Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B055308.263ON51451426990.0
KAFR0B05520singletonON51049318330.0
KNAG0M012108.263ON52149817620.0
NCAS0B050208.263ON56849117650.0
NCAS0B038408.263ON49749017370.0
KNAG0G020408.263ON59151117390.0
TDEL0F039008.263ON55949117270.0
NDAI0B019908.263ON58851617290.0
Skud_12.1578.263ON59249017090.0
KLLA0F19162g8.263ON52848716960.0
Suva_10.1738.263ON59248917030.0
YLR089C (ALT1)8.263ON59248916980.0
NDAI0J013608.263ON50149316870.0
Smik_12.1488.263ON59248916920.0
ZYRO0C01628g8.263ON53448716820.0
CAGL0L12254g8.263ON57448816820.0
YDR111C (ALT2)8.263ON50749016700.0
Kpol_392.58.263ON51249016520.0
Skud_4.3728.263ON50749016500.0
Suva_2.2718.263ON50749016440.0
Smik_4.3578.263ON50749016430.0
KAFR0B027308.263ON53948916350.0
SAKL0H17006g8.263ON53149016330.0
TBLA0G01630singletonON50049515870.0
Kpol_543.398.263ON49249215780.0
TBLA0F030608.263ON50049715780.0
TBLA0E044408.263ON56248515820.0
TPHA0A018008.263ON49849915650.0
TPHA0J007508.263ON52248915630.0
KLTH0G13662g8.263ON51948315610.0
Kwal_56.237918.263ON51850015410.0
Ecym_43078.263ON53448915180.0
AGR085W8.263ON52148914870.0
TDEL0D019001.321ON4432421196e-06
NCAS0A092001.321ON4452961197e-06
Kwal_34.160181.472ON3791671171e-05
Kwal_14.25741.321ON443721134e-05
Suva_6.1361.321ON4441191125e-05
TPHA0O014501.321ON4431451125e-05
AEL170C1.321ON4582431116e-05
YJL060W (BNA3)1.321ON4441141091e-04
Smik_10.1801.321ON4442951081e-04
Skud_10.1561.321ON4601161072e-04
SAKL0D06886g1.321ON4472621062e-04
Kpol_1035.231.321ON4443001053e-04
Ecym_62921.321ON4302761044e-04
Ecym_6319singletonON3542251035e-04
CAGL0J05126g1.321ON4332941036e-04
Kwal_47.189823.511ON4962571028e-04
KLTH0H10648g1.321ON4432591000.001
Kpol_1039.222.252ON3861801000.001
NDAI0G057601.321ON448233980.002
KNAG0B053201.321ON433257980.002
KLTH0G19646g1.472ON379172960.003
KLLA0F10021g3.511ON497258960.004
KLLA0F01617g1.321ON444239950.005
KAFR0A017101.321ON435245930.009
KLTH0G09614g2.252ON389178920.011
KLTH0G02002g3.511ON496257910.016
Kpol_480.11.472ON380349890.023
ZYRO0G20636g1.321ON45368870.046
NCAS0G040501.472ON384114850.068
TPHA0F012602.252ON392201850.082
Ecym_32902.252ON386148840.10
SAKL0F02156g3.511ON49857830.17
Suva_17.6singletonON401117820.21
TDEL0A016008.204ON475234800.35
Ecym_55428.204ON44691790.45
Kwal_47.17462na 1ON492125790.46
KLLA0F03509g2.252ON387168780.50
KNAG0G005501.472ON38781780.55
NCAS0E006703.511ON49779780.58
TBLA0B009902.102ON546161770.75
KLTH0G19624gsingletonON46840770.78
KLTH0B00176g8.204ON44840770.84
TPHA0D033703.511ON49757770.89
KAFR0J015802.252ON383103761.0
KLTH0E07678gna 1ON492125751.4
KNAG0B006603.511ON49657751.5
SAKL0D11528g1.472ON383119741.8
AGR141C8.204ON43851741.9
Kpol_278.23.511ON49858742.0
SAKL0G02838g5.449ON243134722.0
KNAG0E018502.252ON384134732.5
ADL249W2.252ON387155722.7
SAKL0E08492g2.252ON384103722.8
TDEL0D057903.511ON49758723.1
CAGL0G01254g3.511ON50457723.1
Kwal_23.48882.252ON389153723.3
Kwal_23.4020singletonON40194713.5
KLTH0E09614g2.392ON33768713.6
Smik_4.394na 2ON124034714.2
KAFR0D014203.511ON492262714.6
Kwal_8.5858.204ON44648705.3
ZYRO0A01672g2.252ON386105705.4
TPHA0P013503.45ON39141697.3
Smik_9.532.252ON388125688.4
YIL116W (HIS5)2.252ON385124688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05530
         (514 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}           1044   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   710   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   683   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   684   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   673   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   674   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   669   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   670   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   662   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   657   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   660   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   658   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   654   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   656   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   652   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   652   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   647   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   640   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   640   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   637   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   637   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   634   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   633   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              615   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   612   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   612   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   613   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   607   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   606   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   605   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   598   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   589   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   577   0.0  
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    50   6e-06
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    50   7e-06
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    50   1e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    48   4e-05
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    48   5e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    48   5e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    47   6e-05
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    47   1e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    46   1e-04
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    46   2e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    45   2e-04
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    45   3e-04
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    45   4e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    44   5e-04
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    44   6e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    44   8e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    43   0.001
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    43   0.001
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    42   0.002
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    42   0.002
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    42   0.003
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    42   0.004
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    41   0.005
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    40   0.009
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    40   0.011
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.016
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    39   0.023
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    38   0.046
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    37   0.068
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    37   0.082
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    37   0.10 
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    37   0.17 
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    36   0.21 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    35   0.35 
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    35   0.45 
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    35   0.46 
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    35   0.50 
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       35   0.55 
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     35   0.58 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    34   0.75 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    34   0.78 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    34   0.84 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    34   0.89 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    34   1.0  
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    33   1.4  
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    33   1.5  
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    33   1.8  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    33   1.9  
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    33   2.0  
SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {O...    32   2.0  
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    33   2.5  
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    32   2.7  
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    32   2.8  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    32   3.1  
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    32   3.1  
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    32   3.3  
Kwal_23.4020 s23 complement(531463..532668) [1206 bp, 401 aa] {O...    32   3.5  
KLTH0E09614g Chr5 (867211..868224) [1014 bp, 337 aa] {ON} simila...    32   3.6  
Smik_4.394 Chr4 (718158..721880) [3723 bp, 1240 aa] {ON} YDR150W...    32   4.2  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    32   4.6  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    32   5.3  
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    32   5.4  
TPHA0P01350 Chr16 (274173..275348) [1176 bp, 391 aa] {ON} Anc_3....    31   7.3  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    31   8.4  
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    31   8.8  

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/514 (97%), Positives = 502/514 (97%)

Query: 1   MQLTEEFAATTQYFPVRKALDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEE 60
           MQLTEEFAATTQYFPVRKALDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEE
Sbjct: 1   MQLTEEFAATTQYFPVRKALDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEE 60

Query: 61  LEFELLNNDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVST 120
           LEFELLNNDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVST
Sbjct: 61  LEFELLNNDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVST 120

Query: 121 GIFKSDAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTE 180
           GIFKSDAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTE
Sbjct: 121 GIFKSDAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTE 180

Query: 181 GXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEI 240
           G            CKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEI
Sbjct: 181 GASKAASYLLSLLCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEI 240

Query: 241 EKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF 300
           EKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF
Sbjct: 241 EKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF 300

Query: 301 DGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQA 360
           DGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQA
Sbjct: 301 DGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQA 360

Query: 361 ILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQ 420
           ILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQ
Sbjct: 361 ILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQ 420

Query: 421 LKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQ 480
           LKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQ
Sbjct: 421 LKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQ 480

Query: 481 KEGTYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ 514
           KEGTYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ
Sbjct: 481 KEGTYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ 514

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/493 (67%), Positives = 394/493 (79%)

Query: 22  DDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVH 81
           D   H+F+PA KI++ DLNQ ++ +EYAVRGSI  RAEELEFEL +     S  FE I++
Sbjct: 18  DSNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIY 77

Query: 82  ANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGS 141
           ANIGNPQQLDQKPLTFSRQV+SIL+YP LL  +++L+S GI+K DA+ERAE L   IG S
Sbjct: 78  ANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGAS 137

Query: 142 VGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGV 201
           VGAYS +QGVYGIRET A +I+ RDN E AS DDIFLT+G            C++++TG+
Sbjct: 138 VGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGI 197

Query: 202 LIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVIN 261
           LIPIPQYPLYTA+I + +AKMLPYYL+EESGWST   EIE  V++AI + +KPS MVVIN
Sbjct: 198 LIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVIN 257

Query: 262 PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRSLQKQYPGK 321
           PGNPTG+VLS D I  II + AKYGIVLIADEVYQ+NIF+GEFHSMKK+LR LQK+YPGK
Sbjct: 258 PGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGK 317

Query: 322 YDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDL 381
           YD VQLASLHSTSKGVSGECGQRGGYME+VGF DE+R  +LKLASI++CSV+TGQALVDL
Sbjct: 318 YDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDL 377

Query: 382 MVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHF 441
           MV+PP  GDESYE D  ER  IH TLK+RA+KLY+ F  L+G+ECQKPQGAMYLFP+L  
Sbjct: 378 MVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLIL 437

Query: 442 PQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEK 501
           P   I EA    M  DEFYCH LLE TGICTVPGSGFGQ+EGTYH+RTTFL+PG +W + 
Sbjct: 438 PDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDD 497

Query: 502 WKLFHEEFFSKYQ 514
           WK FHE+F  +YQ
Sbjct: 498 WKKFHEKFMKEYQ 510

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/498 (65%), Positives = 395/498 (79%), Gaps = 6/498 (1%)

Query: 21  DDDTIHN--FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFEN 78
           DD T+    F+PA+K+  DDLN+N++ +EYAVRG+IP +AEELE +L  +   D L F  
Sbjct: 25  DDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQL--SQQPDLLPFNA 82

Query: 79  IVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHI 138
           I  ANIGNPQQLDQKPLTFSRQV+SILQYP LL+    LV++G +K DA +RA  LL  I
Sbjct: 83  ITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQI 142

Query: 139 GGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKN 198
           GGSVGAYS +QGVYGIRE+VA++IT RD GETASPDDIFLT+G            C+D +
Sbjct: 143 GGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSS 202

Query: 199 TGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMV 258
           TG++IPIPQYPLYTA+IT+ ++ MLPYYL+EESGWST   EIE+ V+D+I   V P V+V
Sbjct: 203 TGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIV 262

Query: 259 VINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQ 317
           VINPGNPTG+VLS D I  I+ I AKYGIV++ADEVYQ NI+ G +FHSMKKVLRSLQ+ 
Sbjct: 263 VINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRD 322

Query: 318 YP-GKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQ 376
           +P G+YD VQLAS+HSTSKGVSGECGQRGGYMELVGF +E+RQ ILKLASIS+CSV+TGQ
Sbjct: 323 HPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQ 382

Query: 377 ALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLF 436
           ALVDLM+NPP++GD+SYELD  ERK IH  +K R   LY+ F +L+G+ECQ+PQGAMYLF
Sbjct: 383 ALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLF 442

Query: 437 PKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGN 496
           PKL   +  I EA +  + PDEFYCH LL+ TGICTVPGSGFGQKEGTYH+RTTFLAPG 
Sbjct: 443 PKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGT 502

Query: 497 QWTEKWKLFHEEFFSKYQ 514
           QW + W+ FH+ F+ KY+
Sbjct: 503 QWIKDWETFHKAFYDKYR 520

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/491 (67%), Positives = 398/491 (81%), Gaps = 4/491 (0%)

Query: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85
           +NF PA ++TL +LN NVLK++YAVRG+IP RAEEL+ +L  + SS  L F++IV+ANIG
Sbjct: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSS--LPFDHIVNANIG 136

Query: 86  NPQQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGA 144
           NPQQL+QKPL+F RQV+S+LQYPE+L Q  + LV++G+FK DA+ERA+TLL  IGG+VGA
Sbjct: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196

Query: 145 YSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIP 204
           YS+SQGVYGIR+TVAN+IT RDNGE A P+DIFLT G            CK   TGVLIP
Sbjct: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256

Query: 205 IPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGN 264
           IPQYPLYTA++ L ++  LPYYL+E+SGWSTN  EIE+VVL A    ++PSV+VVINPGN
Sbjct: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316

Query: 265 PTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYD 323
           PTG+VLS+  I HI  I AKYGIV+IADEVYQEN+F+  +FHSMKKVLR+LQK++PG YD
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 324 AVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMV 383
            VQLASLHSTSKGVSGECGQRGGYMEL GF  E+R  ILKLASISLC V+TGQALVDLMV
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 384 NPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQ 443
           +PPKKGDES+E D  ERK+I   L  RA +LY  F  L+G+ECQKPQGAMYLFP+L  P 
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 444 TLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWK 503
             + +A +  MSPDEFYC +LLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W EKWK
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 504 LFHEEFFSKYQ 514
           +FH++F++ Y+
Sbjct: 557 IFHQDFYNTYR 567

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/490 (64%), Positives = 390/490 (79%), Gaps = 3/490 (0%)

Query: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85
           ++F+PA K++L D+N+NV+ +++A+RGSI  +AE+L+ +L  N +   L F+ I  ANIG
Sbjct: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQL--NKNPHCLPFDEITVANIG 66

