Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B055508.261ON55555527920.0
YLR088W (GAA1)8.261ON61458516980.0
Smik_12.1478.261ON61358416880.0
Suva_10.1728.261ON61458516600.0
Skud_12.1568.261ON61258316450.0
NCAS0B038608.261ON58355016060.0
NDAI0J013908.261ON58355315800.0
CAGL0L12232g8.261ON59155515590.0
SAKL0H17050g8.261ON58455015530.0
TDEL0F038808.261ON57955015470.0
TBLA0F030808.261ON58355215360.0
KNAG0H032508.261ON58555615260.0
Ecym_43098.261ON57755215130.0
AGR087C8.261ON57756115120.0
Kpol_543.378.261ON57854915040.0
KLTH0G13706g8.261ON58455215010.0
ZYRO0C01672g8.261ON56955114970.0
TPHA0A018208.261ON58154714860.0
Kwal_56.238048.261ON57854914800.0
KLLA0F19118g8.261ON57856714520.0
SAKL0A04114g6.228ON46593780.59
TBLA0F025506.124ON52283751.4
KLTH0H03850g6.228ON46894751.5
ZYRO0E07150g6.228ON44993741.9
TPHA0E027706.228ON450105741.9
Kwal_26.71547.86ON121344742.3
KAFR0A028408.843ON520108714.6
SAKL0D01386g8.843ON521130706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05550
         (555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...  1080   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   658   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   654   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   644   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   638   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   623   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   613   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   605   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   602   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   600   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   596   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   592   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   587   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   587   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   583   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   582   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   581   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   577   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   574   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   563   0.0  
SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly...    35   0.59 
TBLA0F02550 Chr6 complement(619583..621151) [1569 bp, 522 aa] {O...    33   1.4  
KLTH0H03850g Chr8 (352972..354378) [1407 bp, 468 aa] {ON} simila...    33   1.5  
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    33   1.9  
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    33   1.9  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    33   2.3  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...    32   4.6  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    32   6.9  

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/555 (95%), Positives = 530/555 (95%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           MGLVERVKRQVAVMGLVPKLKKYLPLFSK             PIDGQYRNTYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNSTIYGIF 120
           SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNSTIYGIF
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNSTIYGIF 120

Query: 121 HSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSEDTGAS 180
           HSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSEDTGAS
Sbjct: 121 HSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSEDTGAS 180

Query: 181 LRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNIAVSI 240
           LRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNIAVSI
Sbjct: 181 LRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNIAVSI 240

Query: 241 TEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRIQALT 300
           TEHEGMKVSLHGLP            FKMLLRSIKDSSLAGIKKPHGNEAFSGWRIQALT
Sbjct: 241 TEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRIQALT 300

Query: 301 LKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPAAVGL 360
           LKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPAAVGL
Sbjct: 301 LKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPAAVGL 360

Query: 361 SLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVMLMFI 420
           SLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVMLMFI
Sbjct: 361 SLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVMLMFI 420

Query: 421 CILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVLAFPM 480
           CILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVLAFPM
Sbjct: 421 CILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVLAFPM 480

Query: 481 TLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNC 540
           TLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNC
Sbjct: 481 TLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNC 540

Query: 541 WTWFFSHLAGYHAGL 555
           WTWFFSHLAGYHAGL
Sbjct: 541 WTWFFSHLAGYHAGL 555

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/585 (57%), Positives = 413/585 (70%), Gaps = 44/585 (7%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+E++ R++  MGLVP++   LP+ S              P+DGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRE+EWNILRGYR+Q++ MV++   ERN++M +WL + G KT  + N     T+
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+ H+PRGDGTEA+VLA+PW NS+ +FN GGAALGVSLARFF RWP+WSKNIIVVFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
             A+LRSWVEAYHTSLDLTGGSIEAAV+LDY+S  DFF+YVEI YDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+SITEHEGMKVSLHGLP             K+L   I+D +L+G+KKPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           Q++TLKA G  G DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV LS+AFA SSL  F+N+   +I   S Y L A++VWF+S+  SF  +  +L      +
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 417 LMFICILFSFIPLI-SRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           LM I +   F+PLI SR + ++E    +++R+K  AF YFSLV TSLLMINF +AL IG 
Sbjct: 421 LMTISMASCFLPLILSRKIHISE---PLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 476 LAFPMTLVK-----------------------------ISNTLPTS-------SQALKNS 499
           LAFPMT VK                             + N + T+        Q LKN 
Sbjct: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNL 537

Query: 500 MLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544
           +LL+++NP+ISI  F   FD E  G   +++L+ AW D+ CW+WF
Sbjct: 538 VLLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWF 582

