Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B05520singletonON51051026400.0
KAFR0B055308.263ON51448918740.0
KNAG0M012108.263ON52148918610.0
TDEL0F039008.263ON55949117510.0
KLLA0F19162g8.263ON52848717310.0
KNAG0G020408.263ON59149317340.0
NCAS0B038408.263ON49749017200.0
ZYRO0C01628g8.263ON53448717210.0
Skud_4.3728.263ON50749017160.0
NCAS0B050208.263ON56849117170.0
NDAI0J013608.263ON50149217030.0
Smik_4.3578.263ON50749017030.0
SAKL0H17006g8.263ON53149117040.0
YDR111C (ALT2)8.263ON50749016960.0
NDAI0B019908.263ON58849016950.0
YLR089C (ALT1)8.263ON59249116900.0
Skud_12.1578.263ON59249016870.0
Smik_12.1488.263ON59249116810.0
Suva_2.2718.263ON50749016720.0
Suva_10.1738.263ON59249116740.0
CAGL0L12254g8.263ON57448816550.0
Kpol_543.398.263ON49249116260.0
TBLA0F030608.263ON50049516250.0
KAFR0B027308.263ON53949016260.0
Kpol_392.58.263ON51249016210.0
TBLA0G01630singletonON50049816190.0
KLTH0G13662g8.263ON51948316140.0
Kwal_56.237918.263ON51848315990.0
TPHA0J007508.263ON52248915860.0
Ecym_43078.263ON53448815770.0
TPHA0A018008.263ON49849215520.0
TBLA0E044408.263ON56248515470.0
AGR085W8.263ON52148814730.0
KLLA0F03509g2.252ON3871871356e-08
KLTH0G09614g2.252ON3892401349e-08
TPHA0O014501.321ON4431411331e-07
TDEL0D019001.321ON4433591286e-07
NCAS0A092001.321ON4453241251e-06
Skud_10.1561.321ON4603301242e-06
Suva_6.1361.321ON4441421214e-06
Kpol_1039.222.252ON3861801204e-06
YJL060W (BNA3)1.321ON4443581205e-06
Kwal_34.160181.472ON3791681195e-06
KLTH0H10648g1.321ON4434311188e-06
NDAI0B045502.102ON5651621171e-05
NDAI0G057601.321ON4483251162e-05
Kwal_14.25741.321ON4433611152e-05
AEL170C1.321ON4582341133e-05
Kwal_23.48882.252ON3892261124e-05
KAFR0A017101.321ON4353541091e-04
KLTH0G19646g1.472ON3791251081e-04
CAGL0J05126g1.321ON4333321081e-04
YIL116W (HIS5)2.252ON3851751072e-04
Suva_9.782.252ON3861801062e-04
Smik_10.1801.321ON4441491072e-04
KLLA0F10021g3.511ON4972021045e-04
Ecym_32902.252ON3861951035e-04
KNAG0B053201.321ON4331391035e-04
SAKL0D06886g1.321ON4473231035e-04
KLLA0F01617g1.321ON4443541026e-04
ZYRO0A01672g2.252ON3862161019e-04
Smik_9.532.252ON3881761010.001
ADL249W2.252ON3871761000.001
KAFR0J015802.252ON383199980.002
Kpol_1035.231.321ON444143980.003
NDAI0B037302.252ON386195960.004
KNAG0E018502.252ON384126940.006
Skud_9.552.252ON385208940.006
ZYRO0G05346g2.102ON504145930.011
KNAG0B006603.511ON496122920.011
TPHA0F012602.252ON392230920.011
TDEL0A016008.204ON475212910.014
TDEL0C040902.252ON383291890.023
Ecym_62921.321ON430135890.024
SAKL0E12188g2.102ON530164890.027
Kpol_1035.302.102ON501145880.035
ZYRO0G20636g1.321ON453133870.044
Kpol_278.23.511ON498122870.044
TBLA0B009902.102ON546159870.046
Ecym_6319singletonON354127860.052
SAKL0E08492g2.252ON384177860.052
NCAS0B064402.252ON385143860.053
CAGL0C01243g2.252ON383126860.055
SAKL0F02156g3.511ON498152860.060
Kpol_480.11.472ON380125860.063
KNAG0H037302.102ON523171850.099
Ecym_55428.204ON44694840.11
KNAG0G005501.472ON387133830.14
NCAS0G040501.472ON384134820.16
SAKL0D11528g1.472ON38341810.24
ZYRO0C06028g3.511ON49659810.25
KLTH0E07678gna 1ON492125810.28
SAKL0H21824gna 1ON499125810.28
TPHA0D033703.511ON497122800.30
NCAS0E006703.511ON497144800.32
Kwal_47.17462na 1ON492125800.33
CAGL0G01254g3.511ON50459800.34
CAGL0I06578g8.204ON43680780.53
YER152C8.204ON44333780.59
ZYRO0B11088g8.204ON45032780.65
Smik_5.3198.204ON44333770.70
Smik_7.693.511ON500329770.71
Suva_5.2818.204ON45032770.87
AGR141C8.204ON43832760.99
CAGL0G06028g2.102ON537161761.2
SAKL0G02838g5.449ON243134741.4
KLTH0G19624gsingletonON46832751.5
Kwal_47.189823.511ON49659741.6
KLTH0B00176g8.204ON44832741.6
KLTH0G02002g3.511ON49659741.6
KNAG0G016808.204ON45233741.7
AFR548C3.511ON497124741.7
NDAI0I02500singletonON38695741.9
YGL202W (ARO8)3.511ON500328742.0
Skud_5.2908.204ON44333732.3
Kwal_8.5858.204ON44640722.7
NDAI0I028303.511ON500122722.8
Kpol_431.132.475ON443155722.9
KAFR0B023808.204ON44332714.1
NDAI0J011008.289ON36475696.6
NDAI0C059608.204ON47834689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05520
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...  1021   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            726   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   721   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   679   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   671   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   672   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   667   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   667   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   665   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   665   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   660   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   660   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   660   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   657   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   657   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   655   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   654   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   652   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   648   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   649   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   642   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   630   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   630   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   630   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   629   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              628   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   626   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   620   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   615   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   612   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   602   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   600   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   572   0.0  
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    57   6e-08
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    56   9e-08
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    56   1e-07
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    54   6e-07
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    53   1e-06
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    52   2e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    51   4e-06
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    51   4e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    51   5e-06
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    50   5e-06
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    50   8e-06
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    50   1e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    49   2e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    49   2e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    48   3e-05
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    48   4e-05
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    47   1e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    46   1e-04
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    46   1e-04
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    46   2e-04
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    45   2e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    46   2e-04
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    45   5e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    44   5e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    44   5e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    44   5e-04
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    44   6e-04
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    44   9e-04
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    44   0.001
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    43   0.001
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    42   0.002
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    42   0.003
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    42   0.004
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    41   0.006
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    41   0.006
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    40   0.011
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    40   0.011
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    40   0.011
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    40   0.014
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    39   0.023
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    39   0.024
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    39   0.027
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    39   0.035
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    38   0.044
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    38   0.044
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    38   0.046
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    38   0.052
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    38   0.052
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    38   0.053
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    38   0.055
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    38   0.060
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    38   0.063
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    37   0.099
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    37   0.11 
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       37   0.14 
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    36   0.16 
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    36   0.24 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    36   0.25 
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    36   0.28 
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    36   0.28 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    35   0.30 
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     35   0.32 
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    35   0.33 
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    35   0.34 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    35   0.53 
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    35   0.59 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    35   0.65 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    34   0.70 
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    34   0.71 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   0.87 
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    34   0.99 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    34   1.2  
SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {O...    33   1.4  
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    33   1.5  
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    33   1.6  
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    33   1.6  
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    33   1.6  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   1.7  
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    33   1.7  
NDAI0I02500 Chr9 (576038..577198) [1161 bp, 386 aa] {ON}               33   1.9  
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    33   2.0  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    33   2.3  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    32   2.7  
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    32   2.8  
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    32   2.9  
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    32   4.1  
NDAI0J01100 Chr10 (255308..256402) [1095 bp, 364 aa] {ON} Anc_8....    31   6.6  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    31   9.1  

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/510 (96%), Positives = 493/510 (96%)

Query: 1   MPPIXXXXXXXXXXXXXXXXXHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFE 60
           MPPI                 HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFE
Sbjct: 1   MPPITSSTSGTSNTPTSDSNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFE 60

