Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B055408.262ON51951927080.0
TDEL0F038908.262ON47636710321e-135
NDAI0J013808.262ON62436410241e-132
NCAS0B038508.262ON5884939781e-125
Smik_4.3568.262ON5763648921e-113
YDR110W (FOB1)8.262ON5663648831e-112
SAKL0H17028g8.262ON5503668781e-111
Skud_4.3718.262ON5803648801e-111
ZYRO0C01650g8.262ON5863648741e-110
Suva_2.2708.262ON6323648741e-109
Kwal_56.237998.262ON4883688181e-103
KLTH0G13684g8.262ON5083717991e-100
Ecym_43088.262ON5294777841e-97
Kpol_392.68.262ON4573557712e-96
KLLA0F19140g8.262ON5273757632e-94
AGR086C8.262ON5343547581e-93
Kpol_543.388.262ON4423937422e-92
KNAG0H032408.262ON5193626986e-85
CAGL0B01771g8.262ON5363836962e-84
TBLA0E044308.262ON4813755884e-69
TPHA0A018108.262ON4573765221e-59
TPHA0J007408.262ON4083634822e-54
TBLA0F030708.262ON4453704746e-53
NDAI0G00600singletonON48874840.11
NDAI0G00550singletonON41277820.21
NDAI0B06160singletonON140377800.41
KAFR0C013303.107ON96060790.52
NDAI0D03010na 1ON778161761.3
KAFR0B06620singletonON1185131723.3
NCAS0A086703.107ON95978705.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05540
         (519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...  1047   0.0  
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   402   e-135
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   399   e-132
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   381   e-125
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   348   e-113
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   344   e-112
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   342   e-111
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   343   e-111
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   341   e-110
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   341   e-109
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   319   e-103
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   312   e-100
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   306   1e-97
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   301   2e-96
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   298   2e-94
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   296   1e-93
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   290   2e-92
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   273   6e-85
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   272   2e-84
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   231   4e-69
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   205   1e-59
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   190   2e-54
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   187   6e-53
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    37   0.11 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    36   0.21 
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            35   0.41 
KAFR0C01330 Chr3 complement(276359..279241) [2883 bp, 960 aa] {O...    35   0.52 
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    34   1.3  
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    32   3.3  
NCAS0A08670 Chr1 complement(1713724..1716603) [2880 bp, 959 aa] ...    32   5.5  

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score = 1047 bits (2708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/519 (97%), Positives = 505/519 (97%)

Query: 1   MTSTKMNENTRALGPEEKVAPVHNMIERDFASELIEAPENIVIKESYIVPRMGESYTSYT 60
           MTSTKMNENTRALGPEEKVAPVHNMIERDFASELIEAPENIVIKESYIVPRMGESYTSYT
Sbjct: 1   MTSTKMNENTRALGPEEKVAPVHNMIERDFASELIEAPENIVIKESYIVPRMGESYTSYT 60

Query: 61  DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPR 120
           DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPR
Sbjct: 61  DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPR 120

Query: 121 YLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYS 180
           YLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYS
Sbjct: 121 YLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYS 180

Query: 181 NITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEKK 240
           NITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEKK
Sbjct: 181 NITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEKK 240

Query: 241 YSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMFDIC 300
           YSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMFDIC
Sbjct: 241 YSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMFDIC 300

Query: 301 EKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHN 360
           EKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHN
Sbjct: 301 EKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHN 360

Query: 361 DRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGLIFLEVXXXXXXXXXX 420
           DRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGLIFLEV          
Sbjct: 361 DRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGLIFLEVDEPHDEPHDE 420

Query: 421 XXXXFQFEGDQSIDEEDMGAVMPPATEADAQDSMSLTEAYMTDGLPKPRVSKRLIDRQDT 480
               FQFEGDQSIDEEDMGAVMPPATEADAQDSMSLTEAYMTDGLPKPRVSKRLIDRQDT
Sbjct: 421 PYDEFQFEGDQSIDEEDMGAVMPPATEADAQDSMSLTEAYMTDGLPKPRVSKRLIDRQDT 480

Query: 481 SEISGPLTSYYEETHDSIISKKHKTDDYVEMESNSSMKL 519
           SEISGPLTSYYEETHDSIISKKHKTDDYVEMESNSSMKL
Sbjct: 481 SEISGPLTSYYEETHDSIISKKHKTDDYVEMESNSSMKL 519

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  402 bits (1032), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 261/367 (71%), Gaps = 1/367 (0%)

Query: 43  IKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTP 102
           +K  ++ P MGESY  Y +S+MN+ELL+RGE+++ K+Q+SING +    Y+LIRT+SLTP
Sbjct: 35  VKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTP 94

Query: 103 ETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLM 162
           ETLAS + KW K +AE +Y+FL RRYY +N G++ D  + DKIVCEP+ +FD+IM  HLM
Sbjct: 95  ETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLM 153