Query: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           NPQ+L+QKPLTF+RQV+SILQYPELLN R++L    IF SD+ +RAE LL  IGGSVGAY
Sbjct: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S+SQGVYGIR+T A YIT RD GE + P+DIFLT G            C+   TGVLIPI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTAT+ L  + M+PYYL+EES WSTNT EIEK+VLD+I   +KPSV+VVINPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324
           TG+VLS+  I  I  I AKYGIV++ADEVYQENIFDG +FHS KKVLR LQKQYPGK+D 
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           +QLAS+HSTSKGV GECGQRGGYMELVGF DE+RQ +LKLA +++CSV+TGQA+VDLM+ 
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PPKKGD SYELD  ER+ I + + ERA KLY +F +L G+ECQKPQGAMYL+P L   + 
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            I +A + N++PDEFYCH LL+ATGICTVPGSGFGQK+GTYHLRTTFLAPG +W  KW+ 
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 505 FHEEFFSKYQ 514
           FH+ F+ KYQ
Sbjct: 487 FHKHFYEKYQ 496

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/511 (63%), Positives = 399/511 (78%), Gaps = 6/511 (1%)

Query: 8   AATTQYFPVRKALDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLN 67
           A   Q  P +  L   + + F PA ++ + DLN+NVLK++YAVRGSIP RAE+L+ +L  
Sbjct: 82  AVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQL-- 139

Query: 68  NDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLN--QRNILVSTGIFKS 125
            +   SL F+ I++ANIGNPQQL+QKPL+F RQV+S+LQ+PELLN  + N   +T ++K+
Sbjct: 140 QEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKA 199

Query: 126 DAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXX 185
           DA+ RAE LL  IGGSVGAYS+SQGV GIR+TVA++IT RDN E A P+DIFLT G    
Sbjct: 200 DAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAA 259

Query: 186 XXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVL 245
                   CK + TGVLIPIPQYPLYTAT+ L ++  LPYYL+E+SGWSTNT EI+ VVL
Sbjct: 260 VSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVL 319

Query: 246 DAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGE-- 303
           DAI  N+KPSV+VVINPGNPTG+VLS+  I  I  I AKYGIV+IADEVYQENIFD +  
Sbjct: 320 DAIDRNIKPSVLVVINPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVK 379

Query: 304 FHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILK 363
           FHSMKKVLR LQ+++PGK+D VQLASLHSTSKGVSGECGQRGG+MEL GF  EIRQ ILK
Sbjct: 380 FHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILK 439

Query: 364 LASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKG 423
           LASISLC V+TGQALVDLMV+PP++G+ESYELD  ER +IH  L +RA KL+  F +L+G
Sbjct: 440 LASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEG 499

Query: 424 VECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEG 483
           ++CQKPQGAMYLFP+L+ P   + +A +  M+ DEFYC  LLE TGICTVPGSGFGQ  G
Sbjct: 500 IQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPG 559

Query: 484 TYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ 514
           TYHLRTTFLAPG +W + W+ FH+EF++KY+
Sbjct: 560 TYHLRTTFLAPGTEWIDLWEKFHKEFYNKYR 590

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/491 (66%), Positives = 390/491 (79%), Gaps = 4/491 (0%)

Query: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85
            +F PA+ +T+ DLN+NVLK++YAVRGSIP RAEEL+ E L  D S SL F+ IV+ANIG
Sbjct: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQ-EQLKRDPS-SLPFDKIVNANIG 127

Query: 86  NPQQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGA 144
           NPQQL+QKPL+F RQV+SILQYPE+L Q    L+S G+FK DA+ERA+ +L  +GGSVGA
Sbjct: 128 NPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGA 187

Query: 145 YSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIP 204
           YSSSQGVYGIR+TVA++IT RD+GE A P+DIFLT G            C+ + TGVLIP
Sbjct: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247

Query: 205 IPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGN 264
           IPQYPLYTAT+ L ++ +LPYYL+EESGWSTNT EIE VV ++I   ++PSV+VVINPGN
Sbjct: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGN 307

Query: 265 PTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYD 323
           PTGSVLS + I  I  + AKYGIV+IADEVYQENIF G EFHSMKKVLR LQK++PG YD
Sbjct: 308 PTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYD 367

Query: 324 AVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMV 383
            VQL SLHSTSKGVSGECGQRGGYMEL GF  EIRQ +LKLASISLC V+TGQALVDLMV
Sbjct: 368 NVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMV 427

Query: 384 NPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQ 443
            PPK GDESYE D  ER+ IHE L  RA  L++ F  L+G+ECQKP+GAMYLFP++  P 
Sbjct: 428 CPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPY 487

Query: 444 TLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWK 503
             I  A +   +PDEFYC  LLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+
Sbjct: 488 KAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWE 547

Query: 504 LFHEEFFSKYQ 514
            FH++F+ +Y+
Sbjct: 548 DFHKKFYDQYR 558

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/516 (63%), Positives = 401/516 (77%), Gaps = 16/516 (3%)

Query: 12  QYFPVRKALDDDTI----------HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEEL 61
           Q+F  ++AL   +I           +F PA+++TL DLN+NVLK++YAVRGSIP RAEEL
Sbjct: 75  QFFDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEEL 134

Query: 62  EFELLNNDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELL--NQRNILVS 119
           + +L NN S+  L F  IV+ANIGNPQQL QKPL+F RQV+SILQYP++L  N++N L+ 
Sbjct: 135 KVQLENNPST--LPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQN-LID 191

Query: 120 TGIFKSDAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLT 179
             ++K DA++RA+ LL  IGGSVGAYS+SQGVYGIR+TVAN+IT RD GE A P+DIFLT
Sbjct: 192 AKVYKRDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLT 251

Query: 180 EGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNE 239
                         C+   TGVLIPIPQYPLYTAT+ L ++  LPYYL+E+SGWSTN  E
Sbjct: 252 VWCFRCCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKE 311

Query: 240 IEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENI 299
           IE+VV DA+   + PSV+VVINPGNPTG+VL+++ I HI  I AKYGIV+IADEVYQENI
Sbjct: 312 IEEVVQDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENI 371

Query: 300 FDG-EFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIR 358
            DG +F+SMKKVLR LQK +PGK+D VQLASLHSTSKGVSGECGQRGGYMEL+GF  E+R
Sbjct: 372 ADGVKFYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVR 431

Query: 359 QAILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLF 418
           + ILKLASISLC V+TGQALVDLMV+PPKKGD SYE D  ER++I   L  RA +LY  F
Sbjct: 432 KVILKLASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETF 491

Query: 419 CQLKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGF 478
             L+G+ECQKPQGAMYLFPKL  P   + EA +  M+PDEFYC +LL+ATGICTVPGSGF
Sbjct: 492 VGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGF 551

Query: 479 GQKEGTYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ 514
           GQ+ GTYHLRTTFLAPG +W +KW+ FH+EF+  Y+
Sbjct: 552 GQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFYDNYR 587

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/490 (64%), Positives = 393/490 (80%), Gaps = 4/490 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           +F PA+++TL+D+N+NVLK++YAVRG+IP RAEEL+ +L       SL F+ I++ANIGN
Sbjct: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDKIINANIGN 161

Query: 87  PQQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           PQQL QKPLT+ RQV+S+LQYPELLNQ    LV + +FK DA++RA++L+  IGGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           SSSQGV GIR++VA +IT RD+GE + P+DIFLT G            C+   TGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTAT+ L +++ LPYYL+E+SGWSTN  EIE VV +AI + +KP+V+VVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324
           TG+VLS + +  I  + AKYG V+IADEVYQENIF G +FHSMKK+LR+LQ+++PGK+D 
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PP +G+ES+ELD  ER +IHE L  RA  LY+ F  L+G+ECQKPQGAMYLFPK+  P  
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            + EA +  ++PDEFYC +LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+ 
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 505 FHEEFFSKYQ 514
           FH+EFF +Y+
Sbjct: 582 FHKEFFDQYR 591

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 384/487 (78%), Gaps = 4/487 (0%)

Query: 29  KPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQ 88
           KPA K++LDD+N+NVLK++YAVRG IP RAEEL  +L  + SS  L F  I+ ANIGNPQ
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSS--LPFSKIISANIGNPQ 101

Query: 89  QLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSS 148
           QLDQKPLTF R+V+S+LQ+PELL + +  + T ++K+D+++RA+ LL  +GGSVGAYS S
Sbjct: 102 QLDQKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQS 160

Query: 149 QGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQY 208
           QGV GIRETVA++IT RD+GE + P+DI+LT G            CK  NTGVLIPIPQY
Sbjct: 161 QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 220

Query: 209 PLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGS 268
           PLYTA++ L +++ LPYYL EE  WST+  EIE+VVLDAI   +KP+ +VVINPGNPTG+
Sbjct: 221 PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGA 280

Query: 269 VLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQL 327
           +LS+  I  I  + AKYGIV+IADEVYQEN+F G +F+SMKKVLR+LQK Y G+YD +QL
Sbjct: 281 ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQL 340

Query: 328 ASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPK 387
           ASLHSTSKGVSGECGQRGGYMELVGF  +IRQ  LKLASISLC V+TGQALVDLMV+PP+
Sbjct: 341 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 400

Query: 388 KGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLIT 447
            GDESYE D  ER++IH+ L ERA KL+  F +L+G+EC+KPQGAMYL+PKL  P  +I 
Sbjct: 401 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 460

Query: 448 EAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHE 507
           EA +  M PDEFYC ALLE TGICTVPGSGFGQ  GTYHLRTTFL PG +W E W+ FH+
Sbjct: 461 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 520

Query: 508 EFFSKYQ 514
            FF KY+
Sbjct: 521 AFFDKYR 527

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 385/489 (78%), Gaps = 4/489 (0%)

Query: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87
           F PA+++TLDD+N+NVLK+ YAVRG+IP RAEEL+ +L       SL F  I++ANIGNP
Sbjct: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQL--EKDPQSLPFNKIINANIGNP 162

Query: 88  QQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146
           QQL QKPLT+ RQV+S+LQYPELLN     LV + +FK DA++RA++L+  IGGSVGAYS
Sbjct: 163 QQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYS 222

Query: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIP 206
           SSQGV GIR++VA++IT RD GETA P+DIFLT G            C+   TGVLIPIP
Sbjct: 223 SSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIP 282

Query: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266
           QYPLYTAT+ L +++ LPYYL+E SGWSTN  EIE VV +AI + +KP+V+VVINPGNPT
Sbjct: 283 QYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPT 342

Query: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325
           G+VLS + I  I  + AKYG V+IADEVYQENIF G EF+SMKKVLR LQ+ +PGK+D V
Sbjct: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNV 402

Query: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385
           QLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV P
Sbjct: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462

Query: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445
           P +G+ES+E D  ER +IHE L  RA  LY  F  L+G+ECQKPQGAMYLFPK+  P   
Sbjct: 463 PVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKA 522

Query: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505
           I EA +  ++PDEFYC  LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW++F
Sbjct: 523 IQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIF 582

Query: 506 HEEFFSKYQ 514
           H+EFF +Y+
Sbjct: 583 HKEFFDQYR 591

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 386/489 (78%), Gaps = 4/489 (0%)

Query: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87
           F PA+++TL+D+N+NVLK++YAVRG+IP RAEEL+ +L       SL F+ I++ANIGNP
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDRIINANIGNP 162

Query: 88  QQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146
           QQL QKPLT+ RQV+S+LQYPELLNQ    LV + +FK DA++RA++L+  IGGSVGAYS
Sbjct: 163 QQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 222

Query: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIP 206
           SSQGV GIR++VA +IT RD GE + P+DIFLT G            C+   TGVLIPIP
Sbjct: 223 SSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIP 282

Query: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266
           QYPLYTAT+ L +++ LPYYL+E SGWSTN  EIE VV +AI + +KP+V+VVINPGNPT
Sbjct: 283 QYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPT 342

Query: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325
           G+VLS + I  I  + AKYG V+IADEVYQENIF G +FHSMKK+LR LQ+++PGK+D V
Sbjct: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNV 402

Query: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385
           QLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV P
Sbjct: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462

Query: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445
           P +G+ES+E D  ER +IHE L  RA  LY  F  L+G+ECQKPQGAMYLFPK+  P   
Sbjct: 463 PVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKA 522

Query: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505
           + EA +  ++PDEFYC  LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+ F
Sbjct: 523 VQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESF 582

Query: 506 HEEFFSKYQ 514
           H+EFF +Y+
Sbjct: 583 HKEFFDQYR 591

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/493 (62%), Positives = 387/493 (78%), Gaps = 6/493 (1%)

Query: 25  IHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANI 84
           +H+F+PA K+++ DLN NV+K+E+AVRG+IP +A+EL+ +L  N +  SL F  I  ANI
Sbjct: 10  LHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQL--NKNPHSLPFNEITVANI 67

Query: 85  GNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTG--IFKSDAMERAETLLCHIGGSV 142
           GNPQ+L QKPLTF+RQV+SILQYPELLN+RN L ST   I+ +D+ +RAE LL  IGGSV
Sbjct: 68  GNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSV 127

Query: 143 GAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVL 202
           GAYS+SQGVYGIR+T+ANYIT RD GE+ASP+DIF+T G                 TGVL
Sbjct: 128 GAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVL 187

Query: 203 IPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVL-DAIADNVKPSVMVVIN 261
           +PIPQYPLYTA + L +A MLPYYL EESGWS +TNEIEK +  +A+   ++P VMV+IN
Sbjct: 188 LPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIIN 247

Query: 262 PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPG 320
           PGNPTGS+LS+D +I I NI AKYGIV+IADEVYQEN+F+G +FHS KKVLRSLQKQ+P 
Sbjct: 248 PGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPT 307

Query: 321 KYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVD 380
           +Y+ VQLASLHSTSKG+ GECGQRGGYME++GF +++R  ILKLA I +C V+TGQA++D
Sbjct: 308 QYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMD 367