Query: 61  LYHKTQPHSFPFERIIYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYK 120
           LYHKTQPHSFPFERIIYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYK
Sbjct: 61  LYHKTQPHSFPFERIIYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYK 120

Query: 121 KDALERAELLQSQIGASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASK 180
           KDALERAELLQSQIGASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASK
Sbjct: 121 KDALERAELLQSQIGASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASK 180

Query: 181 AVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSV 240
           AVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSV
Sbjct: 181 AVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSV 240

Query: 241 INAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEF 300
           INAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEF
Sbjct: 241 INAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEF 300

Query: 301 HSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKL 360
           HSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKL
Sbjct: 301 HSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKL 360

Query: 361 ASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGI 420
           ASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGI
Sbjct: 361 ASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGI 420

Query: 421 ECQKPQGAMYLFPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGT 480
           ECQKPQGAMYLFPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGT
Sbjct: 421 ECQKPQGAMYLFPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGT 480

Query: 481 YHVRTTFLSPGTEWIDDWKKFHEKFMKEYQ 510
           YHVRTTFLSPGTEWIDDWKKFHEKFMKEYQ
Sbjct: 481 YHVRTTFLSPGTEWIDDWKKFHEKFMKEYQ 510

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/489 (69%), Positives = 402/489 (82%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           H+F+PA KI++ DLNQ ++ +EYAVRGSI  RAEELEFEL +     S  FE I++ANIG
Sbjct: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           NPQQLDQKPLTFSRQV+SIL+YP LL  +++L+S GI+K DA+ERAE L   IG SVGAY
Sbjct: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGVYGIRET A +I+ RDN E AS DDIFLT+GASKA +YL+  LC++++TG+LIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTA+I + +AKMLPYYL+EESGWST   EIE  V++AI + +KPS MVVINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNV 321
           TG+VLS D I  II + AKYGIVLIADEVYQ+NIF+GEFHSMKK+LR LQK+YPGKYD V
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGEFHSMKKVLRSLQKQYPGKYDAV 325

Query: 322 QLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDP 381
           QLASLHSTSKGVSGECGQRGGYME+VGF DE+R  +LKLASI++CSV+TGQALVDLMV+P
Sbjct: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385

Query: 382 PHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRA 441
           P  GDESYE D  ER  IH TLK+RA+KLY+ F  L+G+ECQKPQGAMYLFP+L  P   
Sbjct: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445

Query: 442 IEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKF 501
           I EA    M  DEFYCH LLE TGICTVPGSGFGQ+EGTYH+RTTFL+PG +W + WK F
Sbjct: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505

Query: 502 HEKFMKEYQ 510
           HE+F  +YQ
Sbjct: 506 HEEFFSKYQ 514

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/489 (69%), Positives = 408/489 (83%), Gaps = 4/489 (0%)

Query: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83
           FEPA K+   DLN+ II+AEYAVRG+I M+AEELE +L    QP   PF  I  ANIGNP
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQ--QPDLLPFNAITVANIGNP 91

Query: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143
           QQLDQKPLTFSRQV+SIL+YP LL +++ L++ G YK+DA +RA +L  QIG SVGAYSL
Sbjct: 92  QQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSL 151

Query: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203
           AQGVYGIRE+ A FI++RD  E AS DDIFLTDGASKA TYL+  LC++  TGI+IPIPQ
Sbjct: 152 AQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQ 211

Query: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263
           YPLYTASI ++N+ MLPYYLDEESGWSTK EEIE  VI++I+ G+ P  +VVINPGNPTG
Sbjct: 212 YPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTG 271

Query: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYP-GKYDNV 321
           AVLS D I +I+T+AAKYGIV++ADEVYQ+NI+ G +FHSMKK+LR LQ+ +P G+YDNV
Sbjct: 272 AVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNV 331

Query: 322 QLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDP 381
           QLAS+HSTSKGVSGECGQRGGYME+VGFS+EVR ++LKLASI+ICSVVTGQALVDLM++P
Sbjct: 332 QLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNP 391

Query: 382 PHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRA 441
           P  GD+SYE D  ER EIH+ +K R   LYDTF  LEGIECQ+PQGAMYLFP+L+L  +A
Sbjct: 392 PREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKA 451

Query: 442 IEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKF 501
           IEEAK L ++ DEFYCH+LL+ TGICTVPGSGFGQ+EGTYHVRTTFL+PGT+WI DW+ F
Sbjct: 452 IEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETF 511

Query: 502 HEKFMKEYQ 510
           H+ F  +Y+
Sbjct: 512 HKAFYDKYR 520

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/491 (65%), Positives = 404/491 (82%), Gaps = 4/491 (0%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
            DF PA  ++V DLN+ ++ A+YAVRGSI MRAEEL+ +L  K  P S PF++I+ ANIG
Sbjct: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQL--KRDPSSLPFDKIVNANIG 127

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGASVGA 140
           NPQQL+QKPL+F RQV+SIL+YP +L + ++ L+S+G++K+DA+ERA+ +   +G SVGA
Sbjct: 128 NPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGA 187

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS +QGVYGIR+T A FI++RD+ E A  +DIFLT GAS AV+YL+  LC+ + TG+LIP
Sbjct: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           IPQYPLYTA++ ++N+ +LPYYLDEESGWST   EIE  V  +IE+GI+PS +VVINPGN
Sbjct: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGN 307

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319
           PTG+VLSV+ I++I  VAAKYGIV+IADEVYQ+NIF G EFHSMKK+LRQLQK++PG YD
Sbjct: 308 PTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYD 367

Query: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379
           NVQL SLHSTSKGVSGECGQRGGYME+ GF+ E+R ++LKLASI++C VVTGQALVDLMV
Sbjct: 368 NVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMV 427

Query: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439
            PP  GDESYE+D++ER  IH  L  RA  L+DTF++LEGIECQKP+GAMYLFP++ LP 
Sbjct: 428 CPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPY 487

Query: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499
           +AI+ A+ L+   DEFYC KLLE TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI  W+
Sbjct: 488 KAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWE 547

Query: 500 KFHEKFMKEYQ 510
            FH+KF  +Y+
Sbjct: 548 DFHKKFYDQYR 558

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/487 (64%), Positives = 398/487 (81%), Gaps = 4/487 (0%)

Query: 25  EPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQ 84
           +PAPK+S+ D+N+ ++ A+YAVRG I MRAEEL  +L  K  P S PF +II ANIGNPQ
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQL--KKDPSSLPFSKIISANIGNPQ 101

Query: 85  QLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLA 144
           QLDQKPLTF R+V+S+L++P LL+  D  L Q +YK D+++RA+ L S++G SVGAYS +
Sbjct: 102 QLDQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQS 160

Query: 145 QGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQY 204
           QGV GIRET A FI+KRD+ E +  +DI+LT GAS AV+Y++  LC+  +TG+LIPIPQY
Sbjct: 161 QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 220

Query: 205 PLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGA 264
           PLYTAS+ ++N++ LPYYL EE  WST  EEIE  V++AI+ GIKP+ +VVINPGNPTGA
Sbjct: 221 PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGA 280

Query: 265 VLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQL 323
           +LS   IQ+I  VAAKYGIV+IADEVYQ+N+F G +F+SMKK+LR LQK Y G+YDN+QL
Sbjct: 281 ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQL 340

Query: 324 ASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPH 383
           ASLHSTSKGVSGECGQRGGYME+VGF+ ++R + LKLASI++C VVTGQALVDLMV PP 
Sbjct: 341 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 400

Query: 384 VGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIE 443
            GDESYE+DQ+ER +IH  L +RA KL++TFS LEGIEC+KPQGAMYL+P+L LP + I+
Sbjct: 401 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 460

Query: 444 EAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHE 503
           EA+ L+ME DEFYC  LLENTGICTVPGSGFGQ  GTYH+RTTFL PGTEW++ W+KFH+
Sbjct: 461 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 520

Query: 504 KFMKEYQ 510
            F  +Y+
Sbjct: 521 AFFDKYR 527

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/493 (63%), Positives = 402/493 (81%), Gaps = 6/493 (1%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           + F PA ++ +ADLN+ ++ A+YAVRGSI MRAE+L+ +L  +  P S PF++II ANIG
Sbjct: 100 YKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQL--QEDPRSLPFDKIINANIG 157