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/584 (57%), Positives = 411/584 (70%), Gaps = 43/584 (7%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+E++ R++  MGLVP++   LP+ S              P+DGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRE+EWNILRGYR+Q+E MV++   ERN+IM +WL + G KT  + N     T+
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+ H+PRGDGTEA+VLA+PW NS+ +FN GGAALGVSLARFF RWP+WSKNII+VFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
             A+LRSWVEAYHTSLDLTGGSIEAAV++DY+S  DFF+YVEI YDGLNGELPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+SITEHEGMKVSLHGLP             K+L   I+D +LAG+K PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           Q++TLKA G  G DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV LS+AFA SSL  F+N+   SI   S Y L A++VWF+S+  SF  +  +L      +
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 417 LMFICILFSFIPLI-SRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           LM I ++  F+PLI S+ + ++E    +++R+K  AF YFSLVLTSLLMINF +AL IG 
Sbjct: 421 LMAISMISCFLPLILSKKVHISEP---LSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477

Query: 476 LAFPMTLVKI--------------------------------SNTLPTSSQALKNSMLLL 503
           LAFPMTLVK                                  + +P  SQ  +    LL
Sbjct: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLL 537

Query: 504 V---SNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544
           +   +NP+ISI  F + FD E  G   +++L+ AW D+ CW+WF
Sbjct: 538 LLVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWF 581

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/585 (56%), Positives = 410/585 (70%), Gaps = 44/585 (7%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+E++ R+V  MGLVP++   LP+ S              P+DGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRETEWNILRGYR+Q+E  V++  TERN++M +WL + G KT  + N     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+ H+PRGDGTEA+VLAIPW NSE +FN GGA+LGVSLARFF RWP+WSKNIIVVFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
             A+LRSWVEAYHTSLDLTGGSIEAAV+LDY+S  DFF+YVE+ YDGLNGELPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+SI EHEGMKVSLHGLP             K+L   I+D +L+G+K PHGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           Q++TLKA G GG DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV LS+AFA SSL  F+N++  SI   S Y L A++VWF+++  SF  +  +L      +
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 417 LMFICILFSFIPL-ISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           LM I +   F+P+ +S  + ++E    +++R+K  AF YFSLV TSLLMINF +AL IG 
Sbjct: 421 LMTISLAICFLPIALSGKVHISE---PLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 476 LAFPMTLVKI--------------SN----TLPTSSQAL----------KNSM------- 500
           LAFPMT +K               SN    T P     L          KN         
Sbjct: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNL 537

Query: 501 -LLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544
            LL+++NP+ISI  F  +FD E  G   +++L+ AW D+ CW+WF
Sbjct: 538 LLLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWF 582

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/583 (56%), Positives = 411/583 (70%), Gaps = 42/583 (7%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+E++ R++  MGLVP++   LP+ S              P+DGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRE+EWN+LRGYR+Q+E M ++  +ERN+ M +WL + G KT  + +     T+
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+ H+PRGDGTEA+VLAIPW NS+ +FN GGAALGVSLARFF RWP+WSKNIIVVFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
             A+LRSWVEAYHTSLDLTGGSIEAAV+LDY+S  DFF+YVEI YDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+SITEHEGMKVSLHGLP             K+L   I+D +L+G+K PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           Q++TLKA G GG DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV  S+AFA SSL  F+N+   SI   S Y L A++VWF+S+  SF  +  +L      +
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 417 LMFICILFSFIPLI-SRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           LM I +   F+PL+ S  + ++E    +++R+K  AF YFSLV TSLLMINF +AL IG 
Sbjct: 421 LMTISLATCFLPLVLSEKVHISE---PLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477

Query: 476 LAFPMTLV---------------KISNTLPTSS-------------------QALKNSML 501
           LAFPMT +               K   ++ T S                   Q LKN +L
Sbjct: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLL 537

Query: 502 LLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544
           L+++NP+ISI  F+ +FD+E  G   +++LI AW D+ CW WF
Sbjct: 538 LVLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWF 580

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/550 (57%), Positives = 409/550 (74%), Gaps = 9/550 (1%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           MGL ERV+RQV   GL+PK+   LPL S              P +GQYRNTYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNN----STI 116
           SQAYSYFRE+EWNI+RGYR+Q+  + +    ERN IM  WL   G KTD + N     T+
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+FH+PRGDGTE++VLAIPW N++G+FN  GAALGV+LAR+F RWP+WSKNIIVVF+E+
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
             A+LRSWVEAYHTSLDLTGGSIEAA++LD+A E D FDY+EI+YDGLNGELPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
            V   EHEGMKVSLHG P             K+L+ SIK+S+L+G+KK +GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 297 QALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLP 355
           Q++TL+A G+ G  D+T+FGR+PEAMFRSINNLLEKFHQSFF+YL+LAPR+FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 356 AAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPV 415
           + V +S+ FA +SL  + N+   ++PF S YTL +I+ WF+S+  +F  +  ++   FP 
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 416 MLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           +L+ + I+    P I +G   A  K  +++R+++ AF + SL+LTSLLM+NFPLA  +G+
Sbjct: 421 ILLAVNIIICLYPAILKG--NAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGL 478