Query: 163 NNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLE 222
           N+H   + I+  L+  YSNITRD    A+++CS CNP+     LEK++H+NI+  L+PLE
Sbjct: 154 NDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLE 213

Query: 223 RVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQ 282
           RVHIEIFE F NE I  K++++LYCRDYH+R++W+ PLKNTKFKHLV  + +L L     
Sbjct: 214 RVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYV 273

Query: 283 PIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLL 342
           PIF+E+++LD QD+FDICE++  +Y++++GLG +  + FH  GI++MK  L   + +C+ 
Sbjct: 274 PIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCIS 333

Query: 343 SWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVD 402
            WN+CL+YG Y  N RHN  AGG+P DLL          F+ K   I++   +++V+ V+
Sbjct: 334 DWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVN 393

Query: 403 NGLIFLE 409
            GL++LE
Sbjct: 394 KGLLYLE 400

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  399 bits (1024), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 188/364 (51%), Positives = 252/364 (69%), Gaps = 3/364 (0%)

Query: 46  SYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETL 105
           SY++P +GESY  Y D  ++++LLKRGE     FQ+SI+G L E  Y+LIRT SLT ETL
Sbjct: 90  SYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL 149

Query: 106 ASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNH 165
           A+  P +    A  R    KRRY  DN G + D LR ++IVC+PV +++M+M CHLMN+H
Sbjct: 150 AANFPHFH---APTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDH 206

Query: 166 GFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVH 225
              ++ H +LS+ Y+NITRD   KA++FCSVCNP + +G L KFKH N Y  ++PLERVH
Sbjct: 207 AQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVH 266

Query: 226 IEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285
           IEIFEPF  +KIE KYSH++YCRDY SRYI + PLKNTKFK+LV  +A L  +  R PIF
Sbjct: 267 IEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIF 326

Query: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345
           IET SL+ QD FDI E I  +Y + +GLG      FH  G++QMK  LE HR+ECL  W 
Sbjct: 327 IETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWT 386

Query: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL 405
           +CLKYG +++N +HNDRA GVP DLL+  +++ + K  EK  QI+     ++++++ NG 
Sbjct: 387 MCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGS 446

Query: 406 IFLE 409
           I+LE
Sbjct: 447 IYLE 450

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  381 bits (978), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 206/493 (41%), Positives = 288/493 (58%), Gaps = 32/493 (6%)

Query: 46  SYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETL 105
            Y++P +GE Y  Y D  M+L  ++RGERE F+FQ++ING L E TY+LI+T+SLT ETL
Sbjct: 81  GYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETL 140

Query: 106 ASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNH 165
           ++T  K  K  A  R +FL RRY  D  G + D LR++++VCEPV+++DMIM  HL+N+H
Sbjct: 141 SATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDH 200

Query: 166 GFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVH 225
           G  +K H  L   YSNITR    +  +FCSVCNP ++    +K+KH N +  L+PLERV 
Sbjct: 201 GRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQ 260

Query: 226 IEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285
           +E+FEPFP EK+  KY  ILY RDY SR+IWM+PL+N+KF HLV  ++ +  S IR PIF
Sbjct: 261 VEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIF 320

Query: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345
            ET +++ QD FDI EKI  +Y + IGLGT         G+ Q++  L  H+EECL  W 
Sbjct: 321 FETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWI 380

Query: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL 405
           +CLKYG +  N + NDRA GVPGDLL+  I +   K  +KI QIL++  +E+++++  G 
Sbjct: 381 MCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGC 440

Query: 406 IFLEVXXXXXXXXXXXXXXFQFEGD-------QSIDEEDMGAVMPPATE-ADAQDSMSLT 457
           I+LE                  E D       +  DEED+GA+M P  +    +D +   
Sbjct: 441 IYLE-DRNPEDPEAEYEANTDDESDTEDNVEHRQEDEEDIGAMMSPMIDNTRTEDELENG 499

Query: 458 EAYMTDG-------------------LPKPRV--SKRLIDRQDTS--EISGPLTSYYEET 494
           E    D                     PK R   +K + + Q+T   EI+ P TSYY+  
Sbjct: 500 EKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLNNKNVTNTQETESPEITEPSTSYYQTY 559

Query: 495 HDSIISKKHKTDD 507
            ++      K DD
Sbjct: 560 QETTSQPTMKHDD 572

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  348 bits (892), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 246/364 (67%), Gaps = 2/364 (0%)

Query: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107
           I+P MGESYT Y DS++NLELL+RGERE   F +S+   LT++ Y+LI+T SLT +TL  
Sbjct: 49  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108

Query: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167
            + K+  + AE + LFL+R+YY D+ G + D    DKI CEP +++DM+M  HL+N H  
Sbjct: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227
            K +H  L ++++NI+  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228

Query: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287
           +FEPF  E IE KYS++L CRDY S ++W+LPLK+TKFKHL+P ++SLFLSF R PIF+ 
Sbjct: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288

Query: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347
           +++LD  D++DICE+IA +Y L+IGLG      FH  GI  +   L +++EECL  W  C
Sbjct: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348