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKF--KDVLLSQGIYKKDALERAELLQSQIGASVG 139
           NPQQL+QKPL+F RQV+S+L++P LL    ++   +  +YK DA+ RAE L   IG SVG
Sbjct: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217

Query: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199
           AYS +QGV GIR+T A FI++RDN E A  +DIFLT GAS AV+YL+   C+ E TG+LI
Sbjct: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277

Query: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259
           PIPQYPLYTA++ ++N+  LPYYLDE+SGWST  +EI++ V++AI+  IKPS +VVINPG
Sbjct: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGE--FHSMKKILRQLQKKYPGK 317
           NPTGAVLS   I  I  +AAKYGIV+IADEVYQ+NIF+ +  FHSMKK+LR+LQ+++PGK
Sbjct: 338 NPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGK 397

Query: 318 YDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDL 377
           +D VQLASLHSTSKGVSGECGQRGG+ME+ GFS E+R ++LKLASI++C VVTGQALVDL
Sbjct: 398 FDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDL 457

Query: 378 MVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLIL 437
           MV PP  G+ESYE DQ ER+ IHS L KRA+KL++TF+ LEGI+CQKPQGAMYLFPRL L
Sbjct: 458 MVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNL 517

Query: 438 PDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDD 497
           P +A+++A+ ++M ADEFYC +LLENTGICTVPGSGFGQ  GTYH+RTTFL+PGTEWID 
Sbjct: 518 PFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDL 577

Query: 498 WKKFHEKFMKEYQ 510
           W+KFH++F  +Y+
Sbjct: 578 WEKFHKEFYNKYR 590

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 395/490 (80%), Gaps = 3/490 (0%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           +DF+PAPK+S+ D+N+ +++A++A+RGSI+++AE+L+ +L     PH  PF+ I  ANIG
Sbjct: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQL--NKNPHCLPFDEITVANIG 66

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           NPQ+L+QKPLTF+RQV+SIL+YP LL  +DVL  + I+  D+ +RAE L   IG SVGAY
Sbjct: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGVYGIR+T A +I+KRD  E +  +DIFLT GA+ A +YL+  LC+   TG+LIPI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTA++ ++ + M+PYYLDEES WST   EIE  V+++I+ GIKPS +VVINPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVLS   I +I  +AAKYGIV++ADEVYQ+NIF+G +FHS KK+LR LQK+YPGK+DN
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           +QLAS+HSTSKGV GECGQRGGYME+VGF+DEVR LLLKLA + +CSVVTGQA+VDLM+ 
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GD SYE D++ER EI   + +RA KLY  F  L+GIECQKPQGAMYL+P LIL  +
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           AI +A+ L +  DEFYCH+LL+ TGICTVPGSGFGQ++GTYH+RTTFL+PG EWI+ W+K
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 501 FHEKFMKEYQ 510
           FH+ F ++YQ
Sbjct: 487 FHKHFYEKYQ 496

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/487 (65%), Positives = 394/487 (80%), Gaps = 4/487 (0%)

Query: 26  PAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQ 85
           PA K+ ++++N+ ++ A+YAVRG+I M A EL  +L  K  PHS PF+ I+ ANIGNPQ 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKL--KKDPHSLPFDNIVSANIGNPQH 106

Query: 86  LDQKPLTFSRQVMSILEYPGLLKFKD-VLLSQGIYKKDALERAELLQSQIGASVGAYSLA 144
           L QKPLTF RQV+S+L+YPGLL+  + VL+   +Y+KDA+ RA  L + IG+SVGAYS +
Sbjct: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 145 QGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQY 204
           QG+ GIRET A+FI++RD  E A A+DIFLT GAS AV+YL+  LC+ + TG+LIPIPQY
Sbjct: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226

Query: 205 PLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGA 264
           PLYTAS+ ++N+  LPYYLDE+SGWST   EIE+ V NAIE  IKPS +VVINPGNPTGA
Sbjct: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286

Query: 265 VLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQL 323
           VLS + I +I  +AAKYGIV+IADEVYQ+N+F+G EFHSMKKILR+LQK  PG +DNVQL
Sbjct: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 324 ASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPH 383
           ASLHSTSKGVSGECGQRGGYMEI GF++++R ++LKLASI++C VVTGQALVDLMV PP 
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 384 VGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIE 443
            GDESYE DQ+ER  IH  L +RA KL+ TF++LEGIECQKP+GAMYLFPRL+LP +AI+
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 444 EAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHE 503
            A+   M  D FYC KLLE TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI+ W+ FH+
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 504 KFMKEYQ 510
            F +EY+
Sbjct: 527 AFYEEYR 533

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/490 (64%), Positives = 391/490 (79%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           DF+PA KI+  DLN  +  AEYAVRGSI  RA+EL+ EL  K  P   PF+ II ANIGN
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEEL--KKNPGLLPFDDIINANIGN 76

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFK-DVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           PQQLDQKPLTF+RQV+SILEYP +L+   + L S  ++ KDAL+RAE L   IG SVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGV GIR+T A FI+ RD  E A+ +DI+LT GAS A T L+  LC++  TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPI 196

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTAS  + NA++LPYYLDEE  WST+ +EIE  V +A+E GI+PS ++VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVL+ + I RI  +AAKYGI +I+DEVYQ+N+FN  +FHSMKK+LR+LQ  YPGK+DN
Sbjct: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHS SKG  GECGQRGGYMEIVGFS ++R  L KL SI+ICSVVTGQA+VDLMV+
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GDESYE+D++ER++I + ++ RA+ LY+TF+ LEGIECQ PQGAMYLFPRLILPD+
Sbjct: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           A  E+++L +E DEFYC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL+PGT+WI +WK 
Sbjct: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496

Query: 501 FHEKFMKEYQ 510
           FH+ F  EY+
Sbjct: 497 FHQSFFNEYR 506

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/491 (64%), Positives = 393/491 (80%), Gaps = 4/491 (0%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           ++F PA ++++A+LN  ++ A+YAVRG+I MRAEEL+ +L  +  P S PF+ I+ ANIG
Sbjct: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQL--QEDPSSLPFDHIVNANIG 136

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQIGASVGA 140
           NPQQL+QKPL+F RQV+S+L+YP +LK  +  L++ G++KKDALERA+ L  +IG +VGA
Sbjct: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS +QGVYGIR+T A FI+KRDN E A  +DIFLT GAS AV YL+  LC+   TG+LIP
Sbjct: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           IPQYPLYTAS+ ++N+  LPYYLDE+SGWST  +EIE  V+ A +  I+PS +VVINPGN
Sbjct: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319
           PTGAVLS   I+ I  +AAKYGIV+IADEVYQ+N+FN  +FHSMKK+LR LQKK+PG YD
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379
            VQLASLHSTSKGVSGECGQRGGYME+ GF+ EVR ++LKLASI++C VVTGQALVDLMV
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439
            PP  GDES+E+DQ ER  I S L  RA +LY  F+ LEGIECQKPQGAMYLFPRL LP 
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499
           +A+++A+ L+M  DEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI+ WK
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 500 KFHEKFMKEYQ 510
            FH+ F   Y+
Sbjct: 557 IFHQDFYNTYR 567

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/492 (62%), Positives = 393/492 (79%), Gaps = 6/492 (1%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           HDFEPAPK+S+ DLN  +I AE+AVRG+I M+A+EL+ +L     PHS PF  I  ANIG
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQL--NKNPHSLPFNEITVANIG 68

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQG--IYKKDALERAELLQSQIGASVG 139
           NPQ+L QKPLTF+RQV+SIL+YP LL  ++ L S    IY  D+ +RAE L ++IG SVG
Sbjct: 69  NPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVG 128

Query: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199
           AYS +QGVYGIR+T A +I++RD  E+AS +DIF+T GA+ A +YL+  L     TG+L+
Sbjct: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLL 188

Query: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVI-NAIENGIKPSAMVVINP 258
           PIPQYPLYTA + +HNA MLPYYL+EESGWS    EIE ++  NA+  GI+P  MV+INP
Sbjct: 189 PIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINP 248

Query: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGK 317
           GNPTG++LS D + +I  +AAKYGIV+IADEVYQ+N+FNG +FHS KK+LR LQK++P +
Sbjct: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQ 308

Query: 318 YDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDL 377
           Y+NVQLASLHSTSKG+ GECGQRGGYMEI+GF+++VR+L+LKLA I++C VVTGQA++DL
Sbjct: 309 YNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDL 368