Query: 476 LAFPMTLVK-ISNTLPTSSQA-LKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIP 533
           L+FPMT VK I++  PT S+  +KNS+LLLVSNP+I+   FS + D+E +GL   +RL+ 
Sbjct: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538

Query: 534 AWNDMNCWTW 543
           A  ++ CWTW
Sbjct: 539 ASRELGCWTW 548

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/553 (55%), Positives = 399/553 (72%), Gaps = 12/553 (2%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           MGL+ERV+R +   GL+PK+   LP  S              P+DGQYRNTYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT---DTHNNSTIY 117
           SQAYSYFRETEWNI+RGYR ++ +M +    ERN IME+WLN+ G KT   +  +N  +Y
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDNEVLY 120

Query: 118 GIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSEDT 177
           G+FH+PRGDGTEAIVLA+PW N +G+FNT GAA+GV+LAR+F RWP+WSKNIIVVFSE+ 
Sbjct: 121 GVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSENP 180

Query: 178 GASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNIA 237
            ++LRSWVEAY+TSLDLTGGSIEAA++LD   E+D+FDY+E++YDGLNGELPNLDLVNI 
Sbjct: 181 DSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNIG 240

Query: 238 VSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRIQ 297
           + I EHEGM+VSLHG P             K+L+ SI+ S+ +G+ K HGNEAFSGWRIQ
Sbjct: 241 IYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRIQ 300

Query: 298 ALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           ++TLK  G  G +DIT FGR+PEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 301 SITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV LS+AF  + +  ++N+   ++PF S+YTL   IVW  ++T   CF +  L    P+ 
Sbjct: 361 AVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVW--TVTLVACFILAQLFLILPIP 418

Query: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVL 476
            + + I                 K  V++R+++FAF + SL+LTSLLM+NFPL+  IG++
Sbjct: 419 SLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLM 478

Query: 477 AFPMTLVKISNTLPTSSQ-ALKNSMLLLVSNPYISICAFSNIFDSE----LTGLATLDRL 531
           AFPMT V+ S T  T+ Q  L+N +LL++SNP+I++  ++N+  +     L GL  ++RL
Sbjct: 479 AFPMTKVR-SITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537

Query: 532 IPAWNDMNCWTWF 544
           I AW DM CWTWF
Sbjct: 538 ISAWKDMRCWTWF 550

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/555 (54%), Positives = 398/555 (71%), Gaps = 11/555 (1%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+++V R+++  G + KL + LP  S              P+DGQYR TYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNN----STI 116
           SQAYSYFRETEWNILRGYR+Q+E +    + +RN+++  WL + G KT  + +     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+ H+ RGDGTEA+VLAIPW N + QFN GGAALGVSL++FF RWP+WSKNIIVVFSED
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
           +GA+LR+WV+AYHTSLDLT GSIEAAV+LDY S+SDFF+YVEI YDGLNGELPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           AVSITEHEGMKVSLHGLP             K++   IK+ +L+G+K+ HGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 297 QALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLP 355
           Q++TL+A G EG +DIT FGRIPEAMFRS+NNLLEKFHQS+F+YLLLAPRNFVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 356 AAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPV 415
           +AV +S+AFA  SL   +N++  SIPF S  TL   I+   S+  SF  +   +      
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 416 MLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
            L+F  +  +F+PL+     +      VA+R+K+    Y+SL+LTSLLM+NF L   IG+
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 476 LAFPMTLVKISNTLPTSSQA----LKNSMLLLVSNPYISICAFSNIFDSELTGLATL--D 529
           LAFP+T + + +T   + ++    LKN+ +L ++NP+IS+  F+   D++  G  ++  +
Sbjct: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540

Query: 530 RLIPAWNDMNCWTWF 544
           R+I +W+ + CWTWF
Sbjct: 541 RMITSWDTLGCWTWF 555

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/550 (56%), Positives = 389/550 (70%), Gaps = 11/550 (2%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXX-XXXXXPIDGQYRNTYISENALM 59
           M LVE++ R+   MGL+PK    LP  S               P DGQ+R TYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----T 115
           PSQAYSYFRETEWN+LRGYRTQ+E        ERN+ + +WL   GAKT  + N     T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175
           +YGI H+PRGDGTEA+VLA PW+NSE Q+NTGG AL VSL+RFF RWP+WSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235
           D  A+LRSWVEAYHTSLDLTGGSIEAAV++D+   +DFF YVEIH+DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 236 IAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295
           +AV ITEHEGMKVSLHG+              K ++  +K+ +L+GIKK HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 296 IQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354
           I ++TLKACG +G  DITTFGRIPEA+FRS+NNLLEKFHQSFF+YLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414
           PAAV LS++FA +SL   +N+   S+P +S+Y + A++ + +++  SF  A  +L    P
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 415 VMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIG 474
            +L+ + +L   +P+I       + +   ++R+K+FA+ YFS+VLTSLL++NF LA  +G
Sbjct: 421 ELLLSLNVLLLLMPII---FTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477