Query: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405
           L+YG Y  N R N R    P  +L S+I   + KF+ K  +++EN  S ++ +     GL
Sbjct: 349 LRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGL 408

Query: 406 IFLE 409
           I+LE
Sbjct: 409 IYLE 412

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 167/364 (45%), Positives = 247/364 (67%), Gaps = 2/364 (0%)

Query: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107
           I+P MGESYT Y DS++NLELL+RGERE   F +S+   LT++ Y+LI+T SLT +TL  
Sbjct: 47  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106

Query: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167
            + K+  + AE + LFL+R+YY D+ G + D    DKI CEP +V+DM+M  HLMN H  
Sbjct: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166

Query: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227
            K +H  L + ++NI+  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226

Query: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287
           +FEPF  E IE KYS++L CRDY S ++W+LPLK+TKFKHL+P ++SLFL+F R PIF+ 
Sbjct: 227 VFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286

Query: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347
           +++LD  D++DICE+IA +Y L+IGLG      FH  GI  ++  L ++++ECL  W  C
Sbjct: 287 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKC 346

Query: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405
           L+YG Y  N R N R    P  +L S++   + KF+ K  +++EN  S ++ ++    GL
Sbjct: 347 LRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 406

Query: 406 IFLE 409
           I+LE
Sbjct: 407 IYLE 410

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  342 bits (878), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 167/366 (45%), Positives = 244/366 (66%), Gaps = 4/366 (1%)

Query: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106
           Y+ P++GES  +Y+   +N+ELL+RG R+  K+ +S+ G LT+  Y+LI+TD+LT ETL 
Sbjct: 26  YVTPKLGESQVTYSTD-LNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84

Query: 107 STNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHG 166
           +         AE +YLFLKRRYY D++ ++ DH R D IVCEP  ++++I+  HL+NNH 
Sbjct: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144

Query: 167 FVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHI 226
             +K+H  L + YSNITRD      ++CS CNP++++    KFKH N Y  L+PLER+H+
Sbjct: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204

Query: 227 EIFEPF-PNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285
           EIF+PF  +E IE+KYSH+LYCRDYHSR++W+ PL    F+ LVP +    LS  R PIF
Sbjct: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264

Query: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345
           +ET +LD QDMFD+CE IA +Y L IGLG +  + F+  GI +MK  L+ ++++C   W 
Sbjct: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324

Query: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESV--LRVDN 403
           +CLKYGSY +N  +N R  G   DLL +++  C  KFK K  +I+    + +V  L+   
Sbjct: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384

Query: 404 GLIFLE 409
           G++++E
Sbjct: 385 GMVYVE 390

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  343 bits (880), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 166/364 (45%), Positives = 244/364 (67%), Gaps = 2/364 (0%)

Query: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107
           I+P MGESYT+Y DS++NLELL+RGERE   F +S+   LT++ Y+LI+T SLT +TL  
Sbjct: 50  ILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109

Query: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167
            + K+  + AE + LFL+R+YY DN G + D    DKI CEP +++DM+M  HLMN H  
Sbjct: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169

Query: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227
            K +H  L + ++N +  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 229

Query: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287
           +FEPF    IE KY ++L CRDY S ++W+LPLK+TKFKHL+P ++SLFLSF R PIF+ 
Sbjct: 230 VFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 289

Query: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347
           +++LD  D++DICE+IA +Y L IGLG      FH  GI  ++  L +++EECL  W  C
Sbjct: 290 SSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 349

Query: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405
           L+YG Y  N R N R    P  +L S++   + KF+ K  +++EN  S ++ ++    GL
Sbjct: 350 LRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 409

Query: 406 IFLE 409
           I+LE
Sbjct: 410 IYLE 413

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  341 bits (874), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/364 (43%), Positives = 237/364 (65%), Gaps = 2/364 (0%)

Query: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106
           +IVP M + + S     MNL LL++G  E  +FQ ++ G LT++ Y+LIR+D+L+   L 
Sbjct: 38  FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE 97

Query: 107 STNPKWTKITAEPRYLFLKRRYY-RDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNH 165
             + KW   ++E  Y +L+ RY+  + NG++ D  R D+IVCEP  +F ++M  HL NNH
Sbjct: 98  RCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156

Query: 166 GFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVH 225
                IH +L   Y+NITRD  + A+ +CS CNP+ K    +K +H+N+Y EL+PLERVH
Sbjct: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVH 216

Query: 226 IEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285
           IE+FEPF  EKI+ ++SH+LY RDY SRY+W+LPL+N K KH++  M+S  L   R PIF
Sbjct: 217 IEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIF 276

Query: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345
           +E+ ++D + +FD+C +IA  Y L++GLG      FH  GI+ MK  L +H+EECL  WN
Sbjct: 277 LESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWN 336

Query: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL 405
           LCLKYG +  N   N  + G PGDLL + + +C+ KF +K   ++ +  S+ V+ +  G+
Sbjct: 337 LCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGV 396