Query: 378 MVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLIL 437
           M+ PP  GD+SY+ D  ER +IH+ +  RA KLYD FS++EGI+CQKPQGAMYLFPRL+L
Sbjct: 369 MILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLL 428

Query: 438 PDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDD 497
             + I+EAKK +ME DEFYCH+LL  TGICTVPGSGFGQ+  TYH+RTTFL+PG +WI+ 
Sbjct: 429 STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINK 488

Query: 498 WKKFHEKFMKEY 509
           W+KFH+ F+K Y
Sbjct: 489 WEKFHKAFLKRY 500

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/490 (64%), Positives = 391/490 (79%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           +F+PA KI+  DLN  +  AEYAVRG+I  RA+EL+ EL  K +P   PF+ II ANIGN
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEEL--KRKPGVLPFDDIINANIGN 76

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKF-KDVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           PQQLDQKPLTF+RQV+SILEYP +L+   D L S  +++KDAL RAE L   IG S+GAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGV GIR++ A FI+KRD+ E A+ ++I+LT GAS A T L+  LC++  TG+LIPI
Sbjct: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPI 196

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTAS  + NA++LPYYLDE S WSTK +EIE  V +A+E GIKPS ++VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVLS D I +I  +AAKYGI +I+DEVYQ+N+FNG +FHSMKK+LR+LQ+ YPGK+DN
Sbjct: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHS SKG  GECGQRGGYME+VGFS ++R  L KL SI+ICSVVTGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GDESY++D  ER +I   +  RA  L++TF+ LEGIECQKPQGAMYLFPRL+LP++
Sbjct: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           A+ E+++L +E DEFYC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL+PGT+WI DWK 
Sbjct: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496

Query: 501 FHEKFMKEYQ 510
           FH+ F  +Y+
Sbjct: 497 FHQDFFNKYR 506

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/491 (64%), Positives = 393/491 (80%), Gaps = 5/491 (1%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           + F+PA K+S+ DLN+ ++ A+YAVRG I  +AEEL+ +L     P S PF+RII ANIG
Sbjct: 43  YKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQL--ARDPKSLPFDRIINANIG 100

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLK-FKDVLLSQGIYKKDALERAELLQSQIGASVGA 140
           NPQQLDQKPLTF RQV+S+L+ P +L+      LSQ IYK DA++RA  L S IG SVGA
Sbjct: 101 NPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ-IYKPDAIDRAARLLSNIGGSVGA 159

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS +QGVYG R+T A FI+KRD  E A A+DIFLT GAS AV+Y++  LC+   TG+LIP
Sbjct: 160 YSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIP 219

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           IPQYPLYTAS+ ++N+  LPYYLDEES WST  EEIE  V N+I  G++P  +VVINPGN
Sbjct: 220 IPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGN 279

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319
           PTGA+LS + I++I  VAAKYGIV+IADEVYQ+N+FNG EFHSM+K+L+ LQ+K+ GK+D
Sbjct: 280 PTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFD 339

Query: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379
           N+QLASLHSTSKGVSGECGQRGGYME++GFS +VR + LKLASI++C VVTGQALVDLMV
Sbjct: 340 NIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMV 399

Query: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439
            PP  GD SYE+DQ+ER+EIH  L  RA  LY+TF+ LEGIECQKPQGAMYLFPRL L  
Sbjct: 400 CPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSY 459

Query: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499
           +A+++A+ L +  DEFYC +LLE TGICTVPGSGFGQ  GTYH+RTTFL+PGT+WI  W+
Sbjct: 460 KAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWE 519

Query: 500 KFHEKFMKEYQ 510
           +FH+KF  EY+
Sbjct: 520 EFHKKFYNEYR 530

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/490 (64%), Positives = 388/490 (79%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           DF+PA KI+  DLN  +  AEYAVRG+I  RA+EL+ EL  K  P   PF+ II ANIGN
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEEL--KKNPEVLPFDDIINANIGN 76

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKF-KDVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           PQQLDQKPLTF+RQV++ILEYP +L+   + L S  ++ +DALERAE L + IG S+GAY
Sbjct: 77  PQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGV GIR+T A FI++RD  E A+ +DI+LT GAS A T L+  LC++  TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPI 196

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTAS  + NA++LPYYLDEES WST  +EIE  V +A++  I+PS ++VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVLS + I RI  +AAKYGI +I+DEVYQ+NIFN  +FHSMKK+LR+LQ  YPGK+DN
Sbjct: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHS SKG   ECGQRGGYMEI+GFS E+R  L KL SI+ICSVVTGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GDESYE+D +ER +I   ++ RA+ LY+TF  LEGIECQKPQGAMYLFPRL+LP +
Sbjct: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           A+ E+++L +E DEFYC  LLE+TGICTVPGSGFGQR GTYHVRTTFL+PGT+WI DWK+
Sbjct: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496

Query: 501 FHEKFMKEYQ 510
           FH+ F  +Y+
Sbjct: 497 FHQDFFSKYR 506

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 391/490 (79%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           DF PA ++++ADLN+ ++ A+YAVRGSI MRAEEL+ +L  +  P + PF +I+ ANIGN
Sbjct: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQL--ENNPSTLPFSQIVNANIGN 157

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQIGASVGAY 141
           PQQL QKPL+F RQV+SIL+YP +LK  +  L+   +YK+DA++RA+LL S+IG SVGAY
Sbjct: 158 PQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAY 217

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGVYGIR+T A FI++RD  E A  +DIFLT    +   YL+  LCQ   TG+LIPI
Sbjct: 218 SASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTA++ ++N+  LPYYLDE+SGWST  +EIE  V +A+E  I PS +VVINPGNP
Sbjct: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVL+ + I+ I  +AAKYGIV+IADEVYQ+NI +G +F+SMKK+LR+LQK +PGK+DN
Sbjct: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHSTSKGVSGECGQRGGYME++GF+ EVR ++LKLASI++C VVTGQALVDLMV 
Sbjct: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GD SYE+DQ ER  I S L  RA +LY+TF  LEGIECQKPQGAMYLFP+L LP +
Sbjct: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           A++EA+ L+M  DEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI  W+ 
Sbjct: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577

Query: 501 FHEKFMKEYQ 510
           FH++F   Y+
Sbjct: 578 FHKEFYDNYR 587

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/491 (63%), Positives = 393/491 (80%), Gaps = 4/491 (0%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           ++F PA ++++ D+N+ ++ A+YAVRG+I MRAEEL+ +L  +  P S PF+RII ANIG
Sbjct: 103 NEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDRIINANIG 160

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGASVGA 140
           NPQQL QKPLT+ RQV+S+L+YP LL + +  L+   ++K DA++RA+ L   IG SVGA
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGA 220

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS +QGV GIR++ A FI+KRD  E +  +DIFLT GAS AV YL+   C+   TG+LIP
Sbjct: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           IPQYPLYTA++ ++N++ LPYYLDE SGWST  EEIE  V  AI+N IKP+ +VVINPGN
Sbjct: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319
           PTGAVLS + I +I  VAAKYG V+IADEVYQ+NIF G +FHSMKKILR LQ+++PGK+D
Sbjct: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFD 400

Query: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379
           NVQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVDLMV
Sbjct: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460

Query: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439
            PP  G+ES+E DQ ERN IH  L  RA  LY+TF++LEGIECQKPQGAMYLFP++ LP 
Sbjct: 461 RPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPF 520

Query: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499
           +A++EA+ L++  DEFYC KLLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWI  W+
Sbjct: 521 KAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE 580

Query: 500 KFHEKFMKEYQ 510
            FH++F  +Y+
Sbjct: 581 SFHKEFFDQYR 591

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 393/490 (80%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           DF PA ++++ D+N+ ++ A+YAVRG+I MRAEEL+ +L  +  P S PF++II ANIGN
Sbjct: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDKIINANIGN 161

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           PQQL QKPLT+ RQV+S+L+YP LL + +  L+   ++K DA++RA+ L   IG SVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGV GIR++ A FI+KRD+ E +  +DIFLT GAS AV YL+   C+   TG+LIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTA++ ++N++ LPYYLDE+SGWST  EEIE  V  AI+N IKP+ +VVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVLS + + +I  VAAKYG V+IADEVYQ+NIF G +FHSMKKILR LQ+++PGK+DN
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  G+ES+E DQ ERN IH  L  RA  LYDTF++LEGIECQKPQGAMYLFP++ LP +
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           A++EA+ L++  DEFYC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWI  W+ 
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 501 FHEKFMKEYQ 510
           FH++F  +Y+
Sbjct: 582 FHKEFFDQYR 591