Query: 475 VLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPA 534
            LAFPMTLV+   T       LKN +LLL+SNP+I+I  F+   D EL G+     L  A
Sbjct: 478 CLAFPMTLVR--TTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535

Query: 535 WNDMNCWTWF 544
           W D+ CWTWF
Sbjct: 536 WKDLGCWTWF 545

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/550 (54%), Positives = 392/550 (71%), Gaps = 10/550 (1%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+ ++ R+V  +GLVPK+   LPL S              P++G+YR TYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT----DTHNNSTI 116
           SQAYSYFRETEWN LRGYRTQ+E + +    ERN+ +  WL + G KT    D  +  T+
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+ H+ RGDGTEA++LA PW N++G  N  G ++G++L RFF RWP+WSKNIIVV SE+
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
              S+RSWVEAYHTSLDLTGGSIEAAV+LDY   +D+FD+VEIHYDGLNGE PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+SITEHEGMKVSLHG+               ++L  IK+++L+G++K +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 297 QALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLP 355
           QA+TLKA G EG  D+TTFGRIPEAMFRSINNLLEKFHQSFF+Y+LLAPR FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 356 AAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPV 415
            AV LS++FA +SL   +N+N   +P  S+Y L ++ +W +S+   F  A  +L++  P 
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 416 MLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           +L+    L SF+PL+ +   +AE    +A+R+K+ AF +FSLVLTSLLM+NF LA  +G+
Sbjct: 421 ILISFSALISFLPLLLKK-KIAE---PLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGL 476

Query: 476 LAFPMTLVKISNTLPTSSQ-ALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPA 534
            AFPMTLV+ S+    S +  LKNS+LLL+SNP+I+   F   F+ +L G         A
Sbjct: 477 TAFPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATA 536

Query: 535 WNDMNCWTWF 544
           W ++ CWTWF
Sbjct: 537 WKELGCWTWF 546

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/552 (55%), Positives = 396/552 (71%), Gaps = 11/552 (1%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+  + R+V  MGLVPK+ K LPL S              P+DGQYR+TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRE+EWNILRGYRT+++    +P  +RN +M  WL + G KT  ++N     T+
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YGIF++PRGDGTEAIVLAIPW+N++G+FNTGGAALG++L+RFF RWPIWSKNIIVVFSE+
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
              +LRSWV+AYH SLDLTGGSIEAA+++DY S SDFFDYVEI+Y G+NGELPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+ ITEHEGM+VSLHGLP             + LL   KD+ L+GIK  HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 297 QALTLKAC---GEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSY 353
           QA+TLKA         DIT+FGRI EA FRS+NNLLEKFHQSFF+YL+LAP+ FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 354 LPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTF 413
           LP+AV  S+AFA SSL  ++N++  ++P  S Y L A +++ +SITFSF  A   L +T 
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 414 PVMLMFICILFSFIP-LISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALT 472
           P +L+   +  S +P L+     + E    +++R+K+ AF Y SLVLTSLL++NF LA  
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPE---PLSYRLKSIAFLYISLVLTSLLVLNFSLAFG 477

Query: 473 IGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLI 532
           IG+L F MT VK      +    ++N+M LL+SNP+ S+  F+ IFD ++ G+      I
Sbjct: 478 IGILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFI 537

Query: 533 PAWNDMNCWTWF 544
            +WN +NCWTWF
Sbjct: 538 HSWNTLNCWTWF 549

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/556 (56%), Positives = 397/556 (71%), Gaps = 16/556 (2%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           MGL E ++R+   +GL+PKL   LPL S              P++GQYRNTYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVE--NMVDLPLTERNDIMETWLNDIGAKTDTHNNS---- 114
           SQAYSYFRETEWNILRGYRT++E  N   +  ++R DI+  WLN+ GAKT  + N     
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 115 TIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFS 174
           T+YG+ H+PRGDGTEA+VL  PW+NSEG+FN GG+AL ++L+R+F RWP+WSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 175 EDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLV 234
           ++   +LRSWVEAYHTSLDLTGGSIEAAVILDY S +D+F+Y EIH++GLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 235 NIAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGW 294
           N+AV IT+HEGMKVSLHGLP             K+L   +KDS+LAG+KK HGNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 295 RIQALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354
           RIQA+TLKA GEG IDITTFGRIPEAMFRSINNLLEKFHQSFF+Y LL+P NFVSISSYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYL-KYTF 413
           P+AV LS+ FA +++   VN+   S   I +YTL A +   +S+  SF  A  +L   T 
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYASALHI-TYTLLAALASVISLLVSFLVAHWFLYSTTS 419