Query: 406 IFLE 409
           +FLE
Sbjct: 397 LFLE 400

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 165/364 (45%), Positives = 244/364 (67%), Gaps = 2/364 (0%)

Query: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107
           I+P MGESYT Y DS++NLELL+RGERE   F +S+   LT++ Y+LI+T SLT ETL  
Sbjct: 100 ILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159

Query: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167
            + K+  + AE + LFL+R+YY DN G + D    DKI CEP +++DM+M  HLMN H  
Sbjct: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219

Query: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227
            K +H  L + ++N +  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279

Query: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287
           +FEP+  + IE KY ++L CRDY S ++W+LPLK+TKFKHL+P ++SLFLSF R PIF+ 
Sbjct: 280 VFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVT 339

Query: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347
           +++LD  D++DICE+IA +Y L+IGLG      FH  GI  ++  L +++EECL  W  C
Sbjct: 340 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 399

Query: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405
           L+YG Y  N R N R    P  +L S++   + KF+ K  +++EN  + ++  +    GL
Sbjct: 400 LRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGL 459

Query: 406 IFLE 409
           I+LE
Sbjct: 460 IYLE 463

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  319 bits (818), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/368 (41%), Positives = 234/368 (63%), Gaps = 7/368 (1%)

Query: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106
           + +P++GE+   Y +  +N ELL RG  +  K+Q+S+ G LT+E +DL+R+ +LT E L 
Sbjct: 19  FRMPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77

Query: 107 STNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHG 166
           ST+ K      E ++L LKRR+Y D +G + D    D +VCEP  +FD+IM  HL N H 
Sbjct: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137

Query: 167 FVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHI 226
             +++HH L   Y+N TR      +++CS CNPE+ +    KF+H NIY+ L+PLERVH+
Sbjct: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197

Query: 227 EIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFI 286
           EI  PFP + IE  YSH+LY RDY+SR++WM PL + +   +     +  LS  R PIF+
Sbjct: 198 EIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFV 256

Query: 287 ETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNL 346
           ET++L  QD+F++CE IA +Y L IGLG S+  TF   G+ +++  L+ + E CL SW++
Sbjct: 257 ETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHM 316

Query: 347 CLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDN--- 403
           CLK+G  +HN+ +N R  G+PG+LL S + +   +F+ K  +++E   + +V+ + N   
Sbjct: 317 CLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGR 376

Query: 404 --GLIFLE 409
             G+I+LE
Sbjct: 377 RRGMIYLE 384

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 238/371 (64%), Gaps = 7/371 (1%)

Query: 44  KESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPE 103
           K  + +P +GE    Y +  +NLELL+RG  +  K+Q+S+ G LT++ +DL+R+ SLT +
Sbjct: 16  KVEFDMPAVGEPIEKYHNG-LNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTED 74

Query: 104 TLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMN 163
            L +T+ K      E ++L LKRRYY D +G++ D+   D +VCEP  +FD+IM  HL N
Sbjct: 75  NLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKN 134

Query: 164 NHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLER 223
            H   +++H  L   Y+N TR      +K+CS CNPE+++   +KF+H NIY+ L+PLER
Sbjct: 135 GHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLER 194

Query: 224 VHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQP 283
           VH+EI  PF +E IE  YSH+L+ RDY+SR++WM PLK    + +   + +  L   R P
Sbjct: 195 VHVEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIP 253

Query: 284 IFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLS 343
           IFIET+++D QD+F+ CE +A +Y L IGLG S+ +TF   G+ +++  L+ + E+CL S
Sbjct: 254 IFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRS 313

Query: 344 WNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVD- 402
           W +CLKYG+ +HN+ +N R  GVPG+LL S + +   +F+ K   ++E   + +V+ +  
Sbjct: 314 WYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKV 373

Query: 403 ----NGLIFLE 409
                G+I+LE
Sbjct: 374 SGRRRGIIYLE 384

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  306 bits (784), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 176/477 (36%), Positives = 264/477 (55%), Gaps = 46/477 (9%)

Query: 42  VIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLT 101
           + +E + VPR   +        ++ + L  G  E+ K   ++ G LT++ Y+LI +++L+
Sbjct: 30  ITEEGFKVPRFDLNVYQLAPE-LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLS 88

Query: 102 PETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHL 161
            +TL     K T  T E +++ LKRRY     G + DH R+D  V EP  VFD+IM  HL
Sbjct: 89  TQTLLECCDKVTAGTVENKFVLLKRRY-SILQGNVVDHKREDLPVIEPDLVFDVIMAAHL 147

Query: 162 MNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPL 221
           +N H   +KIH  L   Y+N+TRD       +CS CN ++ + +  ++KH N+Y+++MPL
Sbjct: 148 INGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPL 207

Query: 222 ERVHIEIFEPFP---NEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLS 278
           ER H+EIF PF    NEKIE KYSH+LYCRDYHSR++WMLPL+   F+ LVP +  L  S
Sbjct: 208 ERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCS 267