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/491 (63%), Positives = 389/491 (79%), Gaps = 4/491 (0%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           ++F PA ++++ D+N+ ++ A+YAVRG+I MRAEEL+ +L  +  P S PF +II ANIG
Sbjct: 103 NEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFNKIINANIG 160

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGASVGA 140
           NPQQL QKPLT+ RQV+S+L+YP LL + +  L+   ++K DA++RA+ L  +IG SVGA
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGA 220

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS +QGV GIR + A FI+KRD  E +  +DIFLT GAS AV YL+   C+   TG+LIP
Sbjct: 221 YSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           IPQYPLYTA++ ++N++ LPYYLDE SGWST  EEIE  V  AIEN IK + +VVINPGN
Sbjct: 281 IPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGN 340

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319
           PTGAVLS + I +I  VAAKYG V+IADEVYQ+NIF G +FHSMKKILR LQ+++PGK+D
Sbjct: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFD 400

Query: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379
           NVQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVDLMV
Sbjct: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460

Query: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439
            PP  G+ES+E DQ ERN IH  L  RA  LY TF++LEGIECQKPQGAMYLFP++ LP 
Sbjct: 461 RPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPF 520

Query: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499
           RA++EA+ L++  DEFYC KLLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWI  W+
Sbjct: 521 RAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE 580

Query: 500 KFHEKFMKEYQ 510
            FH++F   Y+
Sbjct: 581 TFHKEFFDHYR 591

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/490 (62%), Positives = 389/490 (79%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           DF+PA K++  DLN  +  AEYAVRG+I  RAEEL+ EL  K   +S PF  II ANIGN
Sbjct: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEEL--KRSSNSLPFNSIINANIGN 76

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFK-DVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           PQQLDQKPLTF+RQV+SILEYP +L+   D L S  ++ KDAL+RA+ L   IG SVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAY 136

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGV GIR+T A FI++RD  E A  +DI+LT GAS A T L+  LC++  TG+L+PI
Sbjct: 137 SHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPI 196

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTAS  ++NA++LPYYLDEE+ WST+ +EIE  V++A++ GI+PS +VVINPGNP
Sbjct: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVL+ + I +I  +AAKYGI +I+DEVYQ+NIF   +FHSMKKILR+LQ  +PGK+DN
Sbjct: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHS SKG  GECGQRGGYMEIVGFS ++R  L KL SI+ICSV TGQA++DLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVK 376

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GDESY++D++ER +I++ +  RA+ LY+TF+ LEGI+CQKPQGAMYLFP+L LP++
Sbjct: 377 PPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEK 436

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           A+ E+++L +E D  YC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL PGT+WI DW++
Sbjct: 437 ALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQ 496

Query: 501 FHEKFMKEYQ 510
           FH+ F  +Y+
Sbjct: 497 FHQDFFNKYR 506

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 389/491 (79%), Gaps = 4/491 (0%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           ++F PA ++++ D+N+ ++ A YAVRG+I MRAEEL+ +L  +  P S PF +II ANIG
Sbjct: 103 NEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQL--EKDPQSLPFNKIINANIG 160

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQIGASVGA 140
           NPQQL QKPLT+ RQV+S+L+YP LL   +  L+   ++K DA++RA+ L   IG SVGA
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGA 220

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS +QGV GIR++ A FI+KRD  E A  +DIFLT GAS AVTYL+   C+   TG+LIP
Sbjct: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           IPQYPLYTA++ ++N++ LPYYLDE SGWST  EEIE  V  AI+N IKP+ +VVINPGN
Sbjct: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319
           PTGAVLS + I +I  VAAKYG V+IADEVYQ+NIF G EF+SMKK+LR LQ+ +PGK+D
Sbjct: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFD 400

Query: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379
           NVQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVDLMV
Sbjct: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460

Query: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439
            PP  G+ES+E DQ ERN IH  L  RA  LY+TF++LEGIECQKPQGAMYLFP++ +P 
Sbjct: 461 RPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPF 520

Query: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499
           +AI+EA  L++  DEFYC KLLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EW+  W+
Sbjct: 521 KAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWE 580

Query: 500 KFHEKFMKEYQ 510
            FH++F  +Y+
Sbjct: 581 IFHKEFFDQYR 591

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/488 (63%), Positives = 386/488 (79%), Gaps = 4/488 (0%)

Query: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83
           F PA + ++ D+N+ ++NA+YAVRG+I MRAEEL+ +L     PHS PF  II ANIGNP
Sbjct: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMEN--PHSLPFNDIINANIGNP 146

Query: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143
           QQL QKPL+F RQV+S+L+YP L+   +    Q + K+DA++RA+ L   IG SVGAYS 
Sbjct: 147 QQLKQKPLSFYRQVLSLLQYPELIPTLENN-PQTMIKQDAIDRAKRLLDDIGGSVGAYSS 205

Query: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203
           +QGV GIR+T A FI+ RD+   A  +DIFLT GAS AV YL+   C+ E TG+LIPIPQ
Sbjct: 206 SQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQ 265

Query: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263
           YPLYTA++ + N+  LPYYL+EE+GWST  EE+E+ ++++IEN IKPS +VVINPGNPTG
Sbjct: 266 YPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTG 325

Query: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIF-NGEFHSMKKILRQLQKKYPGKYDNVQ 322
           AVLS + I++I T+AAKYGI++IADEVYQ+N+F + +FHSMKK+LRQLQ K PG YDNVQ
Sbjct: 326 AVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQ 385

Query: 323 LASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPP 382
           LASLHSTSKGVSGECGQRGGYME+VGF+ ++R ++LKLASI++C VVTGQALVDLMV PP
Sbjct: 386 LASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPP 445

Query: 383 HVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAI 442
             G+ESYE+DQEER  IH  L KRA  L+D F  L+GI CQKPQGAMYLFP+L LP +AI
Sbjct: 446 QKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAI 505

Query: 443 EEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFH 502
           +EA    M  DEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFL+PGT+WI+DW  FH
Sbjct: 506 QEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFH 565

Query: 503 EKFMKEYQ 510
           ++F  +++
Sbjct: 566 QEFYNKFK 573

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/491 (61%), Positives = 383/491 (78%), Gaps = 7/491 (1%)

Query: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83
           F PA K+SV DLNQ  ++A+YAVRGSI MRAE+L  ++ +   P S PF++II ANIGNP
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIIN--DPGSLPFDKIITANIGNP 60

Query: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVL---LSQGIYKKDALERAELLQSQIGASVGA 140
           QQ+ QKPLTF RQV+SILEYP +L   ++L   +  G+Y++D +ERA  +   IG SVGA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 141 YSLAQGVYGIRETTARFISKRDNC-EAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199
           YS +QGV G R+T A FI+KRD C + AS +DIFLT GAS AV YL+  LC     G+LI
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259
           PIPQYPLYTA++ + N+  +PYYL E + WST  +EIE ++  ++ NG+KP A+V+INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKY 318
           NPTGA+LS   +  II ++AKYGI +IADEVYQ+NIF G EFHSM+K+L  LQ ++PG Y
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 319 DNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLM 378
           DNVQLASLHSTSKG  GECGQRGGYME++GF DEV  ++LKLASI+ICSVVTGQAL+DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 379 VDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILP 438
             PP  GD SY+ DQEERN+I   L  RAD+LY  F++LEG+ECQ+PQGAMYLFP+LILP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 439 DRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDW 498
           D+AIE+A +L++  DE+YC +LL+ TGICTVPGSGFGQ  GTYH+RTTFL PGTEWI+ W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 499 KKFHEKFMKEY 509
           ++FH++F + +
Sbjct: 481 REFHQQFYERF 491

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/495 (61%), Positives = 387/495 (78%), Gaps = 10/495 (2%)

Query: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83
           F PAPK S+ D+N+ I+ AEYA+RG+I  RAEEL+ +L   ++  S PF +I+YANIGNP
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSK--SLPFAKIVYANIGNP 65

Query: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143
           QQLDQ+PLTF RQVMS++++P LLK KD+LL+Q IY KD++ERA  L + IG SVGAYS 
Sbjct: 66  QQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSS 125