Query: 414 PVMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTI 473
           P+ L+   ++ +  PL+      A  +  V +RM+   + Y+SL+LTSLLM+NFPLA +I
Sbjct: 420 PLYLILGSVVLAVSPLVMSRSNNA-LREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSI 478

Query: 474 GVLAFPMTLVKISNTLPTSSQALK--NSMLLLVSNPYIS---ICAFSNIFDSELTGLATL 528
           G+  +PMTLVK  N    S  +LK  NS+LL++SNP+++   IC    + +SE   L   
Sbjct: 479 GLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTV--VENSEFPNLDVF 536

Query: 529 DRLIPAWNDMNCWTWF 544
             L  AW D+NCWTWF
Sbjct: 537 AALFSAWKDLNCWTWF 552

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 386/552 (69%), Gaps = 14/552 (2%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXX-XXXXXPIDGQYRNTYISENALM 59
           M ++E++ R++  MGLVP++   LP  S               P++GQYR TYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----T 115
           PSQAYSYFRE+EWNILRGYR ++EN+ DL + ERN I+ +W+ + GAKT  + N+    T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175
           +YGI H+ RGDGTEA+VLA PW  ++G +N GGAAL +SLAR+F RWP+WSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235
           D  ASLR+WV+AYHT LDLTGGSIE+AV+LDY   +D+F Y+EI Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 236 IAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295
            AV I+EHEGMKVSLHG+P             K LL  IKD +LAGIK   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 296 IQALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354
           IQ++TLKA G+ G  D+TTFGR+PEA+FRS+NNLLEKFHQSFF+YLLL+PR+FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414
           PAA+ LS +FA +S    +N+    +P +S Y + A+  + +++  SF  A  +     P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 415 VMLMFICILFSFIPLISRGLPLAETKIT--VAHRMKAFAFGYFSLVLTSLLMINFPLALT 472
            +L+   +  SFI        + + KI    ++R KAFA  YFS+VLTSLL++NF LAL 
Sbjct: 421 SLLLAFNVALSFI-----SFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALA 475

Query: 473 IGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLI 532
           +GVLAFPM+L K + T  T  Q L+NS+LL+ SNP+I+      +F+++L G +    LI
Sbjct: 476 VGVLAFPMSLTK-TTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLI 534

Query: 533 PAWNDMNCWTWF 544
            AW  + CWTW+
Sbjct: 535 DAWTQLGCWTWY 546

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/561 (53%), Positives = 393/561 (70%), Gaps = 14/561 (2%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXX-XXXXXPIDGQYRNTYISENALM 59
           M ++E++ R+V  MGLVPK+   L   S               P++GQYR TYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNN----ST 115
           PSQAYSYFRE+EWNILRGYR++++ M  L   ERN I+ +W+ + GAK   +N+     T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175
           +Y + H+ RGDGTEA+VLA PW   EGQ+NTGG AL V++ R+F RWP+WSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235
           D  ASLRSWV+AYHT LDLTGGSIEAA++LDY   +D+F +VEI Y+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 236 IAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295
           +AV ITEHEGMKV+LHG P             ++LL+ IKD +L+GIK+  GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 296 IQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354
           IQ++TLKA G  G  DITTFGR+PEAMFRS+NNLLEKFHQSFF+YLLLAPR FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414
           PAAVGLS++FA  +    +N+   S+P IS Y + A++ + +++  S   A  +     P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 415 VMLMFICILFSFIPLISRGLPLAETKIT--VAHRMKAFAFGYFSLVLTSLLMINFPLALT 472
            +L+   ++ SF+P       L + KI    +HR KA A+ YFS VL+SLL++NF LA  
Sbjct: 421 ALLLAFNVVVSFMP-----FALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFM 475

Query: 473 IGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLI 532
           +G+LAFPMT V+ +    +  Q +KNS+LLL+SNP+ISIC F ++F+ ELTG +    LI
Sbjct: 476 VGLLAFPMTFVR-TTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLI 534

Query: 533 PAWNDMNCWTWFFSHLAGYHA 553
            AWND+ CWTW+   L  Y A
Sbjct: 535 DAWNDLGCWTWYVLCLGWYPA 555

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/549 (53%), Positives = 388/549 (70%), Gaps = 9/549 (1%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M ++E ++R++   GL+PK    LP  S              P+DGQ+R TYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRETEWNILRGYR ++E +      ERN IM +WL + G KT  + N     ++
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+F++PRGDGTE++VLA+PW+N+E +FN  GAALGVSLARF  RWP+WSKNIIVVFSE+
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
              +LRSWVEAYHTSLDLTGGSIEAAV+LDY   SD+F+Y+E+HY+G NG LPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+SI EHEG+KVSLHGL              KM+    K+ +L G+++ +GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           QALTLKA G+   D+TTFGR+ EAMFRSINNLLEKFHQSFF+Y LLAPR FVSI SYLPA
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV LS++FA +S+  FVN+   S+   S Y L + I W +S+   F    ++  Y  P++
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 417 LMFICILFSFIPLIS-RGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475
           L+   ++ S IPL + + L ++E    +A+R+K  +F Y SLV+TSLL++NFPLA  +G+
Sbjct: 421 LLLGNVVISTIPLAAPKNLSISE---PLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477