Query: 279 FIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHRE 338
            IR PIF+ETA+LD QDMFD+CE IA +Y L+IGLG +    F   G+ ++K     H+E
Sbjct: 268 MIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKE 327

Query: 339 ECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESV 398
           +C+  WN+CL+      N  ++DR  G+P DLL ++I   + KFK K  +I++   +  V
Sbjct: 328 QCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHV 387

Query: 399 L--RVDNGLIFLEVXXXXXXXXXXXXXXFQFEGDQSIDEEDMGAVMPPATEADAQDSM-- 454
           +  R   G+I+LE               F  + D+   E D      P TE+ +++SM  
Sbjct: 388 VQFREAGGMIYLE----------DDNSAFVVDEDEHGPEND----NVPVTESPSKESMKS 433

Query: 455 ------SLTEAYMTDGLPKPRV------------SKRLIDRQDTS-----EISGPLT 488
                 +L E      +P  RV            SK+ I+++  +     E+S PL+
Sbjct: 434 SNNIADNLLEPNNNSSIPSKRVLPSEKSSIRKNGSKKKINKEKVTDKGKMELSSPLS 490

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  301 bits (771), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 149/355 (41%), Positives = 224/355 (63%), Gaps = 6/355 (1%)

Query: 60  TDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEP 119
           ++S +N EL  RG +++ KFQ +ING+L++  YDLI TD LTP+ ++    KW   + E 
Sbjct: 73  SESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE- 131

Query: 120 RYLFLKRRYYRDNNGL-IHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTF 178
           +Y FLK RYY  + G  + D    DKI+C P  V ++++  HL+N H   K +H +L   
Sbjct: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191

Query: 179 YSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEK-I 237
           Y+NI+R +   +L +CS CNP + +  L+K K   +Y  L+P ER+HIEIF+PF +EK I
Sbjct: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLI 251

Query: 238 EKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMF 297
           E  YSHILY RDY+SRY+W+ PLK T FK L  T+ + F +  + PI+IE+++++  D+ 
Sbjct: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311

Query: 298 DICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNI 357
            + +KIA +YDL+IG+G    + FH  G+  MK  L  H +ECL  W +CLKYG   HN 
Sbjct: 312 AMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNN 371

Query: 358 RHNDRAGGVPGD-LLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL--IFLE 409
             N +  G+P + LL+S I ECS+K+K K   +++     +++ +DNG   I+LE
Sbjct: 372 LKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLE 426

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  298 bits (763), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 221/375 (58%), Gaps = 14/375 (3%)

Query: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106
           +++P  G    S+    ++ ++L  G  ++ K   ++ G LT+  YDL+ +D+LT E L 
Sbjct: 57  FVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLL 115

Query: 107 STNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHG 166
             + K T  T E +++ LKRRYY   N L+HD  RKD +V EP  +FD+IM  H++N+H 
Sbjct: 116 RASDKVTNSTVENKFVLLKRRYYVQEN-LLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174

Query: 167 FVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHI 226
             K I++ LSTFY+N+T+  C     FCS CN        +KFKH NI+  L+PL R H+
Sbjct: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234

Query: 227 EIFEPFPNE----------KIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLF 276
           EIF PF +           KIE KY  +LYCRDY+SRY+W+ PLK+     L+P M  L 
Sbjct: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294

Query: 277 LSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAH 336
            S IR PIFI+T +LD QDMFD+CE IA  Y ++IGLG +   +F   GI++MK+    H
Sbjct: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354

Query: 337 REECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSE 396
           +EECL  WN+CLK      N  ++DR  GVP DLL S  Q+   KF+     ++   +  
Sbjct: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414

Query: 397 SVLRVD--NGLIFLE 409
            V++ +   G+I+LE
Sbjct: 415 HVVQFEEAGGMIYLE 429

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  296 bits (758), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 151/354 (42%), Positives = 223/354 (62%), Gaps = 6/354 (1%)

Query: 61  DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPR 120
           D  +  E + RG  E+ K  +++ G LT+E YDLI +D+L+ + L     K T  T E +
Sbjct: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENK 101

Query: 121 YLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYS 180
           Y+ LKRRY     G++ D  RKD  V EP  +FDMIM  HL+N+H   +K++  +   Y+
Sbjct: 102 YVLLKRRYVA-KGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYA 160

Query: 181 NITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEK- 239
           N+TR+L      +CS CN ++ + +  ++KH N++ +LMPLER H+E+F PF +E +EK 
Sbjct: 161 NVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI 220

Query: 240 --KYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMF 297
             KYSH LYCRDYHSR+IW+LPL+   F++L+P +A L  + IR PIF+ETA+LD QDMF
Sbjct: 221 QGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMF 280

Query: 298 DICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNI 357
           DICE IA  Y  +IGLG +    F   GI+++K  L  ++EEC   WN+CL+      N 
Sbjct: 281 DICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQ 340