Query: 144 AQGVYGIRETTARFISKRD-------NCEAASADDIFLTDGASKAVTYLMMALCQNEHTG 196
           +QGV  IR+  ARFI KRD       +    +A ++FLT GAS AV +++    ++E  G
Sbjct: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCG 185

Query: 197 ILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVI 256
           +L+PIPQYPLYTA++ +  +K+LPYYL+E + WST  ++IE  VI+AI+  IKP+ +VVI
Sbjct: 186 VLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVI 245

Query: 257 NPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYP 315
           NPGNPTGA+L+ D I  II +AA+YGIV+IADEVYQ+N++   EFHS KK+L +L+K YP
Sbjct: 246 NPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYP 305

Query: 316 GKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALV 375
            KYDNVQLASLHS SKGV+GECGQRGGYMEI GFS++V+ +LLK+ASI+ICSVVTGQ LV
Sbjct: 306 SKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILV 365

Query: 376 DLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRL 435
           DLMV+PP  GDESYE DQ ER+ IHS L  +++ LYD F+ L GI CQKPQGAMYLFPRL
Sbjct: 366 DLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRL 425

Query: 436 ILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWI 495
            L + AI  A +L ++ DEFYC KLLENTGICTVPGSGFGQ  GTYH+RTTFL PG EWI
Sbjct: 426 HLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWI 485

Query: 496 DDWKKFHEKFMKEYQ 510
           + W+KFH +FM++Y+
Sbjct: 486 NSWEKFHLEFMEKYK 500

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/490 (62%), Positives = 393/490 (80%), Gaps = 4/490 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           +F+PA ++++ DLN+ ++ A+YAVRG I  RAEEL+ +L  K  P+S PF++II ANIGN
Sbjct: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEK--PNSLPFDKIINANIGN 108

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDVLL-SQGIYKKDALERAELLQSQIGASVGAY 141
           PQQL Q+PL+F RQV+S+L+YP LL   +    S  +YKKDA+ RA+ +   IG SVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QGVYGIR T A FI++RD  E A  +DIFLT GAS AV YL+  LC+ E TG+LIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTA++ ++N+  LPY+LDE +GWS    EIEN +  A+++ IKP  +VVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320
           TGAVLS + I  I+ +AAKYGIV+IADEVYQ+NIF+G +FHS+K +LR+LQ++ PGK+DN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHSTSKGVSGECGQRGGYMEI+GF+ EVR ++LKLASI++C VVTGQALVDLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  G+ES+  DQ +R  IHS L +RA+ L+ TF++L+GIECQKP GAMYLFP+L LP R
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
           AI+EA++L++  DEFYC +LLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWID WK+
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 501 FHEKFMKEYQ 510
           FH +FM++Y 
Sbjct: 529 FHIEFMEKYN 538

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/490 (60%), Positives = 386/490 (78%), Gaps = 10/490 (2%)

Query: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81
           H+  PA K+ + DLN+ ++ A+YAVRGSI +RAEEL+  L         PF+ +I ANIG
Sbjct: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL---EAGQKLPFDTVINANIG 87

Query: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141
           NPQQL QKPLTF RQV+SIL+YP LL+         I+KKDA+ERA  L  +IG SVG+Y
Sbjct: 88  NPQQLKQKPLTFYRQVLSILQYPELLES-----GSNIFKKDAIERARKLLKEIG-SVGSY 141

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           S +QG+  IR+T A FI+KRD+ E ++ +DIFLT GAS AV YL+  LC+NE +G+LIPI
Sbjct: 142 SSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI 201

Query: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261
           PQYPLYTA++ ++NA  LPYYLDE  GWST + EIE  + ++++ GIKP+A+V+INPGNP
Sbjct: 202 PQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNP 261

Query: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFN-GEFHSMKKILRQLQKKYPGKYDN 320
           TG++LSV+ +++II VAA +GIV+IADEVYQ+N+FN  +FHSMKK+LR LQK +PG+YD 
Sbjct: 262 TGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDT 321

Query: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380
           VQLASLHSTSKGVSGECGQRGGYME+ GF+ E++ ++LKL SI++C VVTGQALVDLMV 
Sbjct: 322 VQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVS 381

Query: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440
           PP  GDESYE+DQ ER+ I + L  RA  L++ F+++EG+ CQKP+GAMYLFP++ LP +
Sbjct: 382 PPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFK 441

Query: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500
            ++++++L +  DEFYC  LLE TGICTVPGSGFGQ+ GTYH+RTTFL+PGTEWID W K
Sbjct: 442 VLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNK 501

Query: 501 FHEKFMKEYQ 510
           FH +F  +Y+
Sbjct: 502 FHAEFYDKYR 511

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/498 (59%), Positives = 380/498 (76%), Gaps = 12/498 (2%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           D  PAPK S+ D++Q I++ EYA+RG+I  RA+EL+ +L     P+  PF++IIYANIGN
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQL--NISPNQLPFKKIIYANIGN 62

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYS 142
           PQQL+Q+PLTF RQV+S++EYP L+  K++L+   IY  DA++RAE + + IG SVGAYS
Sbjct: 63  PQQLEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYS 122

Query: 143 LAQGVYGIRETTARFISKRDNCEAA---------SADDIFLTDGASKAVTYLMMALCQNE 193
            +QG+  IR+  A+ I +RDN E           +A +IFLTDGA+ AV+Y++    ++E
Sbjct: 123 SSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDE 182

Query: 194 HTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAM 253
           + G+L+PIPQYPLYTA++ + N+K+LPYYL+E+  WST  EEIE  + +AI   IKP+ +
Sbjct: 183 NCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTL 242

Query: 254 VVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQK 312
           V+INPGNPTGA+LSV+ I +II +AAKYGIV+IADEVYQ+NI+   +FHS KKIL  L+ 
Sbjct: 243 VIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKL 302

Query: 313 KYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQ 372
           +YP KYDNVQLASLHS SKGV+GECGQRGGY E++GFSDE++ ++LKLASI+ICSVVTGQ
Sbjct: 303 QYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQ 362

Query: 373 ALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLF 432
            LVDLM  PP  GD SY+ DQ ERN I S L  +++ LYD FS L GI CQKPQGAMYLF
Sbjct: 363 ILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLF 422

Query: 433 PRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGT 492
           PRL L    I EAK   +E DEFYC KLLENTGICTVPGSGFGQ+EGTYHVRTTFL  G 
Sbjct: 423 PRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGI 482

Query: 493 EWIDDWKKFHEKFMKEYQ 510
           EWI  W+KFH +FM +Y+
Sbjct: 483 EWIKLWEKFHLEFMNQYK 500

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/483 (61%), Positives = 378/483 (78%), Gaps = 4/483 (0%)

Query: 29  KISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQLDQ 88
           K ++ D+NQ ++NA+YAVRG I +RAEEL  +L    +P S PF +II ANIGNPQQLDQ
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVE--EPGSLPFNKIINANIGNPQQLDQ 96

Query: 89  KPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLAQGVY 148
           KPLTF RQV+S+L+ P L++         ++K DA+ERA+ +  Q+G SVGAYS +QGV 
Sbjct: 97  KPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVA 156

Query: 149 GIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYT 208
           G R++ A FI +RD  E ASA+DIFLT GAS AV+ ++   C     G LIPIPQYPLYT
Sbjct: 157 GFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYT 215

Query: 209 ASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSV 268
           A++ +++A  LPYYLDE SGWS   E++E  V +AI  G++P+ +VVINPGNPTGA+LS 
Sbjct: 216 ATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSP 275

Query: 269 DVIQRIITVAAKYGIVLIADEVYQDNIFN-GEFHSMKKILRQLQKKYPGKYDNVQLASLH 327
           + I++I+TVAAKY +V+IADEVYQ+N F+  +F SMKK+LR LQK  PGKYDNVQLASLH
Sbjct: 276 EAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLH 335

Query: 328 STSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDE 387
           STSKGVSGECGQRGGYME+VGFS+EV+ + LKLASI++C VVTGQALVDLMV PP  GD 
Sbjct: 336 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDA 395

Query: 388 SYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEAKK 447
           SYE D++ERN IH++L +++  LY+TF +LEG+ CQKPQGAMYLFP+L L  +AI +A+ 
Sbjct: 396 SYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAES 455

Query: 448 LQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHEKFMK 507
           L M  DE+YC +LLE TGICTVPGSGF Q  GTYH+RTTFL+PGTEW+D WKKFH+KF+ 
Sbjct: 456 LGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVD 515