Query: 381 LMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLH 440
           LM+ PPK+GD+SY+LD  ER+ IH  +  RA+KLY++F  ++G++CQKPQGAMYLFP+L 
Sbjct: 368 LMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLL 427

Query: 441 FPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTE 500
               +I EA    M PDEFYCH LL  TGICTVPGSGFGQK  TYHLRTTFLAPG+QW  
Sbjct: 428 LSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWIN 487

Query: 501 KWKLFHEEFFSKY 513
           KW+ FH+ F  +Y
Sbjct: 488 KWEKFHKAFLKRY 500

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 382/489 (78%), Gaps = 4/489 (0%)

Query: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87
           F PA+++TLDD+N+NVLK++YAVRG+IP RAEEL+ +L       SL F  I++ANIGNP
Sbjct: 105 FYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFNKIINANIGNP 162

Query: 88  QQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146
           QQL QKPLT+ RQV+S+LQYPELLNQ    LV + +FK DA++RA++L+  IGGSVGAYS
Sbjct: 163 QQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYS 222

Query: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIP 206
           SSQGV GIR +VA +IT RD GE + P+DIFLT G            C+   TGVLIPIP
Sbjct: 223 SSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIP 282

Query: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266
           QYPLYTAT+ L +++ LPYYL+E SGWSTN  EIE VV +AI + +K +V+VVINPGNPT
Sbjct: 283 QYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPT 342

Query: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325
           G+VLS + I  I  + AKYG V+IADEVYQENIF G +FHSMKK+LR LQ+++PGK+D V
Sbjct: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNV 402

Query: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385
           QLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV P
Sbjct: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462

Query: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445
           P +G+ES+E D  ER +IHE L  RA  LY  F  L+G+ECQKPQGAMYLFPK+  P   
Sbjct: 463 PLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRA 522

Query: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505
           + EA +  ++PDEFYC  LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+ F
Sbjct: 523 VQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETF 582

Query: 506 HEEFFSKYQ 514
           H+EFF  Y+
Sbjct: 583 HKEFFDHYR 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/487 (64%), Positives = 379/487 (77%), Gaps = 4/487 (0%)

Query: 30  PAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQ 89
           PA+K+ L ++N+NVLK++YAVRG+IP  A EL  +L       SL F+NIV ANIGNPQ 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKL--KKDPHSLPFDNIVSANIGNPQH 106

Query: 90  LDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSS 148
           L QKPLTF RQV+S+LQYP LL +   +L+ + +++ DA+ RA  LL  IG SVGAYS+S
Sbjct: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 149 QGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQY 208
           QG+ GIRETVA +IT RD GE A  +DIFLT G            CK + TGVLIPIPQY
Sbjct: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226

Query: 209 PLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGS 268
           PLYTA++ L ++  LPYYL+E+SGWSTN  EIE VV +AI  N+KPSV+VVINPGNPTG+
Sbjct: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286

Query: 269 VLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQL 327
           VLS++DI  I  I AKYGIV+IADEVYQEN+FDG EFHSMKK+LR LQK  PG +D VQL
Sbjct: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 328 ASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPK 387
           ASLHSTSKGVSGECGQRGGYME+ GF ++IRQ ILKLASISLC V+TGQALVDLMV+PPK
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 388 KGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLIT 447
            GDESYELD  ERK+IHE L ERA KL+  F  L+G+ECQKP+GAMYLFP+L  P   I 
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 448 EAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHE 507
            A ++ M+PD FYC  LLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W E+W+ FH+
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 508 EFFSKYQ 514
            F+ +Y+
Sbjct: 527 AFYEEYR 533

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/488 (64%), Positives = 387/488 (79%), Gaps = 4/488 (0%)

Query: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87
           F PA++ TL D+N+ VL ++YAVRG+IP RAEEL+ +L+ N    SL F +I++ANIGNP
Sbjct: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMEN--PHSLPFNDIINANIGNP 146

Query: 88  QQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSS 147
           QQL QKPL+F RQV+S+LQYPEL+        T I K DA++RA+ LL  IGGSVGAYSS
Sbjct: 147 QQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-KQDAIDRAKRLLDDIGGSVGAYSS 205

Query: 148 SQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQ 207
           SQGV GIR+TVA++IT RD+G  A P+DIFLT G            C+ + TGVLIPIPQ
Sbjct: 206 SQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQ 265

Query: 208 YPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTG 267
           YPLYTAT+ L ++  LPYYLNEE+GWST+  E+E ++LD+I +N+KPSV+VVINPGNPTG
Sbjct: 266 YPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTG 325

Query: 268 SVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDAVQ 326
           +VLS++ I  I  + AKYGI++IADEVYQEN+F D +FHSMKKVLR LQ + PG YD VQ
Sbjct: 326 AVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQ 385

Query: 327 LASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPP 386
           LASLHSTSKGVSGECGQRGGYMELVGF  +IRQ +LKLASISLC V+TGQALVDLMV PP
Sbjct: 386 LASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPP 445

Query: 387 KKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLI 446
           +KG+ESYE D  ER+NIH+ L +RA  L++ F +L G+ CQKPQGAMYLFPKL  P   I
Sbjct: 446 QKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAI 505

Query: 447 TEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFH 506
            EA++Q+MSPDEFYC +LLE TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W E W  FH
Sbjct: 506 QEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFH 565

Query: 507 EEFFSKYQ 514
           +EF++K++
Sbjct: 566 QEFYNKFK 573

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 382/490 (77%), Gaps = 4/490 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           +FKPA KIT  DLN  V K+EYAVRG+IP RA+EL+ EL  N   + L F++I++ANIGN
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN--PEVLPFDDIINANIGN 76

Query: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           PQQLDQKPLTF+RQV++IL+YPE+L    N L S  +F  DA+ERAE LL  IGGS+GAY
Sbjct: 77  PQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S SQGV GIR+TVA++IT RD GE A+P+DI+LT G            CKD  TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPI 196

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTA+ +L +A++LPYYL+EES WSTN++EIEKVV DA+   ++PSV++VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDA 324
           TG+VLS++ I  I  I AKYGI +I+DEVYQENIF D +FHSMKKVLR LQ  YPGK+D 
Sbjct: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHS SKG   ECGQRGGYME++GF  EIR A+ KL SIS+CSV+TGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PP+ GDESYE D+ ER  I   ++ RA  LY  F +L+G+ECQKPQGAMYLFP+L  P+ 
Sbjct: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            + E+    + PDEFYC +LLE+TGICTVPGSGFGQ+ GTYH+RTTFLAPG +W + WK 
Sbjct: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496

Query: 505 FHEEFFSKYQ 514
           FH++FFSKY+
Sbjct: 497 FHQDFFSKYR 506

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/490 (62%), Positives = 379/490 (77%), Gaps = 10/490 (2%)

Query: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85
           HN  PA+K+ +DDLN+NVLK++YAVRGSIP RAEEL+  L   ++   L F+ +++ANIG
Sbjct: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL---EAGQKLPFDTVINANIG 87

Query: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           NPQQL QKPLTF RQV+SILQYPELL        + IFK DA+ERA  LL  IG SVG+Y
Sbjct: 88  NPQQLKQKPLTFYRQVLSILQYPELLES-----GSNIFKKDAIERARKLLKEIG-SVGSY 141

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           SSSQG+  IR+TVAN+IT RD+GE ++P+DIFLT G            CK++ +GVLIPI
Sbjct: 142 SSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI 201

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTAT+ L +A  LPYYL+E  GWST+ NEIE+V+ D++   +KP+ +V+INPGNP
Sbjct: 202 PQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNP 261

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFD-GEFHSMKKVLRSLQKQYPGKYDA 324
           TGS+LS + +  II + A +GIV+IADEVYQEN+F+  +FHSMKKVLR+LQK +PG+YD 
Sbjct: 262 TGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDT 321

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHSTSKGVSGECGQRGGYMEL GF  EI+Q ILKL SISLC V+TGQALVDLMV+
Sbjct: 322 VQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVS 381

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PP+KGDESYE D  ER  I   L  RA  L+  F  ++GV CQKP+GAMYLFPK+  P  
Sbjct: 382 PPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFK 441

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
           ++ ++   +++PDEFYC ALLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W ++W  
Sbjct: 442 VLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNK 501

Query: 505 FHEEFFSKYQ 514
           FH EF+ KY+
Sbjct: 502 FHAEFYDKYR 511

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/490 (63%), Positives = 376/490 (76%), Gaps = 4/490 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           +FKPA KIT  DLN +V K+EYAVRGSIP RA+EL+ EL  N     L F++I++ANIGN
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGL--LPFDDIINANIGN 76

Query: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           PQQLDQKPLTF+RQV+SIL+YPE+L      L S  +F  DA++RAE LL  IGGSVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S SQGV GIR+TVA++ITARD GE A+P+DI+LT G            CKD  TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPI 196

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTA+ +L +A++LPYYL+EE  WST ++EIEKVV DA+   ++PSV++VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDA 324
           TG+VL+++ I  I  I AKYGI +I+DEVYQEN+F D +FHSMKKVLR LQ  YPGK+D 
Sbjct: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHS SKG  GECGQRGGYME+VGF  +IR A+ KL SIS+CSV+TGQA+VDLMVN
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PP+ GDESYE D  ER  I   ++ RA  LY  F  L+G+ECQ PQGAMYLFP+L  P  
Sbjct: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
              E+    + PDEFYC +LLE+TGICTVPGSGFGQK GTYH+RTTFLAPG QW + WK 
Sbjct: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496

Query: 505 FHEEFFSKYQ 514
           FH+ FF++Y+
Sbjct: 497 FHQSFFNEYR 506

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/490 (61%), Positives = 380/490 (77%), Gaps = 4/490 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           +FKPA K+T  DLN +V K+EYAVRG+IP RAEEL+ EL    SS+SL F +I++ANIGN
Sbjct: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEEL--KRSSNSLPFNSIINANIGN 76

Query: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           PQQLDQKPLTF+RQV+SIL+YPE+L    + L S  +F  DA++RA+ LL  IGGSVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAY 136

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S SQGV GIR+TVA++IT RD GE A P+DI+LT G            CKD  TG+L+PI
Sbjct: 137 SHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPI 196

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTA+ +L +A++LPYYL+EE+ WST ++EIE+VVLDA+   ++PSV+VVINPGNP
Sbjct: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDA 324
           TG+VL+++ I  I  I AKYGI +I+DEVYQENIF D +FHSMKK+LR LQ  +PGK+D 
Sbjct: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHS SKG  GECGQRGGYME+VGF  +IR A+ KL SIS+CSV TGQA++DLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVK 376

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PP+ GDESY+ D  ER  I+  +  RA  LY  F +L+G++CQKPQGAMYLFPKL  P+ 
Sbjct: 377 PPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEK 436

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            + E+   N+ PD  YC +LLE+TGICTVPGSGFGQK GTYH+RTTFL PG QW + W+ 
Sbjct: 437 ALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQ 496

Query: 505 FHEEFFSKYQ 514
           FH++FF+KY+
Sbjct: 497 FHQDFFNKYR 506

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 380/490 (77%), Gaps = 4/490 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           NFKPA KIT  DLN  V K+EYAVRG+IP RA+EL+ EL        L F++I++ANIGN
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEEL--KRKPGVLPFDDIINANIGN 76

Query: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           PQQLDQKPLTF+RQV+SIL+YPE+L    + L S  +F+ DA+ RAE LL  IGGS+GAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S SQGV GIR++VA +IT RD+GE A+P++I+LT G            CKD  TG+LIPI
Sbjct: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPI 196

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTA+ +L +A++LPYYL+E S WST ++EIEKVV DA+   +KPSV++VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324
           TG+VLS+D I  I  I AKYGI +I+DEVYQEN+F+G +FHSMKKVLR LQ+ YPGK+D 
Sbjct: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHS SKG  GECGQRGGYME+VGF  +IR A+ KL SIS+CSV+TGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PP+ GDESY+ D+ ER  I   +  RA  L+  F +L+G+ECQKPQGAMYLFP+L  P+ 
Sbjct: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            + E+    + PDEFYC +LLE+TGICTVPGSGFGQ+ GTYH+RTTFLAPG QW + WK 
Sbjct: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496

Query: 505 FHEEFFSKYQ 514
           FH++FF+KY+
Sbjct: 497 FHQDFFNKYR 506

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/489 (64%), Positives = 379/489 (77%), Gaps = 4/489 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           NFKPA ++T+ DLN+NVLK++YAVRG IP RAEEL+ +L   +  +SL F+ I++ANIGN
Sbjct: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLA--EKPNSLPFDKIINANIGN 108

Query: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILV-STGIFKSDAMERAETLLCHIGGSVGAY 145
           PQQL Q+PL+F RQV+S+LQYP LL+       S+ ++K DA+ RA+ +L  IGGSVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S SQGVYGIR TVAN+IT RD GE A P+DIFLT G            CK + TGVLIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTAT+ L ++  LPY+L+E +GWS N  EIE V+  A+ DN+KP V+VVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324
           TG+VLSK+ I+ I+ I AKYGIV+IADEVYQENIFDG +FHS+K VLR LQ++ PGK+D 
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           VQLASLHSTSKGVSGECGQRGGYME++GF  E+RQ ILKLASISLC V+TGQALVDLMV+
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PPK+G+ES+ LD  +RK IH  L +RAE L+  F  L G+ECQKP GAMYLFPKL+ P  
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            I EA    +SPDEFYC  LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG +W + WK 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 505 FHEEFFSKY 513
           FH EF  KY
Sbjct: 529 FHIEFMEKY 537

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/490 (61%), Positives = 379/490 (77%), Gaps = 3/490 (0%)

Query: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85
           + F+PA K++L+DLN+NVL+++YAVRG IP++AEEL+ +L  +    SL F+ I++ANIG
Sbjct: 43  YKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD--PKSLPFDRIINANIG 100