Query: 358 RHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVL--RVDNGLIFLE 409
            + DR  G+P DLL ++I   S+KFK+K  +I++   +  V+  +   G+I+LE
Sbjct: 341 TYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLE 394

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  290 bits (742), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 149/393 (37%), Positives = 237/393 (60%), Gaps = 4/393 (1%)

Query: 20  APVHNMIERDFASELIEAPE-NIVIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFK 78
            P  N +  D  + + E  E N   K  +  P++G +   Y DS  ++  L+ G     +
Sbjct: 15  VPSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKE 74

Query: 79  FQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHD 138
           +  SI G L++  Y+LIR D L  +TL S   +W++I A  + L+LKRRY     G + D
Sbjct: 75  YLDSIIGTLSQTVYELIRDDLLDVDTL-SEKTRWSRINANAKCLYLKRRYKLTKKGTVID 133

Query: 139 HLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCN 198
             R++KIV EP   +D I+  H++N H   + IH  L   YSN++RD     L FCS CN
Sbjct: 134 LTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCN 193

Query: 199 PEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWML 258
           P++ I  LEK  H NIY + +PLERV ++IFEPF NEKI+ +YSHI+Y RDY SR++W+ 
Sbjct: 194 PDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIY 253

Query: 259 PLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKP 318
           PLKNTKFK L   +  L L   R PI+I+T +++ +DM  IC++IA +Y++ +G+GT +P
Sbjct: 254 PLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEP 313

Query: 319 NTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQEC 378
           ++F++ G+ ++K  L  ++++CL  WN+CLK GSY +N +    A GVP +L   +++  
Sbjct: 314 SSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECS 373

Query: 379 SLKFKEKIIQILENAVSESVLR--VDNGLIFLE 409
           +  F+ K  +I+ +   ++  +   + GL++ +
Sbjct: 374 ATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQ 406

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  273 bits (698), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107
           +VP +G+ +++Y D  +++E  KRGER++  +  +  G +++E Y L + D +T E +A 
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167
             P         + +++ RRYY+D NG+I D    ++IV +P++ FD+IM CHLMN H  
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227
            ++++  L  FY+N    L  + L++CSVCNP  K+    + K   ++ + +PLER+ IE
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY-LFEKALPLERITIE 213

Query: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287
           I EPFPNEK+E KYS+++  +D+  R+ W+ PLKNTKFK++VP +A + LSF R PI++E
Sbjct: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273

Query: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347
           + +LDW D+FDI E I  +Y ++IGLG +  ++   A  R +   L  H +ECL  +N C
Sbjct: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATAR-INRDLNDHHDECLFDFNNC 332

Query: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGLIF 407
           LKYG   +N          P D++S    +   KF+ K   IL+++ S  V+    G ++
Sbjct: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTLY 392

Query: 408 LE 409
           LE
Sbjct: 393 LE 394

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  272 bits (696), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 142/383 (37%), Positives = 220/383 (57%), Gaps = 20/383 (5%)

Query: 47  YIVPRMGESYTSY---TDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPE 103
           +++P + E+Y  Y    DS ++++ LKRGE+++ +F + + G LT+ETY L+  ++LT E
Sbjct: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119

Query: 104 TLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMN 163
           T+      W    AE +Y  L +R+Y+D  G I D    + IV EP  +F++I+  HL N
Sbjct: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179

Query: 164 NHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLER 223
            H     +   L   Y+N TRD    AL +C+ CNP++ I  +EK +HRNI  EL+PLER
Sbjct: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239

Query: 224 VHIEIFEPFPNE--------------KIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLV 269
           VHIE+F PF  E              KIE KYSH+ YCRD+ +RY+W  PLKN KFK LV
Sbjct: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299

Query: 270 PTMASLFLSFIRQ-PIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQ 328
             +A+ F++ +   PIF+E++++D  D+ +I E +A +Y L++GLG +    FHA GI++
Sbjct: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359

Query: 329 MKAKLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQ 388
            K  L   + EC   W +CLK G+Y  N     + G     L +  + +     ++K ++
Sbjct: 360 FKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLK 419

Query: 389 ILENAVSESVLRV--DNGLIFLE 409
            +E + SE++       G IF+E
Sbjct: 420 YIEQSFSENIKTYPKSGGCIFIE 442

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  231 bits (588), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 219/375 (58%), Gaps = 19/375 (5%)

Query: 52  MGESYTSYTD---SFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAST 108
           +G SYT Y D   S +N+ELL++G +++ ++       LT+E  D++ T +L+PE +   
Sbjct: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKY 94

Query: 109 NPKWTKIT-AEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167
           + K T  + A  +Y F  RRYY + +  I D  +  +I+CEP Y++D+++  HL  +  +
Sbjct: 95  DTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSY 154

Query: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNP-EQKIGKL--EKFKHRNIYNE-----LM 219
              +   L  F+SN+ R       K+CS C P E +  KL  +    +NI N      L 
Sbjct: 155 A--VSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLF 212