Query: 508 EYQ 510
           E++
Sbjct: 516 EHR 518

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/483 (61%), Positives = 376/483 (77%), Gaps = 4/483 (0%)

Query: 29  KISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQLDQ 88
           K ++ D+N+ ++NA+YAVRG I +RAEEL+ +L    +P S PF++II ANIGNPQQLDQ
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLE--EPGSLPFDKIINANIGNPQQLDQ 95

Query: 89  KPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLAQGVY 148
           KPLTF RQV+++L+ P L+           +K DA+ERA+ +  Q+G SVGAYS +QGV 
Sbjct: 96  KPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155

Query: 149 GIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYT 208
           G RE+ A FI +RD  E ASA DIFLT GAS AV+Y++   C     G LIPIPQYPLYT
Sbjct: 156 GFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214

Query: 209 ASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSV 268
           AS+ ++N+  LPYYLDEESGWS   E+IE  V ++I+ GI+P+ +VVINPGNPTGA+L+ 
Sbjct: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNT 274

Query: 269 DVIQRIITVAAKYGIVLIADEVYQDNIFN-GEFHSMKKILRQLQKKYPGKYDNVQLASLH 327
           D I+ +I VAAKY +V+IADEVYQ+N FN  EF SMKK+LR LQK  PGKYDNVQLASLH
Sbjct: 275 DTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLH 334

Query: 328 STSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDE 387
           STSKGVSGECGQRGGYME+VGFS+EV+ + LKLASI++C VVTGQAL+DLMV PP  GD 
Sbjct: 335 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDA 394

Query: 388 SYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEAKK 447
           SYE+D++ER +IH  L KR+  LY  F ++EG+ CQ+PQGAMYLFP+L L ++AI +A+ 
Sbjct: 395 SYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAES 454

Query: 448 LQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHEKFMK 507
             +  DE+YC +LLE TGICTVPGSGFGQ  GT+H+RTTFL+PGTEWID WKKFHEKF +
Sbjct: 455 AGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTE 514

Query: 508 EYQ 510
           +++
Sbjct: 515 DHR 517

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/489 (60%), Positives = 390/489 (79%), Gaps = 3/489 (0%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           +F+PA K+++ DLN+ ++ A+YAVRG I  RAE L+ +L     P S PF+++I ANIGN
Sbjct: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLID--NPSSLPFKKVINANIGN 92

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYS 142
           PQQL+QKPLTF RQV+S+L+YP +L       ++ +YK+DA+ERA+ + + IG+SVG+YS
Sbjct: 93  PQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGSYS 152

Query: 143 LAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIP 202
            +QGV+G+R+T A +IS+RD  E A A+DIFLT GAS AV+YL+  LC+ + +G+LIPIP
Sbjct: 153 SSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIP 212

Query: 203 QYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPT 262
           QYPLYTA++ ++N   LPYYL+E SGWST +EEIEN V NAI   I P  +VVINPGNPT
Sbjct: 213 QYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPT 272

Query: 263 GAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNV 321
           GA+LSV+ I++I  VAA +GIV+IADEVYQ+NIF G EFHSMKK+LR LQ++ PGKY+NV
Sbjct: 273 GAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENV 332

Query: 322 QLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDP 381
           QLASLHSTSKGVSGECGQRGGYME+ GFS E++H +LKL SI++C VVTGQALVDLM  P
Sbjct: 333 QLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCP 392

Query: 382 PHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRA 441
           P  G+ SYE+DQ ER+ IHS L +RA  L+  F+ +EG+ CQKPQG+MYLFP++ +P +A
Sbjct: 393 PKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKA 452

Query: 442 IEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKF 501
           +E+A++L +  DE YC +LLE TGICTVPGSGFGQ+ GT+H+RTTFL+PGT WID W++F
Sbjct: 453 LEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREF 512

Query: 502 HEKFMKEYQ 510
           H+ F  +Y+
Sbjct: 513 HQIFCNKYR 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 377/488 (77%), Gaps = 5/488 (1%)

Query: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83
           FEP   + + DLN  ++ A+YAVRG I  RA ELE +L     P S PF++IIYANIGNP
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSR--DPDSLPFKKIIYANIGNP 107

Query: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143
           QQL QKPL+FSR+V+S+LE P LL+    +L+  IYK DA+ RA+ +   +  S+GAYS 
Sbjct: 108 QQLGQKPLSFSREVLSLLESPNLLQMPMEVLNL-IYKPDAVRRAKRMMRDLQTSIGAYSH 166

Query: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203
           +QGV G R+T A ++S RD  E ASA+DIFLT GAS   + ++  LC+ + +G+LIPIPQ
Sbjct: 167 SQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQ 225

Query: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263
           YPLYTA+I ++N   LPYYLDEESGWS  ++++E  +I +IE G+KP+ +VVINPGNPTG
Sbjct: 226 YPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTG 285

Query: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQ 322
           A+L V+ ++RI  +AAKY IV+IADEVYQ+N+F G +F+SMKK+LR LQ++Y   + NVQ
Sbjct: 286 AILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQ 345

Query: 323 LASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPP 382
           L SLHSTSKG+SGECGQRGGYME+VGFSD++R ++LK+ASI +CS V GQALVDLM+  P
Sbjct: 346 LVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRP 405

Query: 383 HVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAI 442
             GDESYE+D  ER+ I + L++R+  L++TF+NLEG+EC+KPQG+MYLFPRL+LP +AI
Sbjct: 406 KPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAI 465

Query: 443 EEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFH 502
           + A+ L M+ DEFYC +LL +TGICTVPGSGFGQ   T H+RTTFL PGTEWI+ W+ FH
Sbjct: 466 KAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFH 525

Query: 503 EKFMKEYQ 510
           + F  +Y+
Sbjct: 526 KSFYDKYR 533

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/492 (57%), Positives = 374/492 (76%), Gaps = 6/492 (1%)

Query: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82
           DF P  K+++ DLN KII  +YAVRG I  RAEEL+ +L  +  P S PF +II ANIGN
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQL--EKDPKSLPFNKIINANIGN 65

Query: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKD---VLLSQGIYKKDALERAELLQSQIGASVG 139
           PQQL QKPL+F R+V+SIL+YP +L+ +     L+   +Y+KD + RA  L  +IG SVG
Sbjct: 66  PQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125

Query: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199
           AYSL+QGV GI++T A +I+KRD+ E A  +DIFLT GAS AV++++   C    TG+LI
Sbjct: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185

Query: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259
           PIPQYPLYTA+I +  A  + YYL+EE  WS    E+EN++  +I++GIKP+ +V+INPG
Sbjct: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKY 318
           NPTG++L+   I  II ++AKYG+++IADEVYQ+N+F+G EFHS+KK+LR+LQ+KY G Y
Sbjct: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305

Query: 319 DNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLM 378
           + VQLASLHSTSKG+ GECGQRGGYME++G +D+VR  ++KL SI+ICSVVTGQAL+D++
Sbjct: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365

Query: 379 VDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILP 438
           V PP  GDESYE DQ ERN I + L  R+ KL+  F +LEG+EC +PQGAMYLFP+ I P
Sbjct: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425

Query: 439 DRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDW 498
            + I+ A+KL  EAD  YC +LLE+TGICTVPGSGFGQ+  TYH+RTTFL PG  WID W
Sbjct: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485

Query: 499 KKFHEKFMKEYQ 510
           +KFH +F + Y+
Sbjct: 486 RKFHTEFCERYR 497

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/485 (58%), Positives = 370/485 (76%), Gaps = 4/485 (0%)

Query: 27  APKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQL 86
           A ++   DLN  ++ A+YAVRG+I   A++L+ +L     P + PFE +I +NIGNPQQL
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLK--HPGTLPFESVINSNIGNPQQL 138

Query: 87  DQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLAQG 146
            QKPL+F RQV+SILEYP LL  +  L+    Y  D++ERA+ L + IG S+GAYS +QG
Sbjct: 139 GQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197

Query: 147 VYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPL 206
           V+GIR+T A FI+ RD+ E A  DDIFLT GAS AV+ ++  LC+ + TG+LIPIPQYPL
Sbjct: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPL 257

Query: 207 YTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVL 266
           YTA++ +++A  LPYYLDE +GWST + EI     +++E GIKP+ +VVINPGNPTG+VL
Sbjct: 258 YTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317