Query: 476 LAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAW 535
            A+PMTLV ++NT     +  +NS+LL +SNP+I+   F  I +S+L G+  +  L+ AW
Sbjct: 478 FAYPMTLVMLNNTDNLRLKT-RNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAW 536

Query: 536 NDMNCWTWF 544
           N +  WTWF
Sbjct: 537 NKLGSWTWF 545

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/552 (52%), Positives = 388/552 (70%), Gaps = 18/552 (3%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXX-XXXXXPIDGQYRNTYISENALM 59
           M L+E+++R++  +GL+P++ ++LP  S               P++GQYR+TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT-----DTHNNS 114
           PSQAYSYFRETEWNILRGYRTQ++ + +    ERN+++ +W  + GAKT     D H N 
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGN- 119

Query: 115 TIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFS 174
           T+YG+ H+PRGDGTEA+VLA PW+N +G++N GGAAL  +L+RFF RWP+WSKNII+VFS
Sbjct: 120 TMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFS 179

Query: 175 EDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLV 234
           +D  ASLRSWV AYHTSLDLTGGSIE+AV+LDY   +DFF YVEI+Y GLNGELPNLDLV
Sbjct: 180 DDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLV 239

Query: 235 NIAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGW 294
           N+AV ITEHEGMKVSL+G+              K ++  +K  +L+G++  +GNEAFSGW
Sbjct: 240 NVAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGW 299

Query: 295 RIQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSY 353
           RIQA+ L+A G +G  DITTFGRIPEA FRS+NNLLEKFHQSFF+YLLLAPR FVSI+SY
Sbjct: 300 RIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359

Query: 354 LPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTF 413
           LPAAV  S++F  ++L   +     + P  S + L A+I + +++  SF  +I +  + +
Sbjct: 360 LPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQY 419

Query: 414 PVMLMFICILFSFIPLISRGLPLAETKITVAH--RMKAFAFGYFSLVLTSLLMINFPLAL 471
             +L+    + + +P I          I  +H  + K+ AF Y S+VLTSLL+INF LA 
Sbjct: 420 SSLLISCNAVIAVLPAI-----FGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAF 474

Query: 472 TIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRL 531
            IG+LAFP+ LVK      TS Q +KN++LL++SNP+IS   F N F+ +L+GL    RL
Sbjct: 475 GIGLLAFPLILVKAPM---TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRL 531

Query: 532 IPAWNDMNCWTW 543
           + AW  + CWTW
Sbjct: 532 VQAWQKLGCWTW 543

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/551 (53%), Positives = 380/551 (68%), Gaps = 22/551 (3%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+E+++R+V  MGLVPK+   LPL S              PI+GQ+R TYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRE+EWNILRGYR+Q+E+  ++   ERN+ M  WL + GAKT  +NN     ++
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YGI H+ RGDGTEAI+LA+PW+N+EG  N GGA+LG+SL+RFF RWP+WSKNII+VFSE+
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
              +LRSWV+AYHTSLDLTGGSIEAA++LDY   +D+FDY EI Y GLNGELPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           AVSITEHEG+ VSLHG+              K+LL  I   + AG++   GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 297 QALTLKACGE--GGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354
           Q++T+KA G+  G  DITTFGRIPEAMFRSINNLLEKFHQS+F+Y+L+APR FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414
           PA V L+  FA +SL   + +   ++ F S Y L+A++ W +SI  SF F+  +L     
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 415 VMLMFICILFSFIPLIS-RGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTI 473
           ++L+   ++   +PL + R   + E    ++HR++ +AF Y SLV+TSL+M+NF LA  +
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITE---PLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVV 477

Query: 474 GVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIP 533
           G+LAFPMT V    +L       K   LL++SNP +S                 L +LI 
Sbjct: 478 GILAFPMTAVGTQRSL-----TFKKYALLIISNPLVSFFIVK-------PHPQLLQKLIS 525

Query: 534 AWNDMNCWTWF 544
           AW D+ CWTWF
Sbjct: 526 AWQDLGCWTWF 536

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/547 (50%), Positives = 390/547 (71%), Gaps = 4/547 (0%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXXXXXXXPIDGQYRNTYISENALMP 60
           M L+E + R+   +GL+PK+   L + S              P+DGQYR TYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116
           SQAYSYFRE+EWNILRGYRT +E ++D P   RN+++ +WL D G K   ++N+    T+
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176
           YG+++S RGDGTEAIVLA+PW+N++ + N GGAALG+SL+R+F RWPIWSKNII+V SE+
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236
              +++SWV+AYH SLDLTGGS+EAA++LD+ S+S++F++VE++++G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 237 AVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296
           A+S+ EHEG+KVSL GL              K LL  +K+S+L+G +K +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356
           QALTLKACG  G DITTFGRIPEA+FRS+NNLLEKFHQSFF+Y L+APR+FVSI SYLP+
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416
           AV LS++F  S+   ++N+   ++P   + ++ A+I++F SI  SF F      +  P +
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVL 476
           ++   +L SF+PL +   PL   +  +++R+K+FAF Y SLVLTSLL++NF LA  +G+L
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 477 AFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWN 536
           AFP+T  K  + + T    + N   L +SNP+I+I  F +IF+ ++T       LI ++ 
Sbjct: 481 AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK 540

