTGHKPHHFLR 77

Query: 177 KAVFFDLPDY 186
           K +FF   D+
Sbjct: 78  KGLFFSERDF 87

>NDAI0I01790 Chr9 complement(421537..422880) [1344 bp, 447 aa] {ON}
           Anc_6.99
          Length = 447

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 13  EKGGDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFI-----TQSSEEI 67
           +KG D  ++IG   GT  + A   +RK +    V+  +   E++ G+I     T+S+ E 
Sbjct: 360 QKGNDGSYYIGSCAGTNDINAWSDERKTNTRRYVEAQLDAFEMRGGWIIWCYKTESAIE- 418

Query: 68  WDSICFCVRKVIADAKIP 85
           WD     V+K+I D   P
Sbjct: 419 WD-----VQKLIFDGLFP 431

>Skud_9.41 Chr9 (95085..99164) [4080 bp, 1359 aa] {ON} YIL126W
           (REAL)
          Length = 1359

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 90/201 (44%), Gaps = 26/201 (12%)

Query: 212 GVEGSTEGWSRTFLSNTGLPEL--------IENEFERIGGP--GNNSRNFLSAGEY---- 257
           G EG+T+G  +    N  + +L        + +E E +  P  GN+   +  AG++    
Sbjct: 740 GTEGATKGGIKGL--NNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLYRVAGKFELLD 797

Query: 258 -VSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIG 316
            V    K+SG ++ +         +++ +  +      R+D S +T++     +  NA G
Sbjct: 798 RVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPG 857

Query: 317 R------LAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHV 370
                  L+  AG    ++  +D  +  +  W P++D+ A+D      GQ     +L+ +
Sbjct: 858 SDYFCFLLSTRAGGLGLNLQTADTVVIFDTDWNPHQDLQAQDR-AHRIGQKNEVRILR-L 915

Query: 371 ITTHPAYEELKIKAAKSKLDL 391
           ITT  + EE+ ++ A  KLD+
Sbjct: 916 ITTD-SVEEVILERAMQKLDI 935

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,935,087
Number of extensions: 2757215
Number of successful extensions: 6165
Number of sequences better than 10.0: 68
Number of HSP's gapped: 6192
Number of HSP's successfully gapped: 84
Length of query: 605
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 490
Effective length of database: 40,294,809
Effective search space: 19744456410
Effective search space used: 19744456410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)