Query: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145
           NPQQLDQKPLTF RQV+S+LQ P++L +      + I+K DA++RA  LL +IGGSVGAY
Sbjct: 101 NPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAY 160

Query: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPI 205
           S SQGVYG R+TVA++IT RD GE A  +DIFLT G            C+   TGVLIPI
Sbjct: 161 SHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPI 220

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           PQYPLYTA++ L ++  LPYYL+EES WSTN  EIEKVV ++IA  V+P  +VVINPGNP
Sbjct: 221 PQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNP 280

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324
           TG++LS + I  I  + AKYGIV+IADEVYQEN+F+G EFHSM+KVL+ LQ+++ GK+D 
Sbjct: 281 TGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDN 340

Query: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384
           +QLASLHSTSKGVSGECGQRGGYMEL+GF  ++RQ  LKLASISLC V+TGQALVDLMV 
Sbjct: 341 IQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVC 400

Query: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444
           PPK GD SYE D  ER  IH+ L  RA  LY  F +L+G+ECQKPQGAMYLFP+L     
Sbjct: 401 PPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYK 460

Query: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504
            + +A + ++SPDEFYC  LLEATGICTVPGSGFGQ  GTYHLRTTFLAPG  W + W+ 
Sbjct: 461 AVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEE 520

Query: 505 FHEEFFSKYQ 514
           FH++F+++Y+
Sbjct: 521 FHKKFYNEYR 530

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/495 (59%), Positives = 373/495 (75%), Gaps = 12/495 (2%)

Query: 30  PAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQ 89
           PA K +L+D++Q++L +EYA+RG+IP RA+EL+ +L  N S + L F+ I++ANIGNPQQ
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQL--NISPNQLPFKKIIYANIGNPQQ 65

Query: 90  LDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSSQ 149
           L+Q+PLTF RQV+S+++YP L+N +NILV   I+  DA++RAET+L  IGGSVGAYSSSQ
Sbjct: 66  LEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQ 125

Query: 150 GVYGIRETVANYITARDNGETASPDD---------IFLTEGXXXXXXXXXXXXCKDKNTG 200
           G+  IR+ VA  I  RDN E    D+         IFLT+G             KD+N G
Sbjct: 126 GILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCG 185

Query: 201 VLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVI 260
           VL+PIPQYPLYTA +TL ++K+LPYYLNE+  WST+  EIE ++ DAI+ N+KP+ +V+I
Sbjct: 186 VLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVII 245

Query: 261 NPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYP 319
           NPGNPTG++LS + I  IINI AKYGIV+IADEVYQ NI+ D +FHS KK+L SL+ QYP
Sbjct: 246 NPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYP 305

Query: 320 GKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALV 379
            KYD VQLASLHS SKGV+GECGQRGGY EL+GF DEI++ ILKLASI +CSV+TGQ LV
Sbjct: 306 KKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILV 365

Query: 380 DLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKL 439
           DLM  PP+KGD SY+LD  ER NI   L  ++  LY+LF +L G+ CQKPQGAMYLFP+L
Sbjct: 366 DLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRL 425

Query: 440 HFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWT 499
           H    +I EA   N+ PDEFYC  LLE TGICTVPGSGFGQKEGTYH+RTTFL  G +W 
Sbjct: 426 HLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWI 485

Query: 500 EKWKLFHEEFFSKYQ 514
           + W+ FH EF ++Y+
Sbjct: 486 KLWEKFHLEFMNQYK 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/492 (59%), Positives = 372/492 (75%), Gaps = 7/492 (1%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           +F PA+K++++DLNQ+ + ++YAVRGSIP RAE+L  +++N+  S  L F+ I+ ANIGN
Sbjct: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGS--LPFDKIITANIGN 59

Query: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNIL---VSTGIFKSDAMERAETLLCHIGGSVG 143
           PQQ+ QKPLTF RQV+SIL+YP +LN   +L   V  G+++ D +ERA  +L  IGGSVG
Sbjct: 60  PQQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVG 119

Query: 144 AYSSSQGVYGIRETVANYITARDN-GETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVL 202
           AYS+SQGV G R+TVA++I  RD   + ASP+DIFLT G            C     GVL
Sbjct: 120 AYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVL 179

Query: 203 IPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINP 262
           IPIPQYPLYTAT+TL ++  +PYYL E + WSTNT EIE  + +++A+ VKP  +V+INP
Sbjct: 180 IPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINP 239

Query: 263 GNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGK 321
           GNPTG++LS+ D+  II I AKYGI +IADEVYQENIF G EFHSM+KVL +LQ ++PG 
Sbjct: 240 GNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGT 299

Query: 322 YDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDL 381
           YD VQLASLHSTSKG  GECGQRGGYMEL+GFKDE+   +LKLASIS+CSV+TGQAL+DL
Sbjct: 300 YDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDL 359

Query: 382 MVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHF 441
           +  PP+ GD SY+LD  ER  I + L  RA++LY LF  L+GVECQ+PQGAMYLFPKL  
Sbjct: 360 VTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLIL 419

Query: 442 PQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEK 501
           P   I +A+   + PDE+YC  LL+ATGICTVPGSGFGQ  GTYHLRTTFL PG +W E+
Sbjct: 420 PDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIER 479

Query: 502 WKLFHEEFFSKY 513
           W+ FH++F+ ++
Sbjct: 480 WREFHQQFYERF 491

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/497 (59%), Positives = 376/497 (75%), Gaps = 14/497 (2%)

Query: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87
           F PA K +L+D+N+++LK+EYA+RG+IP RAEEL+ +LL N  S SL F  IV+ANIGNP
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLEN--SKSLPFAKIVYANIGNP 65

Query: 88  QQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSS 147
           QQLDQ+PLTF RQV+S++Q+P+LL  ++IL++  I+  D++ERA  LL  IGGSVGAYSS
Sbjct: 66  QQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSS 125

Query: 148 SQGVYGIRETVANYITARD---------NGETASPDDIFLTEGXXXXXXXXXXXXCKDKN 198
           SQGV  IR+ VA +I  RD           ETAS  ++FLT G             KD++
Sbjct: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETAS--NVFLTAGASTAVDHILPLFAKDES 183

Query: 199 TGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMV 258
            GVL+PIPQYPLYTA +TL  +K+LPYYLNE + WST+  +IE++V+DAI  N+KP+ +V
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLV 243

Query: 259 VINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQ 317
           VINPGNPTG++L+KD II II+I A+YGIV+IADEVYQEN+++  EFHS KKVL  L+K 
Sbjct: 244 VINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKN 303

Query: 318 YPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQA 377
           YP KYD VQLASLHS SKGV+GECGQRGGYME+ GF +++++ +LK+ASIS+CSV+TGQ 
Sbjct: 304 YPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQI 363

Query: 378 LVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFP 437
           LVDLMVNPP+ GDESYELD  ER  IH  L  ++  LY++F +L G+ CQKPQGAMYLFP
Sbjct: 364 LVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFP 423

Query: 438 KLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQ 497
           +LH  +  I  A   N+ PDEFYC  LLE TGICTVPGSGFGQ  GTYHLRTTFL PG +
Sbjct: 424 RLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIE 483

Query: 498 WTEKWKLFHEEFFSKYQ 514
           W   W+ FH EF  KY+
Sbjct: 484 WINSWEKFHLEFMEKYK 500

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/485 (60%), Positives = 373/485 (76%), Gaps = 4/485 (0%)

Query: 31  AKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQL 90
           A+++  +DLN NV+K++YAVRG+IP  A++L+ +LL +  +  L FE+++++NIGNPQQL
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGT--LPFESVINSNIGNPQQL 138

Query: 91  DQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSSQG 150
            QKPL+F RQV+SIL+YP LL+    LV +  +  D++ERA+TLL  IG S+GAYS+SQG
Sbjct: 139 GQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197

Query: 151 VYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPL 210
           V+GIR+TVA++IT RD+GE A PDDIFLT G            CK + TGVLIPIPQYPL
Sbjct: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPL 257

Query: 211 YTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVL 270
           YTAT+TL DA  LPYYL+E +GWST+ NEI KV  D++   +KP+ +VVINPGNPTGSVL
Sbjct: 258 YTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317

Query: 271 SKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQLAS 329
           + + I ++ ++ AKYG+V+IADEVYQ+NIF G EFHSMKK+LR LQK+ P KYD +QLAS
Sbjct: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377

Query: 330 LHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKG 389
           LHS SKG+ GECG RGGY E +GF  E++Q I KL+SISLCS + GQALVDLM  PPKKG
Sbjct: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437

Query: 390 DESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEA 449
           + SYELD  ER+ I    K+R+ KLY +F  L+GV CQKPQGAMY+FP +  P   I  A
Sbjct: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497

Query: 450 INQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHEEF 509
            N +++PDEFYC  LL+ATGICTVPGSGFGQ+ GTYH+RTTFLAPG +W ++W+ FH EF
Sbjct: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557

Query: 510 FSKYQ 514
           F KY+
Sbjct: 558 FEKYR 562

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/499 (57%), Positives = 364/499 (72%), Gaps = 6/499 (1%)

Query: 20  LDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENI 79
           ++ +   +F P  K+TL DLN  ++K++YAVRG IP RAEEL+ +L       SL F  I
Sbjct: 1   MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQL--EKDPKSLPFNKI 58

Query: 80  VHANIGNPQQLDQKPLTFSRQVISILQYPELL---NQRNILVSTGIFKSDAMERAETLLC 136
           ++ANIGNPQQL QKPL+F R+V+SILQYP++L   ++   L+   +++ D + RA  LL 
Sbjct: 59  INANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLG 118

Query: 137 HIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKD 196
            IGGSVGAYS SQGV GI++TVA+YIT RD+GE A P+DIFLT G            C  
Sbjct: 119 EIGGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNG 178

Query: 197 KNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSV 256
             TGVLIPIPQYPLYTATITL  A  + YYLNEE  WS NT E+E  + ++I   +KP+ 
Sbjct: 179 PTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTT 238

Query: 257 MVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQ 315
           +V+INPGNPTGS+L++ DI +II I AKYG+++IADEVYQEN+F G EFHS+KKVLR LQ
Sbjct: 239 IVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQ 298

Query: 316 KQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITG 375
           ++Y G Y+ VQLASLHSTSKG+ GECGQRGGYMEL+G  D++R  ++KL SIS+CSV+TG
Sbjct: 299 RKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTG 358

Query: 376 QALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYL 435
           QAL+D++V+PP+ GDESYE+D  ER NI   L  R++KL+ LF  L+GVEC +PQGAMYL
Sbjct: 359 QALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYL 418

Query: 436 FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPG 495
           FPK  FPQ  I  A   +   D  YC  LLE TGICTVPGSGFGQK  TYHLRTTFL PG
Sbjct: 419 FPKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPG 478

Query: 496 NQWTEKWKLFHEEFFSKYQ 514
           + W + W+ FH EF  +Y+
Sbjct: 479 DSWIDLWRKFHTEFCERYR 497

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/489 (62%), Positives = 374/489 (76%), Gaps = 3/489 (0%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
           NFKPA K+T++DLN+NVLK++YAVRG IP RAE L+ +L++N SS  L F+ +++ANIGN
Sbjct: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSS--LPFKKVINANIGN 92

Query: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146
           PQQL+QKPLTF RQV+S+LQYP +L++     +  ++K DA+ERA+ +L  IG SVG+YS
Sbjct: 93  PQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGSYS 152

Query: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIP 206
           SSQGV+G+R+TVA YI+ RD GE A  +DIFLT G            CK K +GVLIPIP
Sbjct: 153 SSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIP 212

Query: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266
           QYPLYTAT+ L +   LPYYL E SGWSTN  EIE VV +AI + + P V+VVINPGNPT
Sbjct: 213 QYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPT 272

Query: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325
           G++LS + I  I ++ A +GIV+IADEVYQENIF G EFHSMKKVLR LQ++ PGKY+ V
Sbjct: 273 GAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENV 332

Query: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385
           QLASLHSTSKGVSGECGQRGGYMEL GF  EI+  ILKL SISLC V+TGQALVDLM  P
Sbjct: 333 QLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCP 392

Query: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445
           PKKG+ SYE D  ER  IH  L ERA  L+  F +++GV CQKPQG+MYLFPK+  P   
Sbjct: 393 PKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKA 452

Query: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505
           + +A   +++PDE YC  LLEATGICTVPGSGFGQK GT+HLRTTFLAPG  W ++W+ F
Sbjct: 453 LEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREF 512

Query: 506 HEEFFSKYQ 514
           H+ F +KY+
Sbjct: 513 HQIFCNKYR 521

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/483 (61%), Positives = 357/483 (73%), Gaps = 4/483 (0%)

Query: 33  KITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQLDQ 92
           K TL D+NQ VL ++YAVRG IP RAEEL  +L+  +   SL F  I++ANIGNPQQLDQ
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLV--EEPGSLPFNKIINANIGNPQQLDQ 96

Query: 93  KPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSSQGVY 152
           KPLTF RQV+S+LQ P L+          +FK DA+ERA+ +L  +GGSVGAYS+SQGV 
Sbjct: 97  KPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVA 156

Query: 153 GIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYT 212
           G R++VA +I  RD GE AS +DIFLT G            C     G LIPIPQYPLYT
Sbjct: 157 GFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYT 215

Query: 213 ATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSK 272
           AT+ L DA  LPYYL+E SGWS +T ++E+VV DAI   V+P+ +VVINPGNPTG++LS 
Sbjct: 216 ATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSP 275