Query: 537 DMNCWTW 543
            M  WTW
Sbjct: 541 YMGNWTW 547

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/549 (53%), Positives = 395/549 (71%), Gaps = 12/549 (2%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXX-XXXXXPIDGQYRNTYISENALM 59
           M L+ER++R+V  +GL+P++ ++LP  S               P++GQYR+TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT----DTHNNST 115
           PSQAYSYFRETEWNILRGYRTQ++ + +    ERN+I+ +WL + G KT    D    +T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175
           +YG+ H+PRGDGTEA+VL+ PW N +G+FN GG AL V+LAR+F RWP+WSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235
           D  ASLRSWV+AYHTSLDLTGGSIE+AV+LDY   +DFF YVEI+Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 236 IAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295
           +A+ +TEHEGMKVSL+G+P             K ++  IK  +L+G+++ +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 296 IQALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354
           IQA+ L+A G+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFF+YLLLAPR FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414
           PAAV  S++F  ++L   +     +        + A++ + +++ FSF  ++T+ ++  P
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 415 VMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIG 474
           V+L+   ++ +  P++   L     + + AHR+KA A+ Y S+VLTSLL++NF LA  IG
Sbjct: 421 VILISWSVMTALAPIL---LNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIG 477

Query: 475 VLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPA 534
           +LAFP+ LVK S    T     KNS+LLL+SNP+IS C F+  F+  L GL  L++L+ A
Sbjct: 478 LLAFPLILVKNST---TPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQA 534

Query: 535 WNDMNCWTW 543
           WN+  CWTW
Sbjct: 535 WNEFGCWTW 543

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/567 (51%), Positives = 390/567 (68%), Gaps = 20/567 (3%)

Query: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKXXXXXXXX-XXXXXPIDGQYRNTYISENALM 59
           M LVE++ R++  +GL+PK    L   S               P DGQ+R TYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLT-ERNDIMETWLNDIGAKT----DTHNNS 114
           PSQAYSYFRE+EWNILRGYRTQ++    +  T + N  +  WL + G KT    D     
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 115 TIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFS 174
           T+YGIFH+PRGDGTEA+V+A PW+N   ++NTGGAAL +SL RFF RWP+WSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 175 EDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLV 234
           ED  ASLRSWV AYHTSLDLTGGSIE+A++LDY   SD FDY+EIHYDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 235 NIAVSITEHEGMKVSLHGLPXXXXXXXXXXXXFKMLLRSIKDSSLAGIKKPHGNEAFSGW 294
           N+AV I EHEG+KVSLHGLP             K +L  IKDS L+GIK  +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 295 RIQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSY 353
           RIQ+LTLKA G +G  DITTFGR+PEA+ RS+NNLLEKFHQSFF+YLLLAPR F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 354 LPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTF 413
           L  AV +S+AF  ++L + +N+    +P +S Y + +I+ + +S+ F+F  +  ++ +  
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 414 PVMLMFICILFSFIPLISRGLPLAETKITV----AHRMKAFAFGYFSLVLTSLLMINFPL 469
           P +L+ +  +FS +PL+SR      T++ +    ++R KAFA+ Y ++VLTSLL++NF L
Sbjct: 421 PRVLLGLSGIFSVLPLLSR------TRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSL 474

Query: 470 ALTIGVLAFPMTLVKISNTLPTSSQ-ALKNSMLLLVSNPYISICAFSNIFDSELTGLATL 528
           A+ +G+LAFPMT  + +  + ++ + ++KN +LL++SNP+I+  A  N  +  L+G    
Sbjct: 475 AIVMGLLAFPMT--RTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVF 532

Query: 529 DRLIPAWNDMNCWTWFFSHLAGYHAGL 555
             LI A   + CWTW+   L  Y + L
Sbjct: 533 YALIEASQQLGCWTWYIICLGWYPSWL 559

>SAKL0A04114g Chr1 (386331..387728) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 465

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSL-VLTSLLMINFPLALTIGV 475
           LMF C+  +      R L  + T   +AH  K F   Y+ L  L      NFP  +++ +
Sbjct: 146 LMFDCLAIN-----GRSLLQSPTSSRLAHLCKDFFRPYYDLRSLYPDHCTNFPFKISVKL 200