Query: 220 PLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSF 279
           P+ER+HIEIF PF + KIE KY  ILY RDY +RYIW   LK  K KH+   +   FLS 
Sbjct: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272

Query: 280 IRQ-PIFIETASLDWQDMFDICEKIAFEYDLQIGLGT-SKPNTFHAAGIRQMKAKLEAHR 337
               PIF++++++D  D+FDICEKI+ EY + +GLGT +K + FH +GI   K  +  ++
Sbjct: 273 ATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNK 332

Query: 338 EECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLS-SQIQECSLKFKEKIIQILENAVSE 396
            +CL SW+  L +GS  HN + N R    P D+++ + + +   KF+++ ++I++  +++
Sbjct: 333 SKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITD 392

Query: 397 SVLRVDN--GLIFLE 409
           + +++ N   +IF+E
Sbjct: 393 NYVKLGNVASIIFIE 407

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  205 bits (522), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/376 (30%), Positives = 212/376 (56%), Gaps = 15/376 (3%)

Query: 38  PENIVIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRT 97
           PE+++    YI+PR+G+ Y S     ++ +LL++GE  V     S   +L++E YDL++ 
Sbjct: 22  PEHVLANIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAV---ANSKTNYLSKELYDLVKN 78

Query: 98  DSLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIM 157
           D LT + +A       +  A  R + LK RYYRD+  ++HD  +++KIV +P + F M+M
Sbjct: 79  DDLTRKNVAVA-LNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVM 137

Query: 158 GCHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNE 217
             HL+N+H     I+ +LS  ++N++      ++++CS+CN  +K  + +K    +   +
Sbjct: 138 TTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPD 197

Query: 218 LMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFL 277
           ++  ER+ +++  PF  +KI+K+Y+HIL   D+H++++W  PLKN K + ++  +    +
Sbjct: 198 ILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIV 257

Query: 278 SFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHR 337
           +   +P+FI + +L   D+F++C  +A EY++ IGLGT      ++      +  L +H+
Sbjct: 258 ALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRI-LNSHK 316

Query: 338 EECLLSWNLCLKY-----GSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILEN 392
            ECL SW +CLK+      +   +IR  ++  G     L S + +   K++E+   I+  
Sbjct: 317 TECLKSWFMCLKWLADRQSNSKFDIRPPNKNYG-----LFSGMTDFLKKYEERSKMIIGR 371

Query: 393 AVSESVLRVDNGLIFL 408
             SE+ + +D G  F+
Sbjct: 372 LPSENFINIDEGSHFI 387

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 195/363 (53%), Gaps = 8/363 (2%)

Query: 49  VPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS- 107
           +P +   Y     S +++E +  G  +  + +   +  LT++ Y LIR  +   ET    
Sbjct: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83

Query: 108 -----TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLM 162
                T+      TA  +++ ++ RY  +  G I D     K++  P  ++D+IM CH +
Sbjct: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFL 143

Query: 163 NNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLE 222
           N+H    KIHHSL   YSNI+R L   +L+ CS CNP+     +E  +H +  ++    E
Sbjct: 144 NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSC-DKNFAFE 202

Query: 223 RVHIEIFEPFPN-EKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIR 281
           ++H+EIF+PF + +    K+SH++Y RDY +RY+W+ PL+    K L  T+A+  L  +R
Sbjct: 203 KIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLR 262

Query: 282 QPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECL 341
            PI+IE+ +LD  ++  I ++I+   +L +G+GT+K + F A+GI  MK     +RE C 
Sbjct: 263 IPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCG 322

Query: 342 LSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV 401
            +WN  +      +N  +N    G+P +L++ +    +  +K+K  + +   +S++ + +
Sbjct: 323 NNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTILL 382

Query: 402 DNG 404
            NG
Sbjct: 383 KNG 385

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  187 bits (474), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 200/370 (54%), Gaps = 11/370 (2%)

Query: 39  ENIVIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTD 98
           E ++  + +  P +G+    Y DS+++ ++LKRGE+E  +F+ ++  H+T + Y  +R +
Sbjct: 20  EQLIDIDDFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDE 79

Query: 99  SLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMG 158
           SL  +   +  P   KI    + ++L+ RY ++++G + +  + +K++CEP Y++ + M 
Sbjct: 80  SLLEDD--APIPASLKIKTSKK-MYLQIRYSKNSDGDLIE-TKTNKLLCEPKYIYKLTMK 135

Query: 159 CHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLE-KFKHRNIYNE 217
            H MNNH    K++ +LS  Y NI   L +  L++CS CN   KI  +   +  RN Y +
Sbjct: 136 AHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYID 195

Query: 218 LMPLERVHIEIFEPFPNE--KIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASL 275
            +PLER+ I+I +PF +   KI  KYSHIL  RDYHSRY W+ PLK+   K++   +   
Sbjct: 196 YLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKF 255

Query: 276 FLSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNT--FHAAGIRQMK--A 331
            ++  R PIF+ +  +    +  I  KI  EY ++I +G        F   GI ++    
Sbjct: 256 LVTLPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLL 315