Query: 273 DDIIHIINIGAKYGIVLIADEVYQENIFD-GEFHSMKKVLRSLQKQYPGKYDAVQLASLH 331
           + I  I+ + AKY +V+IADEVYQEN FD  +F SMKKVLR LQK  PGKYD VQLASLH
Sbjct: 276 EAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLH 335

Query: 332 STSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKGDE 391
           STSKGVSGECGQRGGYMELVGF +E++Q  LKLASISLC V+TGQALVDLMV PPKKGD 
Sbjct: 336 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDA 395

Query: 392 SYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEAIN 451
           SYELD  ER  IH +L +++  LY  F  L+GV CQKPQGAMYLFPKL   +  I +A +
Sbjct: 396 SYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAES 455

Query: 452 QNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHEEFFS 511
             M+PDE+YC  LLEATGICTVPGSGF Q  GTYHLRTTFLAPG +W + WK FH++F  
Sbjct: 456 LGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVD 515

Query: 512 KYQ 514
           +++
Sbjct: 516 EHR 518

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/500 (59%), Positives = 368/500 (73%), Gaps = 7/500 (1%)

Query: 12  QYFPVRKALDDDTIHNFKP-AKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDS 70
           ++   R  L  D  ++ KP   K TL D+N+ VL ++YAVRG IP RAEEL+ +LL  + 
Sbjct: 18  RHLSTRPGLRKD--YSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLL--EE 73

Query: 71  SDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMER 130
             SL F+ I++ANIGNPQQLDQKPLTF RQV+++LQ P+L++  +       FK DA+ER
Sbjct: 74  PGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVER 133

Query: 131 AETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXX 190
           A+ +L  +GGSVGAYS+SQGV G RE+VA +I  RD GE AS  DIFLT G         
Sbjct: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192

Query: 191 XXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIAD 250
              C     G LIPIPQYPLYTA++ L ++  LPYYL+EESGWS +T +IEKVV D+I  
Sbjct: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252

Query: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKK 309
            ++P+ +VVINPGNPTG++L+ D I ++I + AKY +V+IADEVYQEN F D EF SMKK
Sbjct: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312

Query: 310 VLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISL 369
           VLR LQK  PGKYD VQLASLHSTSKGVSGECGQRGGYMELVGF +E++Q  LKLASISL
Sbjct: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372

Query: 370 CSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKP 429
           C V+TGQAL+DLMV PPKKGD SYE D  ER +IH+ L +R+  LY  F  ++GV CQ+P
Sbjct: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432

Query: 430 QGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRT 489
           QGAMYLFPKL      I +A +  ++PDE+YC  LLEATGICTVPGSGFGQ  GT+HLRT
Sbjct: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492

Query: 490 TFLAPGNQWTEKWKLFHEEF 509
           TFLAPG +W + WK FHE+F
Sbjct: 493 TFLAPGTEWIDSWKKFHEKF 512

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/489 (58%), Positives = 366/489 (74%), Gaps = 5/489 (1%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
            F+P   + L+DLN NVL+++YAVRG IP RA ELE +L  +   DSL F+ I++ANIGN
Sbjct: 49  RFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQL--SRDPDSLPFKKIIYANIGN 106

Query: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146
           PQQL QKPL+FSR+V+S+L+ P LL Q  + V   I+K DA+ RA+ ++  +  S+GAYS
Sbjct: 107 PQQLGQKPLSFSREVLSLLESPNLL-QMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYS 165

Query: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIP 206
            SQGV G R+TVA Y+++RD GE AS +DIFLT G            CK + +GVLIPIP
Sbjct: 166 HSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224

Query: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266
           QYPLYTATITL +   LPYYL+EESGWS N +++E++++++I   VKP+ +VVINPGNPT
Sbjct: 225 QYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPT 284

Query: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325
           G++L  + +  I  I AKY IV+IADEVYQEN+F+G +F+SMKKVLRSLQ++Y   +  V
Sbjct: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344

Query: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385
           QL SLHSTSKG+SGECGQRGGYMELVGF D+IR+ ILK+ASI LCS + GQALVDLM++ 
Sbjct: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSR 404

Query: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445
           PK GDESYE D  ER +I   L+ER++ L+  F  L+GVEC+KPQG+MYLFP+L  PQ  
Sbjct: 405 PKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKA 464

Query: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505
           I  A + +M PDEFYC  LL +TGICTVPGSGFGQ   T HLRTTFL PG +W E W+LF
Sbjct: 465 IKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELF 524

Query: 506 HEEFFSKYQ 514
           H+ F+ KY+
Sbjct: 525 HKSFYDKYR 533

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/489 (58%), Positives = 356/489 (72%), Gaps = 5/489 (1%)

Query: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86
            F PA+ +TL D+N+NV+K++YAVRG IP RAEELE  L  +  S  L F  I+ ANIGN
Sbjct: 36  RFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGS--LPFSKIIQANIGN 93

Query: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146
           PQQL QKPLTF RQVIS++Q P+LL      +    FK+D + RA  +L   GGSVGAYS
Sbjct: 94  PQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA-FKADVVVRARRMLQDAGGSVGAYS 152

Query: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIP 206
           +SQGV G R TVA +I  RD G  A+PD+++LT G            CK   TGVLIPIP
Sbjct: 153 ASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIP 211

Query: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266
           QYPLYTATIT  +A  LPYYLNE  GWSTN +E+E+V+LD+   N+ P  +VVINPGNPT
Sbjct: 212 QYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPT 271

Query: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDAV 325
           GSVLS  D+  I+ + AKYGIV+IADEVYQ+N+F D +FHSM+KVL++LQ + P  Y  V
Sbjct: 272 GSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNV 331

Query: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385
           QLASLHS SKG+SGECGQRGGYMEL+GF++E+R+  +KLASISLC V+TGQALVDLMV P
Sbjct: 332 QLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGP 391

Query: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445
           P +GD SYE    E ++I+  L+ER++ L+  FC L+G+EC  PQGA+YLFPKLH PQ  
Sbjct: 392 PSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKA 451

Query: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505
           I  A    +  DE YC  LL+ TGICTVPG+GFGQ  GTYH+RTTFL PG +W E WK F
Sbjct: 452 IEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDF 511

Query: 506 HEEFFSKYQ 514
           H++F+ KY+
Sbjct: 512 HKKFYDKYR 520

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 107/242 (44%), Gaps = 29/242 (11%)

Query: 246 DAIADNVKPSVMVVIN-PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEF 304
           +AI D  K    V+IN P NP G V +++++  I  I  K  +V+I+DEVY+   F   F
Sbjct: 192 NAITDKTK---AVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDSF 248

Query: 305 HSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVS-GECGQRGGYMELVGFKDEIRQAILK 363
             +  +   + +            +L   S G S    G R G++  V    E+   + K
Sbjct: 249 TRIATLSPEIGQ-----------LTLSVGSAGKSFAATGWRVGWV--VSLNPELLSYVSK 295

Query: 364 LASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKG 423
            A   +C   +   L + + N     +++ E++ FE  N+ +  K + +   ++F +L G
Sbjct: 296 -AHTRIC-FASPSPLQEAVAN---SINDALEINYFE--NMRQEYKHKYDIFTSVFKEL-G 347

Query: 424 VECQKPQGAMYL---FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQ 480
           +   +P+G  ++   F K+  P+         N + D    + L+   G+  +P + F  
Sbjct: 348 LPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRIAYWLINELGVVAIPPTEFYI 407

Query: 481 KE 482
           KE
Sbjct: 408 KE 409

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/296 (21%), Positives = 119/296 (40%), Gaps = 41/296 (13%)

Query: 201 VLIPIPQYPLYTATITLCDAKMLPYYLN----------EESGWSTNTNEIEKVVLDAIAD 250
           V++  P +  Y + I L   K++   +N          E + W+ +  + +    +AI  
Sbjct: 143 VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVDMEQFK----NAITS 198

Query: 251 NVKPSVMVVIN-PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKK 309
             K    V+IN P NP G V ++++++ I NI  +  +++I+DEVY+   F  EF  +  
Sbjct: 199 KTK---AVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHLYFTDEFTRIAT 255

Query: 310 VLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISL 369
           +   +           QL     ++       G R G++  +    E+ Q + K A   +
Sbjct: 256 LSPEIG----------QLTLTVGSAGKTFAATGWRIGWV--ISLNSELLQYVSK-AHTRI 302

Query: 370 CSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKP 429
           C   +   L +   N      ES   +   ++ I +       K++    +  G+   KP
Sbjct: 303 C-FASPSPLQEACANSINDALESNYFEKMRQEYIQKF------KIFTSVFEELGLPYTKP 355

Query: 430 QGAMYL---FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKE 482
           +G  ++   F K+  P+         N   D    H L+   G+  +P + F  KE
Sbjct: 356 EGTYFVLADFSKVKIPEDYPYPKEILNKGKDFRISHWLINELGVVAIPPTEFYIKE 411

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 74/167 (44%), Gaps = 18/167 (10%)

Query: 145 YSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIP 204
           Y + QG + +R+ +A   +  D   T S +++ LT G                +  + I 
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 205 IPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVI--NP 262
            P Y   ++   +  A++   +L +E+ +  N  E+E+++        KP+   ++   P
Sbjct: 113 -PTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMI--------KPNTKCIVLNTP 163

Query: 263 GNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKK 309
            NP  SV+  + +  I  +  K+GIV+  DEVY        FHS +K
Sbjct: 164 NNPLSSVIPTETLREIAELADKHGIVVFCDEVYSP-----LFHSCEK 205

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 233 WSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIAD 292
           W+ N +E+E  +        K   +++  P NP G V ++++++ I  I  K+ +V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 293 EVYQENIFDGEF 304
           EVY+   F  EF
Sbjct: 237 EVYEHLYFTPEF 248

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 18/119 (15%)

Query: 198 NTG--VLIPIPQYPLYTATITLCDAKML------PYYLNEESG----WSTNTNEIEKVVL 245
           N+G  V++  P +  Y   I LC  K++      P  L++ +     W+ +  + EK + 
Sbjct: 137 NSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAIT 196

Query: 246 DAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEF 304
                  K   +++  P NP G V + D++  + NI  K+ +V+I+DEVY+   F   F
Sbjct: 197 S------KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTDSF 249

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 170 TASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLN- 228
           T  P+++ +T G              ++N  V++  P +  Y   I LC  K++   +N 
Sbjct: 111 TLKPENVLVTTGANEGILACLMGIL-NQNDEVIVFEPFFDQYIPNIELCGGKVVYVPINP 169

Query: 229 ---------EESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHII 279
                    + + W+ +  + E V+ +      K   +++  P NP G V +++++  I 
Sbjct: 170 PKDLDKRVTKGTEWTLDFEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIG 223

Query: 280 NIGAKYGIVLIADEVYQENIFDGEF 304
           +I  K+ +++I+DEVY    F  EF
Sbjct: 224 DICVKHNVIIISDEVYDNLYFVDEF 248

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 103/243 (42%), Gaps = 47/243 (19%)

Query: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKV 310
           N K   +++ +P NP G V ++++++ + NI  + GI +I+DEVY+   F  EF  +  +
Sbjct: 210 NEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTDEFTRIATL 269

Query: 311 LRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLC 370
              +              S H+ + G +G+     G+   +G+     + +L LAS    
Sbjct: 270 SEEI--------------SQHTLTVGSAGKSFAATGWR--IGWVISRNKELLALAS---- 309

Query: 371 SVITGQALVDLMVNPPKKGDES------YELDNFERKNIHETLKERAEKLYNLFCQLKGV 424
                +A V +  + P    E+      + L      +     +++ E+    F  L G+
Sbjct: 310 -----KAHVRICFSSPAPLQEACAVAIEHALKTTYYADTRAAYQKKYERFQKPFDDL-GL 363

Query: 425 ECQKPQGAMYL---FPKL------HFPQTLITEAINQNMSPDEFYCHALLEATGICTVPG 475
              + +G+ +L   F +L      HFP+ L  +  +  ++      + L+   G+  +P 
Sbjct: 364 PYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRVA------YWLINELGLVAIPC 417

Query: 476 SGF 478
           S F
Sbjct: 418 SSF 420

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 16/114 (14%)

Query: 201 VLIPIPQYPLYTATITLCDAKML------PYYLNEESG----WSTNTNEIEKVVLDAIAD 250
           V++  P +  Y   I LC  K++      P  L++ +     W+ +  + EK +      
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS---- 197

Query: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEF 304
             K   +++  P NP G V +++++  + NI  K+ +V+I+DEVY+   F   F
Sbjct: 198 --KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSF 249

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/295 (19%), Positives = 120/295 (40%), Gaps = 39/295 (13%)

Query: 201 VLIPIPQYPLYTATITLCDAKMLPYYLN----------EESGWSTNTNEIEKVVLDAIAD 250
           V++  P +  Y + I LC  K++   +N              W+ +  + EK +      
Sbjct: 142 VIVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRNTRGEEWTIDFEQFEKAITP---- 197

Query: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKV 310
             K   +++  P NP G V +++++  + NI  K+ +++I+DEVY+   F   F  +  +
Sbjct: 198 --KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTDSFTRIATI 255

Query: 311 LRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLC 370
              +           QL     ++  +    G R G++  V    ++   + K A   +C
Sbjct: 256 SPEIG----------QLTLTVGSAGKLFAATGWRIGWV--VSLNADLLSYVSK-AHTRIC 302

Query: 371 SVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQ 430
              +   L +   N     D+  ++  FE+  + +    + +   ++F +L G+    P+
Sbjct: 303 -FSSPSPLQEACAN---SIDDGLKIGYFEK--MRQEYITKFKIFTSIFDEL-GLPYTAPE 355

Query: 431 GAMYL---FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKE 482
           G  ++   F K+  P+        ++   D    H L+   G+  +P + F  KE
Sbjct: 356 GTYFVLVNFSKVKIPKDYSYPEEIRDKGKDFRISHWLINELGVVAIPPTEFYIKE 410