Query: 476 LAFPMTLVKISNTLPTSSQALKNSMLLLVSNPY 508
           + F   LVK+++TL          +   V+ PY
Sbjct: 201 MHFSYDLVKVASTLDKLPHVSDGLIFTPVTTPY 233

>TBLA0F02550 Chr6 complement(619583..621151) [1569 bp, 522 aa] {ON}
           Anc_6.124 YBR227C
          Length = 522

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 289 EAFSGWRIQALTLKACGEGGIDITTFGRIPEAMFR-SINNLLEKFHQSFFYYLLLAPRN- 346
           E  +G ++ AL+L +     ID+ TFG IPE + R  I   LE  +    Y++L  P+N 
Sbjct: 349 ELSNGKKVSALSLTS----PIDLITFGLIPELIGRVPIVTALEPLNVKDLYHILKEPKNA 404

Query: 347 FVSISSYLPAAVGLSLAFACSSL 369
            +    Y+    G+ LA    +L
Sbjct: 405 LLHQYQYIFNQFGVQLAITQDAL 427

>KLTH0H03850g Chr8 (352972..354378) [1407 bp, 468 aa] {ON} similar
           to uniprot|Q01159 Saccharomyces cerevisiae YGL130W CEG1
           mRNA guanylyltransferase (mRNA capping enzyme), alpha
           subunit
          Length = 468

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSL-VLTSLLMINFPLALTIGV 475
           LMF C+  +      R +  + T   +AH  K F   Y+ L  L       FP  +++  
Sbjct: 145 LMFDCLAIN-----GRCIVQSPTSSRLAHLGKEFFKPYYDLRSLYPAQCATFPFKISMKH 199

Query: 476 LAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYI 509
           ++F + LVK++N+L          +   V+ PY+
Sbjct: 200 MSFSVDLVKVANSLDKLPHVSDGLIFTPVTTPYV 233

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 6/93 (6%)

Query: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLT-SLLMINFPLALTIGV 475
           LMF C+  +      R L  + T   +AH  K F   YF L L      + FP  +++  
Sbjct: 145 LMFDCLAIN-----GRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKH 199

Query: 476 LAFPMTLVKISNTLPTSSQALKNSMLLLVSNPY 508
           ++F   L+K++N+L          +   V  PY
Sbjct: 200 MSFSYDLLKVANSLEKLPHMSDGLIFTPVKTPY 232

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%), Gaps = 11/105 (10%)

Query: 406 ITYLKYTFPVMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSL-VLTSLLM 464
           +T L+Y     LMF C+  +      R L  + T   +AH  K F   YF +  +     
Sbjct: 138 LTELRY-----LMFDCLTMN-----GRNLTHSPTSSRLAHLGKEFYKPYFDMRSIFPDRC 187

Query: 465 INFPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYI 509
           INFP  +++  + F   LV +  TL          +   V+ PY+
Sbjct: 188 INFPFKISMKQMNFSYDLVNVYKTLDKLPHLSDGLIFTPVNTPYV 232

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 203  VILDYASESDFFDYVEIHYDGLNGELPNLDLVNIAVSITEHEGM 246
            ++LD+  + D++ Y+E    G +G +   DL+ +   +TEHE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 19/108 (17%)

Query: 405 AITYLKYTFPVMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLM 464
            I+  K T PV+L+F  +LF           +  T ++VA   ++    YF L L  + +
Sbjct: 370 GISIKKITAPVILLFSMVLFC----------VGTTLLSVAPVDQS----YFKLTLAGMAI 415

Query: 465 INFPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISIC 512
           +   L  +     FP   + +S+ LP   Q +  S+ L + N  +S+C
Sbjct: 416 LGVGLDTS-----FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLC 458

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 60/130 (46%), Gaps = 23/130 (17%)

Query: 400 FSFCFAITYLKYTFPVML---MFICILFSFIPLISRGLPLAETKITVAHRMKAFAFG--- 453
           + FCF +   +YT P+      F+ +++  I  IS G  +     ++   +   AF    
Sbjct: 338 YYFCFVLNLREYT-PLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGC 396

Query: 454 -----------YFSLVLTSLLMINFPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLL 502
                      YF ++L  +++++F + L+     FP + + +S+ LP  +Q +  S++ 
Sbjct: 397 IMLSVTPVDQTYFRMILGMMIILSFGMDLS-----FPASSIILSDELPMENQGMAGSLVS 451

Query: 503 LVSNPYISIC 512
            + N  +S+C
Sbjct: 452 TMINYSMSMC 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,318,384
Number of extensions: 2238766
Number of successful extensions: 7539
Number of sequences better than 10.0: 41
Number of HSP's gapped: 7664
Number of HSP's successfully gapped: 43
Length of query: 555
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 440
Effective length of database: 40,294,809
Effective search space: 17729715960
Effective search space used: 17729715960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)