Query: 332 KLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILE 391
            L+ ++E+C   W  C++  ++  N R +   G     L+  Q  E +  F+ K   +L 
Sbjct: 316 NLKENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLS 375

Query: 392 NAVSESVLRV 401
           + + E+VL++
Sbjct: 376 DLLEENVLKI 385

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 204 GKLEKFKH--RNIYNELMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLK 261
           GKL K KH   +  N   P+  +H ++F P     I      I +  D ++R+ W+ PLK
Sbjct: 167 GKLTKHKHIVGSRLNIKSPMSYIHTDLFGPVSGVDITSPKYFISFT-DENTRFRWVFPLK 225

Query: 262 NTKFKHLVPTMASL 275
                H++P    L
Sbjct: 226 KKDADHILPIFQQL 239

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 204 GKLEKFKH----RNIYNELM-PLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWML 258
           GKL K KH    R  Y +   P E +H ++F P     I      I +  D ++R+ W+ 
Sbjct: 269 GKLTKHKHIVGSRLKYQKYYEPFEYIHTDLFGPVSGVDITSPKYFISFT-DENTRFRWVF 327

Query: 259 PLKNTKFKHLVPTMASL 275
           PLK     H++P    L
Sbjct: 328 PLKKKDADHILPIFQQL 344

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 204 GKLEKFKH----RNIYNELM-PLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWML 258
           GK+ K KH    R  Y +   P E +H ++F P     I      I +  D ++R+ W+ 
Sbjct: 354 GKITKHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDITSPKYFISFT-DENTRFRWVF 412

Query: 259 PLKNTKFKHLVPTMASL 275
           PLK     H++P    L
Sbjct: 413 PLKKKDADHILPIFQQL 429

>KAFR0C01330 Chr3 complement(276359..279241) [2883 bp, 960 aa] {ON}
           Anc_3.107 YOL090W
          Length = 960

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 174 SLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFP 233
           SL   YSNI+   C   LK+  +   E++IGK E  +H     E M L+   I+    FP
Sbjct: 253 SLPQKYSNISMGACNALLKYLQLVTEEEQIGKYELVEHS--LKEFMKLDASAIKALNLFP 310

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 63/161 (39%), Gaps = 27/161 (16%)

Query: 139 HLRKDKIVCEPVYVFDMIMGCH--------LMNNHGFVKKIHHSLSTFYSNITRDLCLKA 190
           H +K  I C P  +  +I   H         +  H    +I   L+  Y NI++ L    
Sbjct: 148 HNKKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDV 207

Query: 191 LKFCSVCNPEQKIGKLEKFKHRNIYNELMPL-----ERVHIEIFEPF------PNEKIEK 239
           +  C  C P       +KF    +   ++PL     +R+ ++I          P +   K
Sbjct: 208 VAACPDCKPLSS----KKFNITRV--NVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTK 261

Query: 240 KYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFI 280
             + ILY  DYHS  +W+  L   +    +  +  +FL+ +
Sbjct: 262 --NAILYIGDYHSGAVWLFALDGEEDATDILLVLEMFLNVV 300

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query: 160 HLMNNHGFVKKIHHSL-STFYSNITRD-LCLKAL-KF-CSVCNPEQKIGKLEKFKH---- 211
           H    H  VK I  S+      NIT D +  + + KF C  C      GK+ + KH    
Sbjct: 601 HRFFGHVNVKDIRKSVEKGMIQNITADKIDWRGIDKFQCKEC----LAGKMRRHKHTVGS 656

Query: 212 RNIYNELM-PLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVP 270
           R  Y +   P + +H ++F P  +         I +  D ++R+ W+ PL++   +H++ 
Sbjct: 657 RLKYQQFFEPFQYIHTDLFGPMSDVSATTPTYFISFV-DENTRFRWVYPLRSKSAEHILL 715

Query: 271 TMASLFLSFIR 281
               L ++FIR
Sbjct: 716 VFRKL-VNFIR 725

>NCAS0A08670 Chr1 complement(1713724..1716603) [2880 bp, 959 aa]
           {ON} Anc_3.107
          Length = 959

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 161 LMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMP 220
           L+NN     ++  SL   YSN+    C   L +  + N + ++GK E  +H     E M 
Sbjct: 244 LINN-----ELSLSLPKKYSNLAMGACNALLGYLELLNEQDQLGKFELIEHS--LQEFMK 296

Query: 221 LERVHIEIFEPFPNEKIE 238
           L+   I+    FP   ++
Sbjct: 297 LDASAIKALNLFPQGPVQ 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,057,102
Number of extensions: 2483441
Number of successful extensions: 6906
Number of sequences better than 10.0: 37
Number of HSP's gapped: 7071
Number of HSP's successfully gapped: 37
Length of query: 519
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 405
Effective length of database: 40,409,475
Effective search space: 16365837375
Effective search space used: 16365837375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)