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 12/116 (10%)

Query: 198 NTG--VLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLD------AIA 249
           N+G  V++  P +  Y   I LC  K++   +N          + E+  +D      AI 
Sbjct: 153 NSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTIDFEQFENAIT 212

Query: 250 DNVKPSVMVVIN-PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEF 304
              K    V+IN P NP G V +++++  + NI  K+ +V+I+DEVY+   F   F
Sbjct: 213 SKTK---AVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLFFTDSF 265

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/262 (18%), Positives = 115/262 (43%), Gaps = 47/262 (17%)

Query: 233 WSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIAD 292
           W+ + +E+   +        K   +++  P NP G V ++++++ I NI  +  +V+I+D
Sbjct: 187 WTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISD 240

Query: 293 EVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVG 352
           EVY+   F  EF  +  +             + ++ +L + S G +G+     G+   +G
Sbjct: 241 EVYEHLYFTSEFTRIATL-------------SPEIGNL-TLSVGSAGKTFAATGWR--IG 284

Query: 353 FKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAE 412
           +       +LK AS++   +             P +   +  ++   + N  E +++   
Sbjct: 285 WIVSQNAELLKYASMAHTRICFASP-------SPFQEACAKSIEIALQNNYFEKMRQEYI 337

Query: 413 KLYNLFCQL---KGVECQKPQGAMYL---FPKLH------FPQTLITEAINQNMSPDEFY 460
             +++F ++    G+   +P+G  ++   F K+       FP+ L+++A +  +S     
Sbjct: 338 NKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKAKDFRIS----- 392

Query: 461 CHALLEATGICTVPGSGFGQKE 482
            + L+   G+  +P + F  +E
Sbjct: 393 -YWLINELGVVAIPPTEFYIQE 413

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/300 (18%), Positives = 123/300 (41%), Gaps = 57/300 (19%)

Query: 201 VLIPIPQYPLYTATITLCDAKMLPYYLN----------EESGWSTNTNEIEKVVLDAIAD 250
           V++  P +  Y   I LC  K++   +N          + + W+ + +E  + +      
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP---- 197

Query: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKV 310
             K   +++  P NP G V +++++  + NI  +  +++IADEVY+   F  EF  +  +
Sbjct: 198 --KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYFVDEFPRIATL 255

Query: 311 LRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLC 370
              + +               + S G +G+     G+   +G+       +L+ AS    
Sbjct: 256 SEEIGQL--------------TLSVGSAGKSFAATGWR--IGWVVSQNPDLLQYAS---- 295

Query: 371 SVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQL---KGVECQ 427
                   +      P +   SY +D+  + +  E +++   K + +F  +    G+   
Sbjct: 296 ---KAHTRICFASPSPIQEACSYSIDHALKIDYFENMRQEYVKKFKIFTSVFDELGLPYT 352

Query: 428 KPQGAMYL---FPKL------HFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGF 478
            P+G+ ++   F K+       FP+ ++++  +  +S      + L+   G+  +P + F
Sbjct: 353 IPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKDFRIS------NWLINELGVVAIPPTEF 406

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 109/276 (39%), Gaps = 41/276 (14%)

Query: 235 TNTNEIEKVVLDA-----------IADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGA 283
           TN N+ +K +L+A            A   K  +M++ NP NP G V ++D+++ +  +  
Sbjct: 152 TNPNQGKKRILEANDWILDRETLRAAFTDKTKLMIINNPNNPLGKVFNRDELLEMATLCV 211

Query: 284 KYGIVLIADEVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKG-VSGECG 342
             G  +IADEVY+   F     S    L           +A+   ++   S G +    G
Sbjct: 212 NNGAYIIADEVYEFLQFTPNPLSRISNLS----------EAIAQKTITIGSAGKIFRVTG 261

Query: 343 QRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKGDESYELDN-FERK 401
            R G+M +   ++ + +       +  CS    Q    L +    +      + N F+RK
Sbjct: 262 WRVGWM-ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGIQRALECGYFLSMPNEFDRK 320

Query: 402 NIHETLKERAEKLYNLFCQLKGVECQKPQGAMYL---FPKLHFPQTLITEAINQNMSPDE 458
                       +Y     L GV   KPQGA ++   F K+  P+        +N + D 
Sbjct: 321 ---------FSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYLKNRARDF 370

Query: 459 FYCHALLEATGICTVPGSGF----GQKEGTYHLRTT 490
           F  + L +   I  +P S F     +K    +LR T
Sbjct: 371 FISYWLTQEFCILLLPCSEFYCEEHRKNSETYLRIT 406

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 97/225 (43%), Gaps = 49/225 (21%)

Query: 231 SGWSTNTNEIEKVVLDAIADNVKPSVMVVIN-PGNPTGSVLSKDDIIHIINIGAKYGIVL 289
           S W+ + ++       AI++  K    V+IN P NPTG V ++++++ + NI  +  + +
Sbjct: 166 SEWTLDFDQFR----SAISEKTK---AVIINSPHNPTGKVFTREELLTLGNICVEKNVYI 218

Query: 290 IADEVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYME 349
           I+DEVY+   F  E                     V+LASL      ++   G  G    
Sbjct: 219 ISDEVYENLYFTPE--------------------CVKLASLSPEISNITLTIGSAGKIFA 258

Query: 350 LVGFKDEI----RQAILKLASISLCSVITGQALVDLMVNPPKKG-----DESYELDNFER 400
           + G++          +LKLAS +   +           +PP+       D +   D F+R
Sbjct: 259 VTGWRIGWIISENVELLKLASSAHIKICFSSP------SPPQLACAHAIDIALNSDYFDR 312

Query: 401 KNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYL---FPKLHFP 442
             + +   E+ E L ++F +L G+    P+G+ ++   F KL  P
Sbjct: 313 --MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/294 (19%), Positives = 115/294 (39%), Gaps = 37/294 (12%)

Query: 201 VLIPIPQYPLYTATITLCDA--KMLPYYLNEESGWSTNTNEIEKVVLDAIAD--NVKPSV 256
           V++  P +  Y   I LC    + +P +  +E      T +  ++  DA+    N K   
Sbjct: 131 VIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKA 190

Query: 257 MVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRSLQK 316
           +++  P NP G V ++ ++  +  +  ++  V+I+DEVY+   F   F  +  +      
Sbjct: 191 VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTESFPRIANI------ 244

Query: 317 QYPGKYDAVQLASLHSTSKGVSGECGQRGGYM-----ELVGFKDEIRQAILKLASISLCS 371
                 D   L     ++       G R G++     +L+ +  +    I   +   L  
Sbjct: 245 ----NEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLNYVSKAHTRICFASPSPLQE 300

Query: 372 VITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQG 431
              G              + + ++D F +  + E  +++ E L   F +L G+   +P+G
Sbjct: 301 ACAGSI------------EHALKIDYFPK--MREEYRKKFEILTTAFDKL-GLNYTQPEG 345

Query: 432 AMYL---FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKE 482
             ++   F K+  P+  +        + D    + L+   GI  +P + F  KE
Sbjct: 346 TYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEFYIKE 399

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 110/257 (42%), Gaps = 33/257 (12%)

Query: 245 LDAIADN-----VKPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADE----- 293
           L+AI DN      KP ++  I  G NPTGS LS D  + I  I  K+ +++I DE     
Sbjct: 196 LEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPYYFL 255

Query: 294 ---VYQENIF---DGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGY 347
               YQ+++    +  F S +  + SL K +       ++  L S SK +    G R G+
Sbjct: 256 QMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG--PGTRLGW 313

Query: 348 MELVGFKDEIRQAILKLASISLCSVIT-GQALVDLMVNPPKKGDESYELDNFE--RKNIH 404
             +VG K +I Q   +L  +++ +     QA+V   +N  + G + + LD     R+  +
Sbjct: 314 --IVGSK-KILQKYTQLHEMTIQNPSGFSQAIVAGTLN--RWGQDGF-LDWLVGLRREYN 367

Query: 405 ETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHAL 464
           E      + LY    +        P   M+    ++   +   E   +  S  E    A+
Sbjct: 368 EKRDVAIDALYKYLPETPAFTINPPIAGMFF--TVNTDASAHPEFATKYQSKPELVEQAI 425

Query: 465 LE---ATGICTVPGSGF 478
            E   A+G+  VPG  F
Sbjct: 426 YEKVIASGVLVVPGVWF 442

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/259 (19%), Positives = 107/259 (41%), Gaps = 33/259 (12%)

Query: 229 EESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIV 288
           E + W+ + +E+   +        K   +++  P NP G V ++++++ I  I  +  +V
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 289 LIADEVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYM 348
           +I+DEVY+   F  EF  +  +   + +               + + G +G+     G+ 
Sbjct: 233 IISDEVYEHLYFTPEFTRVATLSPEIGQI--------------TLTIGSAGKSFAATGWR 278

Query: 349 ELVGFKDEIRQAILKLASISLCSVI--TGQALVDLMVNPPKKGDESYELDNFERKNIHET 406
             +G+   +   +L+ AS++   +   +   L +   N          LDN   K + E 
Sbjct: 279 --IGWIVSLNPELLEYASMAHTRICFASPSPLQEACAN-----ALPIALDNGYFKKMREE 331

Query: 407 LKERAEKLYNLFCQLKGVECQKPQGAMYL---FPKLHFPQTLITEAINQNMSPDEFYCHA 463
              +      +F +L G+   KP+G  ++   F K+  P+        ++ + D    + 
Sbjct: 332 YIHKFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYW 390

Query: 464 LLEATGICTVPGSGFGQKE 482
           L+   G+  +P + F  KE
Sbjct: 391 LINELGVVAIPPTEFYIKE 409

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

Query: 169 ETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYL- 227
           E  + D++ L  G            C+ +   +L   P Y +Y+    + D +++   L 
Sbjct: 80  EPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLI 139

Query: 228 NEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGI 287
            E++ +  N  E    VL  + ++ K  ++ + +PGNPTG +++K DI  I+      G+
Sbjct: 140 TEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILE-NWTNGL 194

Query: 288 VLIADEVYQENI-FDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGG 346
           V++ DE Y +    +G  +SM K    L  +YP       L  L + SK   G  G R G
Sbjct: 195 VVV-DEAYIDFADAEGTTYSMAK----LVTKYP------NLTVLQTLSKSF-GLAGIRLG 242

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 94/233 (40%), Gaps = 23/233 (9%)

Query: 253 KPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLR 312
           K   ++V +P NP G V +K+++  +  I  +  +++I+DEVY+   F+  F  +  +  
Sbjct: 202 KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYEFLYFNDSFTRIATLSP 261

Query: 313 SLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSV 372
            +           QL     ++       G R G++  +    E+ Q + K A   +C  
Sbjct: 262 EIG----------QLTLTVGSAGKTFAATGWRIGWV--ISQNPELLQYVSK-AHTRIC-F 307

Query: 373 ITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGA 432
            +   L +   N      ES   +   ++ + +       K++N   +  G+   KP+G 
Sbjct: 308 ASPSPLQEACANSINDALESGYFEKMRKEYVQKF------KIFNAVFEELGLPYTKPEGT 361

Query: 433 MYL---FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKE 482
            ++   F K+  P+         +   D    H L+   G+  +P + F  KE
Sbjct: 362 YFVLADFSKVKIPEDYPWPEEILDKGKDFRISHWLINELGVVAIPPTEFYIKE 414

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/257 (19%), Positives = 102/257 (39%), Gaps = 37/257 (14%)

Query: 233 WSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIAD 292
           W  + + +EK +      N +   +++  P NP G V ++++++ +  I     IV+I+D
Sbjct: 173 WEIDWDILEKTI------NSRTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISD 226

Query: 293 EVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVG 352
           EVY+   F  EF  +  +   +           QL     ++       G R G+   V 
Sbjct: 227 EVYEHLYFSDEFPRIATLSPEIG----------QLTFAVGSAGKTFAATGWRIGWT--VS 274

Query: 353 FKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAE 412
              E+   + K A   +C               P +   ++ L   ++ +  ET+++   
Sbjct: 275 LNKELLNYVAK-AHTRIC----------FSSPSPFQEAIAHALPEAQKIDYFETMRQEYI 323

Query: 413 KLYNLFCQLKGVECQKP----QGAMYL---FPKLHFPQTLITEAINQNMSPDEFYCHALL 465
           + + +F  +   E   P    +G+ ++   F K+  P+  +     Q  + D    + L+
Sbjct: 324 QKFKIFTAVFD-ELNMPYTVAEGSYFICVNFSKVKIPEDYVFPQELQEKAKDFRISYWLM 382

Query: 466 EATGICTVPGSGFGQKE 482
              G+  +P + F  KE
Sbjct: 383 NELGVVAIPPTEFYIKE 399

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 71/172 (41%), Gaps = 27/172 (15%)

Query: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265
           P Y   ++  ++  A +   +L  E G++ N  +++  V            +V+ NP NP
Sbjct: 113 PTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKV------RANTKYIVLNNPNNP 166

Query: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKK------------VLRS 313
            GSV+S + +  II+   +  I ++ DEVY        FHS ++            V  S
Sbjct: 167 LGSVISTEKMTEIIDYAERNEIFIVCDEVYSP-----LFHSSEQPKSACQLSNRCIVTGS 221

Query: 314 LQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGY--MELVGFKDEIRQAILK 363
           + K Y      V+L  + S  K    +   R  +  + +    D I Q ILK
Sbjct: 222 MSKAYSAA--GVRLGWIVSRDKDFLKQAASRRDFNTISVSIIDDYISQYILK 271

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 110/258 (42%), Gaps = 35/258 (13%)

Query: 245 LDAIADN-----VKPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY--- 295
           L+ I DN      KP ++  +  G NPTGS LS D    I  I  K+  ++I DE Y   
Sbjct: 195 LETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFL 254

Query: 296 --------QENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGY 347
                     N     +   K+ +++L+K +       ++  L S SK ++   G R G+
Sbjct: 255 QMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA--PGTRFGW 312

Query: 348 MELVGFKDEIRQAILKLASISL-CSVITGQALVDLMVNPPKKGDESYELDNFERKNIHET 406
             +VG KD I   IL L  +++       Q+++   +N  + G E Y LD       HE 
Sbjct: 313 --IVGAKD-ILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGY-LDWLIGLR-HEY 365

Query: 407 LKER---AEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHA 463
            K+R    + LY    Q+  ++   P   M+    ++   +   E   +  S  E    A
Sbjct: 366 TKKRDCCIDALYKYLPQVDYIKINPPIAGMFF--TVNIDASKHPEFATKYGSDPEKVEKA 423

Query: 464 LLE---ATGICTVPGSGF 478
           + +   A+G+  VPG+ F
Sbjct: 424 IFDRSIASGVLVVPGNWF 441

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 94/239 (39%), Gaps = 31/239 (12%)

Query: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKV 310
           N +   +++  P NP G V +++++  + +I  K  I +I+DEVY+   F  EF      
Sbjct: 196 NERTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGDEF------ 249

Query: 311 LRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLC 370
                          ++A++      ++   G  G      G++  I   + + A + L 
Sbjct: 250 --------------TRIATISKEIGDLTLSVGSAGKSFAATGWR--IGWVVSRNAEL-LS 292

Query: 371 SVITGQALVDLMVNPPKKGDESYELD----NFERKNIHETLKERAEKLYNLFCQLKGVEC 426
            V      +      P +   ++ +D    N   +N+ E  KE+   L  +F +L G+  
Sbjct: 293 YVSKAHTRICFSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDEL-GLPY 351

Query: 427 QKPQGAMYL---FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKE 482
            KP G  ++   F K+  P            + D    + L+   G+  +P + F  KE
Sbjct: 352 TKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVAIPPTEFYIKE 410

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/245 (19%), Positives = 105/245 (42%), Gaps = 39/245 (15%)

Query: 249 ADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMK 308
           A N K   +++  P NP G V ++ ++  + +I  K  +V+I+DEVY+   F   F  + 
Sbjct: 185 AMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKDSFTRIA 244

Query: 309 KVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASIS 368
            +             + ++  L  T  G +G+     G+   +G+   + Q +L  A+ +
Sbjct: 245 TL-------------SPEIGQLTLTV-GSAGKSFAATGWR--IGWALSLNQELLSYAAKA 288

Query: 369 LCSV--ITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVEC 426
              +   +   L + + N     +++ +++ F+   +    K   E   N+  +L G+  
Sbjct: 289 HTRICFASPSPLQEAVAN---AFNDAEKVEYFKETRLQYIRK--YEIFTNVLNEL-GLPY 342

Query: 427 QKPQGAMYLF---------PKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSG 477
            +P+G  ++          P   +P+ L+ +A +  +S      + L+   G+  +P + 
Sbjct: 343 TEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRIS------YWLMNELGVVAIPPTE 396

Query: 478 FGQKE 482
           F  KE
Sbjct: 397 FYIKE 401

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 77/178 (43%), Gaps = 24/178 (13%)

Query: 172 SPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPY-YLNEE 230
           S D++ L  G            C      +LI  P Y +Y+    + D +++    + E+
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 231 SGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKY--GIV 288
           + +  NT++    V++ +  +    +  V +PGNPTG+++   DI  I  I +++  GIV
Sbjct: 146 NSFQMNTDK----VIETLQGDSNIKIAFVTSPGNPTGALI---DIASIEKILSQWQSGIV 198

Query: 289 LIADEVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGG 346
            I DE Y       +F S       L  +YP       LA L + SK   G  G R G
Sbjct: 199 AI-DEAYI------DFCSTGGSAAPLVNKYP------NLAVLQTLSKSF-GLAGVRLG 242

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 106/257 (41%), Gaps = 33/257 (12%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY--- 295
           L+AI DN      KP ++  I  G NPTGS LS D    I  I  K+  ++I DE Y   
Sbjct: 196 LEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFL 255

Query: 296 QENIFDG--------EFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGY 347
           Q + ++         EF S  + + SL K +       ++  + S SK +    G R G+
Sbjct: 256 QMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVLG--PGTRLGW 313

Query: 348 MELVGFKDEIRQAILKLASISLCSVIT-GQALVDLMVNPPKKGDESYELDNF--ERKNIH 404
             LVG K  I +A  +L  +++ +     QA+V   +N  + G   + LD     R+  +
Sbjct: 314 --LVGSK-RILRAYTQLHEMTIQNPSGFSQAIVSGTLN--RWGQHGF-LDWLIGLRQEYN 367

Query: 405 ETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHAL 464
           E      + LY        +    P   M+    ++   +   E   +  S  E    A+
Sbjct: 368 EKRDVAIDALYKYVPSTPALTVTPPIAGMFF--TVNIDASAHPEFATKYQSKPELVEQAI 425

Query: 465 LE---ATGICTVPGSGF 478
            E   A G+  VPG  F
Sbjct: 426 YEKVIACGVLVVPGIWF 442

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 78/349 (22%), Positives = 131/349 (37%), Gaps = 69/349 (19%)

Query: 144 AYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLI 203
           +Y + +G   +R ++A+       G   + DDI LT G                +  + +
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICV 108

Query: 204 PIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPG 263
             P Y    +   +  A++    L +E  +  N   ++ +    I +N K  ++++ NP 
Sbjct: 109 E-PTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSM----IKNNTK--LIIINNPN 161

Query: 264 NPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-----------EFHSMKKVLR 312
           NP GSV+ KD +  I  +  +  I L +DEVY+  IF             E +S   V  
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYRP-IFHSLEDEMVPPSACELYSKAIVSG 220

Query: 313 SLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSV 372
           S+ K Y      ++L  L S  K    +   R  Y                + S+S+   
Sbjct: 221 SMSKAY--SVAGIRLGWLVSKDKQFLRDAASRRDY---------------NMISVSMIDD 263

Query: 373 ITGQALVDLMVNPPKKGDESYEL--DNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQ 430
              Q ++D   N       +YEL  +NF   N  + + E ++K +  +         KP 
Sbjct: 264 QIAQYVLD---NREYVIKRNYELCLNNFRLLN--DFMDEHSDK-FEFY--------HKPT 309

Query: 431 GAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFG 479
            A     K+        + +N  M    F    L E  G+  VPG  FG
Sbjct: 310 AATVCLAKV--------KGVNDTMKFATF----LAEKYGVLAVPGEAFG 346

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 229 EESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIV 288
           E   W+ +  E+ K      A   K   +++  P NP G V +K+++  I N+  +  +V
Sbjct: 187 EGKDWTIDYEELAK------AFTSKTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVV 240

Query: 289 LIADEVYQ 296
           +I+DEVY+
Sbjct: 241 IISDEVYE 248

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 20/114 (17%)

Query: 194 CKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVK 253
           C D     L  +P+  ++ A ++L         L +E G+  N   ++K+    I  N K
Sbjct: 107 CVDPTYAQLYSVPK--MFGAEVSLLK-------LQKEDGFIPNIETLKKM----IKSNTK 153

Query: 254 PSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSM 307
             ++++ NP NP GS +S + +  I  +  +  I L  DEVY+       FHSM
Sbjct: 154 --LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDEVYKP-----IFHSM 200

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 82/201 (40%), Gaps = 32/201 (15%)

Query: 159 ANYITARDNGETASPD----DIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYT-- 212
           A+Y  ++DN     PD    ++ L  G            CK     +++  P Y +Y+  
Sbjct: 67  AHYRNSKDNTANV-PDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVC 125

Query: 213 ATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSK 272
           A I   D    P  + + S        +E +  D +       ++ + +PGNPTG +++ 
Sbjct: 126 ANINDVDVVNCPLIVEDNSFQMDVKRTLETLKKDDLI-----RLLFITSPGNPTGKIIAI 180

Query: 273 DDIIHIINIGAKYGIVLIADEVY-------QENIFDGEFHSMKKVLRSLQKQYPGKYDAV 325
            DII+++    K G+V++ DE Y        E     E+ S+ K    L  +YP      
Sbjct: 181 KDIIYVLE-HWKNGLVVV-DEAYVDFSTYFNEETKKTEYFSVAK----LVTKYPN----- 229

Query: 326 QLASLHSTSKGVSGECGQRGG 346
            L  L + SK   G  G R G
Sbjct: 230 -LTVLQTLSKSF-GLAGIRLG 248

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 69/148 (46%), Gaps = 12/148 (8%)

Query: 154 IRETVANYI--TARDNGETASP---DDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQY 208
           ++E +ANY   T+    E  +P    +I L  G            C  K   VL+  P Y
Sbjct: 63  LKELMANYRNNTSAFKSEGLAPISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTY 122

Query: 209 PLYTATITLCDAKMLPYYL-NEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTG 267
            +Y+    + D +++   L  E++ +  + +     VL+ ++++    ++ +  PGNPTG
Sbjct: 123 SMYSVFAMINDTEVVECPLITEDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTG 178

Query: 268 SVLSKDDIIHIINIGAKYGIVLIADEVY 295
           + +S   I  ++N     GIV++ DE Y
Sbjct: 179 ASISTQKIEMLLN-NWSAGIVVV-DEAY 204

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           L++I DN      KP ++  I  G NPTGS LS D    I  I  K+  ++I DE Y
Sbjct: 196 LESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 210 LYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKP--SVMVVINPGNPTG 267
           +Y  T  LCD  +  + +  E    T   +IEK+        VKP  SV+ + +PG+ T 
Sbjct: 111 VYVPTRVLCDGLLAKFGIQTEYYDPTVGEDIEKL--------VKPNTSVIFLESPGSGTM 162

Query: 268 SVLSKDDIIHIINIGAKYGIVLIADEVYQENI-FDGEFHSMKKVLRSLQKQYPGKYD 323
            +    DI  +++I  K+GI  I D  +   + FD   H +   L +  K   G  D
Sbjct: 163 EI---QDIPALVSIAKKHGIRTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSD 216

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 94/234 (40%), Gaps = 30/234 (12%)

Query: 237 TNEIEKVVLDAIADNVKPS--------VMVVINPGNPTGSVLSKDDIIHIINIGAKYGIV 288
           T E ++  L AI D  K          +  +    NPTG+  S +  + +I I  KY ++
Sbjct: 167 TEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDML 226

Query: 289 LIADEVYQENIFDGEFHSM---KKVLRSLQKQY---PGKYDAVQLASLHSTSKGVSGECG 342
           +IAD+VY    F   F ++   KK    L ++    P  Y      S  + SK ++   G
Sbjct: 227 IIADDVYDMLDFSPPFDNLPQPKKRFVHLDRETNNDPESYG--NTISNATFSKLIA--PG 282

Query: 343 QRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKN 402
            R GY E V   D++   +    + +  S  T   L  ++V    K   +  L N     
Sbjct: 283 LRFGYHETV--TDKLAGQLSHGGANT--SGGTPSQLNSMIVGTMLKNGSTATLLN----Q 334

Query: 403 IHETLKERAEKLYNLFCQL--KGVECQKPQGAMYLFPKLHFPQTLITEAINQNM 454
           +  T  ERAE +Y        K  + +KP+G    F  L  PQ      I + +
Sbjct: 335 LRSTYAERAETMYAAVKGYMPKNTKFEKPEGGY--FSWLTLPQGYDAHEIGKRL 386

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

Query: 264 NPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRSLQKQYPGKYD 323
           NP+G   S    + ++ +  KY I+LI+D+VY   ++D    ++ K L  L       Y+
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYDQPCDALPKCLPRLTHLDRASYE 258

Query: 324 AVQLASLHSTSKGVSGEC---GQRGGYMELV 351
             +    ++ S     +    G R GY E V
Sbjct: 259 YGENGYGNTISNATFSKVIAPGLRCGYQESV 289

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 52/125 (41%), Gaps = 8/125 (6%)

Query: 175 DIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKML---PYYLNEES 231
           DI  T G            C   N G  + + +Y  Y++++   DA+ L   P  L+ E 
Sbjct: 132 DIITTTGSTQGWDASLRIFC---NKGDTVLLEEY-TYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 232 GWSTNTNEIEKVVLDAIADNVKPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLI 290
                  E+     D   D   P ++  I  G NPTG  LS     +I ++  KY +++I
Sbjct: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247

Query: 291 ADEVY 295
            DE Y
Sbjct: 248 EDEPY 252

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 75/168 (44%), Gaps = 16/168 (9%)

Query: 174 DDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAK--MLPYYLNEES 231
           D++ L  G            C      +LI    Y +YT    + D +   +P  L+EE 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 232 GWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIA 291
            +  +    E+ +L+ + ++    ++ + +PGNPTG+ +  + I  I++   + G+V++ 
Sbjct: 148 KFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV- 201

Query: 292 DEVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSG 339
           DE Y + +   +  S+  +          KY+ + +    S S G++G
Sbjct: 202 DEAYIDFVEGSDKGSLAPL--------ATKYENIAVLQTLSKSFGLAG 241

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 227 LNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYG 286
           L+E+  +  N + ++K    AI  N K  ++++ NP NP G V+S + +  I  +  +  
Sbjct: 132 LSEKDSFLPNLDTLKK----AIKSNTK--LIIINNPNNPLGCVISDELLTSICELCKEKN 185

Query: 287 IVLIADEVYQENIFDGEFHSM 307
           + L  DEVY+       FHS+
Sbjct: 186 VYLHCDEVYRP-----IFHSL 201

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 13/79 (16%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQEN 298
           L+AI DN      KP ++  I  G NPTG+ L+ +    I  I  K+  ++I D  Y   
Sbjct: 194 LEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY-- 251

Query: 299 IFDGEFHSMKKVLRSLQKQ 317
                F  M K  R LQK+
Sbjct: 252 -----FLQMDKYERDLQKR 265

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 64/161 (39%), Gaps = 14/161 (8%)

Query: 145 YSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIP 204
           YS +QG+  I + +   I A  N       D+ L  G              D+ T VL+ 
Sbjct: 112 YSQTQGLAPILDFLK-LIVANCNNPPYQNWDLLLANGSSDSMFKLFDT-LTDETTTVLVE 169

Query: 205 IPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNV---------KPS 255
              +    + IT   A  +P  LN  S  S     I    L  + +N          +PS
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQG--INVTYLQHLLENWQSGPYKHLNRPS 227

Query: 256 VMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           ++  I+ G NPTG  +S ++   I  +  KY  +++ D+ Y
Sbjct: 228 ILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 26/40 (65%)

Query: 256 VMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           + +V    NPTG++ S+   + ++ +  KY I++I+D+VY
Sbjct: 190 IYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 26/40 (65%)

Query: 256 VMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           + +V    NPTG++ S+   + ++ +  KY I++I+D+VY
Sbjct: 191 IYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           L++I DN      KP ++  I  G NPTGS LS +    I  I  K+  ++I DE Y
Sbjct: 193 LESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 7/103 (6%)

Query: 194 CKDKNTGVLIPIPQYPLYTATITLCDAKMLPY-YLNEESGWSTNTNEIEKVVLDAIADNV 252
           C      +L+  P Y +Y+    + D  ++    + E++ +  +  EI    L+ +A++ 
Sbjct: 107 CVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNSFQIDATEI----LNILANDP 162

Query: 253 KPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
              ++ + +PGNPTG+ +  D I +++      G+V I DE Y
Sbjct: 163 LIKLVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLV-IVDEAY 203

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 51/125 (40%), Gaps = 8/125 (6%)

Query: 175 DIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKML---PYYLNEES 231
           DI  T G            C   N G  + +  Y  Y++++   DA+ L   P  L+ E 
Sbjct: 132 DIITTTGSTQGWDASLRIFC---NKGDTVLLEDY-TYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 232 GWSTNTNEIEKVVLDAIADNVKPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLI 290
              +   E+         +   P ++  I  G NPTG  LS +   HI  +  +Y I++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 291 ADEVY 295
            D+ Y
Sbjct: 248 EDDPY 252

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           L+ I DN      KP ++  I  G NPTGS LS D    I  +  K+  ++I DE Y
Sbjct: 193 LEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 16/119 (13%)

Query: 201 VLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVI 260
           V+   P Y   ++   +  A++    LN E+ +  +  +++ +    I  N K   +V+ 
Sbjct: 108 VICVDPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSM----IKGNTK--CIVLN 161

Query: 261 NPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRSLQKQYP 319
           NP NP GSV+    +  I  +  K  I +I DEVY+       FHS        + QYP
Sbjct: 162 NPNNPLGSVIPTATLEEIAALARKNEIRVICDEVYRP-----LFHSHDN-----ESQYP 210

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 264 NPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRSL 314
           NP+GS  S +    ++ +  +Y ++LI+D++Y    +D     + + L SL
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAYDQPSDQLPRALPSL 241

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 239 EIEKVVLDAIADNVKPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           ++E+++ +      KP ++  I  G NPTG+ L+ +  + I  I  K+  ++I DE Y
Sbjct: 192 KLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDEPY 249

>SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {ON}
           similar to uniprot|P41734 Saccharomyces cerevisiae
           YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase
           required in balance with alcohol acetyltransferase to
           maintain optimal amounts of isoamyl acetate which is
           particularly important in sake brewing
          Length = 243

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 21/134 (15%)

Query: 306 SMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGY--MELVGFKDEIRQAILK 363
           ++K + R L+ + PG    + +++L+    G +  C   GG+  +EL  FKD + + +  
Sbjct: 61  ALKLLPRILENESPG----IVMSTLYF---GSNDAC--HGGHQKVELPEFKDNVERLLDI 111

Query: 364 LASISLCSVITGQALVDLMVNPPKKGDE---SYELDNFERKNIHETLKERAEK------- 413
             S  +  ++ G AL D     P+K DE    Y   N   K   + L+E A+K       
Sbjct: 112 FKSKGIKPILVGPALFDKDNWNPRKADEVAQGYVRSNENNKLYSDALQEIADKEQIPFVN 171

Query: 414 LYNLFCQLKGVECQ 427
           LY+ F +  G E +
Sbjct: 172 LYDAFSREGGNEWR 185

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 163 TARDNGETASPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKM 222
           TA +     +  +I L  G            C      +L+  P Y +Y+    + D ++
Sbjct: 77  TADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEV 136

Query: 223 LPY-YLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINI 281
           +    + E++ +  ++++    VLD + ++ +  ++ + +PGNPTG+ +    I  ++  
Sbjct: 137 VTCPLITEDNSFQMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQ- 191

Query: 282 GAKYGIVLIADEVY 295
               G+V++ DE Y
Sbjct: 192 NWDRGLVVV-DEAY 204

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 20/155 (12%)

Query: 194 CKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEI-EKVVLDAIADNV 252
           C  +   V++  P Y +Y     + D      Y+      S N+ +I E  +L+ +  + 
Sbjct: 108 CSPREQKVMLLPPTYGMYKVCADINDVG----YVEVPLISSDNSFQIDEDRILEQLNLDK 163

Query: 253 KPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLR 312
              V+ + +PGNPTG+ +    +  ++      GIV++ DE Y       +F + K  L 
Sbjct: 164 SIKVVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVVV-DEAYI------DFSADKPSLS 215

Query: 313 SLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGY 347
            L  ++P       L  L + SK  SG  G R G+
Sbjct: 216 PLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 51/103 (49%), Gaps = 7/103 (6%)

Query: 194 CKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYL-NEESGWSTNTNEIEKVVLDAIADNV 252
           C      ++I  P Y +Y+    + D   +   L  E++ +  +T++    VL+ +A + 
Sbjct: 108 CVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNSFQMDTSK----VLETLAQDP 163

Query: 253 KPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
              ++ + +PGNPT +++   +I  ++N     G +++ DE Y
Sbjct: 164 TIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLVVVDEAY 204

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 239 EIEKVVLDAIADNVKPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           ++EK++ +      +P ++  I  G NPTG+ L+ D    I  I  K+  ++I DE Y
Sbjct: 191 KLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
           L+A+ DN      KP ++  I  G NPTGS L+ +    I  I  K+  ++I DE Y
Sbjct: 193 LEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 74/153 (48%), Gaps = 23/153 (15%)

Query: 195 KDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLN-EESGWSTNTNEIEKVVLDAIADNVK 253
           KDK   +LI  P Y +Y+    + D + +   L  E++ +  +T +    V++ + ++  
Sbjct: 112 KDK---ILIMPPTYGMYSICTDINDVEYVKVPLVVEDNSFQMDTEK----VIETLQNDPS 164

Query: 254 PSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRS 313
             ++ + +PGNPTG+++  ++I  +++   + G V++ DE Y       +F +    +  
Sbjct: 165 IKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-DEAYI------DFCTTGGSVAP 216

Query: 314 LQKQYPGKYDAVQLASLHSTSKGVSGECGQRGG 346
           L  +YP       LA L + SK   G  G R G
Sbjct: 217 LVNKYP------NLAVLQTLSKSF-GLAGIRLG 242

>Kwal_23.4020 s23 complement(531463..532668) [1206 bp, 401 aa] {ON}
           YLR027C (AAT2) - aspartate aminotransferase, cytosolic
           [contig 255] FULL
          Length = 401

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 40/94 (42%), Gaps = 5/94 (5%)

Query: 203 IPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVV-IN 261
           + +P +P Y   I   + ++  Y   +E       N +    LDA+ D  K SV +  I 
Sbjct: 126 VGVPTWPNYVPMIENLNGRVTTYSYYDEIRQEVAFNSL----LDALYDCPKFSVFIFQIC 181

Query: 262 PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
             NPTGS LSK     +  I     +V I D  Y
Sbjct: 182 CHNPTGSDLSKRQWKAVAEIIKARSLVTIFDAAY 215

>KLTH0E09614g Chr5 (867211..868224) [1014 bp, 337 aa] {ON} similar
           to uniprot|P32419 Saccharomyces cerevisiae YDL078C MDH3
           Cytoplasmic malate dehydrogenase catalyzes
           interconversion of malate and oxaloacetate involved in
           the glyoxylate cycle
          Length = 337

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 211 YTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVL 270
           Y +T+ L D ++ P    + S  +TN+ +      D +AD +K + +VVI  G P    +
Sbjct: 26  YVSTLALYDLRLAPGVARDLSHINTNS-KCRGYGKDELADALKGANVVVIPAGVPRKPGM 84

Query: 271 SKDDIIHI 278
           ++DD+  I
Sbjct: 85  TRDDLFKI 92

>Smik_4.394 Chr4 (718158..721880) [3723 bp, 1240 aa] {ON} YDR150W
           (REAL)
          Length = 1240

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 264 NPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQE 297
           N   SV+S  DI H+  +  K+G+ LI+DE ++E
Sbjct: 651 NDVISVVSSADINHLSKMAEKHGMTLISDESFEE 684

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 98/262 (37%), Gaps = 44/262 (16%)

Query: 245 LDAIADNV-----KPSVMVVINPG-NPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQEN 298
           L AI DN      KP ++  I  G NPTGS L  +    +  I  K+  +++ DE Y   
Sbjct: 193 LAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPYY-- 250

Query: 299 IFDGEFHSMKKVLR--SLQKQYPGKYDAVQLASLHSTSKGVSGEC--------------G 342
                F  M+  ++  SL+K+    +D   LASL  T   +  +               G
Sbjct: 251 -----FLQMEDYVKDPSLRKEVKLSHDEF-LASLDQTFLSIDTDGRVIRMDSFSKVLAPG 304

Query: 343 QRGGYMELVGFKDEIRQAILKLASISL-CSVITGQALVDLMVNPPKKGDESYELDNFERK 401
            R G++      ++I +A L L  +S+  +    Q++V   ++  K G   Y LD     
Sbjct: 305 SRLGWITC---SNQIMKAYLALYEMSMQAAAGFTQSIVSATLS--KWGQHGY-LDWLLGL 358

Query: 402 NIHETLKE--RAEKLYNLFCQLKGVECQKPQGAMYL---FPKLHFPQTLITEAINQNMSP 456
               TLK     +  Y    Q        P   M+    F     P+   T     +   
Sbjct: 359 RHEYTLKRDNAIDACYKYIPQTDAFHINPPVAGMFFTITFDGAKHPE--FTTKFKSDPLL 416

Query: 457 DEFYCHALLEATGICTVPGSGF 478
            E Y +     +G+   PGS F
Sbjct: 417 LESYLYEKAVESGVIIAPGSWF 438

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 30/48 (62%)

Query: 256 VMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGE 303
           + +V    NP+G+  S++  + ++++  +Y I++I+D+VY    F G+
Sbjct: 192 IYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQ 239

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 11/105 (10%)

Query: 194 CKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYL-NEESGWSTNTNEIEKVVLDAIADNV 252
           C      +L+  P Y +Y+    + D +++   L   ++ +  NT+E+ K   +      
Sbjct: 107 CVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQN------ 160

Query: 253 KPSV--MVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVY 295
            PS+  + + +PGNPTG+ +    I  I+      G+V++ DE Y
Sbjct: 161 DPSIKLIFITSPGNPTGAKVETSRIEKILQ-NWDRGMVVV-DEAY 203

>TPHA0P01350 Chr16 (274173..275348) [1176 bp, 391 aa] {ON} Anc_3.45
           YOL126C
          Length = 391

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 238 NEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHI 278
           N+I   V D +A+NVK S +++I  G P    +++DD+ +I
Sbjct: 88  NKIRLQVTDNLAENVKDSNLIIIAAGVPRKPGMTRDDLFNI 128

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 55/125 (44%), Gaps = 7/125 (5%)

Query: 172 SPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLN-EE 230
           S D++ L  G            C      +L+  P Y +Y+    + D +++   L   +
Sbjct: 86  SADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSD 145

Query: 231 SGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLI 290
           + +  NT    + VL  + ++    +M   +PGNPTG+ + K  +I  +      GIV++
Sbjct: 146 NSFQMNT----EAVLTILNNDPLIKIMFATSPGNPTGAKI-KTCLIEEVLQKWDNGIVVV 200

Query: 291 ADEVY 295
            DE Y
Sbjct: 201 -DEAY 204

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 52/124 (41%), Gaps = 5/124 (4%)

Query: 172 SPDDIFLTEGXXXXXXXXXXXXCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEES 231
           + D++ L  G            C      +L+  P Y +Y+    + D +++   L    
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSD 145

Query: 232 GWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIA 291
           G      E    VL  + ++    +M V +PGNPTG+ + K  +I  +      G+V++ 
Sbjct: 146 GSFQMDTE---AVLTILKNDSLIKLMFVTSPGNPTGAKI-KTSLIEKVLQNWDNGLVVV- 200

Query: 292 DEVY 295
           DE Y
Sbjct: 201 DEAY 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,389,397
Number of extensions: 2537226
Number of successful extensions: 7091
Number of sequences better than 10.0: 111
Number of HSP's gapped: 7212
Number of HSP's successfully gapped: 111
Length of query: 514
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 400
Effective length of database: 40,409,475
Effective search space: 16163790000
Effective search space used: 16163790000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)