Query: 267 SVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQLAS 325
           +V+ I+ +  VAAKYG+V+IADEVYQDNIF G EFHSMKKILR LQK+ P KYDN+QLAS
Sbjct: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377

Query: 326 LHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVG 385
           LHS SKG+ GECG RGGY E +GF+ EV+ ++ KL+SI++CS V GQALVDLM  PP  G
Sbjct: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437

Query: 386 DESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEA 445
           + SYE DQ ER  I +  KKR++KLY+ F++LEG+ CQKPQGAMY+FP + LP  AI+ A
Sbjct: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497

Query: 446 KKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHEKF 505
           + L +  DEFYC +LL+ TGICTVPGSGFGQ+ GTYHVRTTFL+PG EW+  W+KFH +F
Sbjct: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557

Query: 506 MKEYQ 510
            ++Y+
Sbjct: 558 FEKYR 562

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/488 (57%), Positives = 363/488 (74%), Gaps = 5/488 (1%)

Query: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83
           F PA  +++AD+N+ ++ A+YAVRG I  RAEELE     +  P S PF +II ANIGNP
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERR--LEEHPGSLPFSKIIQANIGNP 94

Query: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143
           QQL QKPLTF RQV+S+++ P LL+     L Q  +K D + RA  +    G SVGAYS 
Sbjct: 95  QQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA-FKADVVVRARRMLQDAGGSVGAYSA 153

Query: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203
           +QGV G R T A+FI +RD    A+ D+++LT GAS AV+ L+   C+   TG+LIPIPQ
Sbjct: 154 SQGVKGYRRTVAQFIERRDGI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQ 212

Query: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263
           YPLYTA+I  +NA  LPYYL+E  GWST  +E+E  ++++ +  I P  +VVINPGNPTG
Sbjct: 213 YPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTG 272

Query: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIF-NGEFHSMKKILRQLQKKYPGKYDNVQ 322
           +VLSV  ++ I+T+AAKYGIV+IADEVYQDN+F + +FHSM+K+L+ LQ + P  Y NVQ
Sbjct: 273 SVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQ 332

Query: 323 LASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPP 382
           LASLHS SKG+SGECGQRGGYME++GF +E+R + +KLASI++C VVTGQALVDLMV PP
Sbjct: 333 LASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPP 392

Query: 383 HVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAI 442
             GD SYE+  +E   I+  L++R+  L+ TF +LEGIEC  PQGA+YLFP+L LP +AI
Sbjct: 393 SQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAI 452

Query: 443 EEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFH 502
           E A+KL + ADE YC +LL+ TGICTVPG+GFGQ  GTYHVRTTFL PGT+WI+ WK FH
Sbjct: 453 EAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFH 512

Query: 503 EKFMKEYQ 510
           +KF  +Y+
Sbjct: 513 KKFYDKYR 520

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 90/187 (48%), Gaps = 18/187 (9%)

Query: 151 RETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTAS 210
           R  T+ F  K  N +   AD++ L  G+ +++  L+ A C      ILI    Y +YT  
Sbjct: 71  RNKTSIF--KDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTIC 128

Query: 211 ICIHNAK--MLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSV 268
             +++ +   +P  L EE  +    E+I    +  ++N      + + +PGNPTG  + V
Sbjct: 129 SQVNDVEYVTVPLLLSEEDKFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFIDV 184

Query: 269 DVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHS 328
           + I++I++   + G+V++ DE Y D +   +  S+  +          KY+N+ +    S
Sbjct: 185 NRIEKILS-QWQTGLVVV-DEAYIDFVEGSDKGSLAPL--------ATKYENIAVLQTLS 234

Query: 329 TSKGVSG 335
            S G++G
Sbjct: 235 KSFGLAG 241

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 107/240 (44%), Gaps = 28/240 (11%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML--PYYLDE 225
           SAD++ L  G+ +++  L+ A C      ILI  P Y +Y+    I++ +++  P  +++
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 226 ESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVL 285
            S      +   + VI  ++         V +PGNPTGA++ +  I++I++   + GIV 
Sbjct: 146 NS-----FQMNTDKVIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIVA 199

Query: 286 IADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYME 345
           I DE Y D      F S       L  KYP       LA L + SK   G  G R G   
Sbjct: 200 I-DEAYID------FCSTGGSAAPLVNKYP------NLAVLQTLSKSF-GLAGVRLG--- 242

Query: 346 IVGFS--DEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTL 403
            V F+  D  R L    A  NI S+ +   L  L  +      ++ ++  EER  +   L
Sbjct: 243 -VTFTSKDLSRVLNAMKAPYNISSMASNLVLKALSSESVQTMKDNVQEIVEERERVLKAL 301

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 73/141 (51%), Gaps = 17/141 (12%)

Query: 170 DDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PYYL 223
           +++ +T GA++ +   +M +  N++  +++  P +  Y  +I +   K++      P  L
Sbjct: 115 ENVLVTTGANEGILACLMGIL-NQNDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDL 173

Query: 224 DEE----SGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAA 279
           D+     + W+   E+ EN + N      K  A+++  P NP G V + + ++RI  +  
Sbjct: 174 DKRVTKGTEWTLDFEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIGDICV 227

Query: 280 KYGIVLIADEVYQDNIFNGEF 300
           K+ +++I+DEVY +  F  EF
Sbjct: 228 KHNVIIISDEVYDNLYFVDEF 248

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 74/359 (20%), Positives = 154/359 (42%), Gaps = 51/359 (14%)

Query: 138 VGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGI 197
           V  YS  +G   + E+  +  S   N E   A+++ +T GA++ +   +M +  N    +
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAEL-KAENVTVTTGANEGILSCLMGIL-NPGDEV 141

Query: 198 LIPIPQYPLYTASICIHNAKML------PYYLDEE----SGWSTKVEEIENSVINAIENG 247
           ++  P +  Y  +I +   K++      P  +D+     + W+   E+  N++ +     
Sbjct: 142 IVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD----- 196

Query: 248 IKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKIL 307
            K  A+++  P NP G V + + + RI  +  K  +V+I+DEVY+   F   F  +  + 
Sbjct: 197 -KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDSFTRIATLS 255

Query: 308 RQLQKKYPGKYDNVQLASLHSTSKGVS-GECGQRGGYMEIVGFSDEVRHLLLKLASINIC 366
            ++ +            +L   S G S    G R G+  +V  + E+   + K A   IC
Sbjct: 256 PEIGQ-----------LTLSVGSAGKSFAATGWRVGW--VVSLNPELLSYVSK-AHTRIC 301

Query: 367 SVVTG---QALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQ 423
                   +A+ + + D   +    +E  ++E        K + D     F  L G+   
Sbjct: 302 FASPSPLQEAVANSINDALEIN--YFENMRQE-------YKHKYDIFTSVFKEL-GLPYT 351

Query: 424 KPQGAMYL---FPRLILPDRAIEEAKKLQMEADEF-YCHKLLENTGICTVPGSGFGQRE 478
           +P+G  ++   F ++ +P+      +++  +A +F   + L+   G+  +P + F  +E
Sbjct: 352 EPEGTYFILVDFSKVKIPE-GYSYPEEIANKAKDFRIAYWLINELGVVAIPPTEFYIKE 409

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/324 (19%), Positives = 139/324 (42%), Gaps = 44/324 (13%)

Query: 170 DDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PYYL 223
           +++ +T GA++ +   +M L  N    +++  P +  Y ++I +   K++      P  L
Sbjct: 117 ENVTITTGANEGILSCLMGLL-NAGDEVIVFEPFFDQYISNIELMGGKIVYVPINPPKEL 175

Query: 224 D----EESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAA 279
           D    E + W+  +E+ +N++ +      K  A+++  P NP G V + + + +I  +  
Sbjct: 176 DQRVTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNICV 229

Query: 280 KYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQ 339
           +  +++I+DEVY+   F  EF  +  +  ++           QL     ++       G 
Sbjct: 230 EKNVIIISDEVYEHLYFTDEFTRIATLSPEIG----------QLTLTVGSAGKTFAATGW 279

Query: 340 RGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDES--YEKDQEERN 397
           R G+  ++  + E+   + K A   IC   +   L +   +  +   ES  +EK ++E  
Sbjct: 280 RIGW--VISLNSELLQYVSK-AHTRIC-FASPSPLQEACANSINDALESNYFEKMRQEYI 335

Query: 398 EIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYL---FPRLILPDRAIEEAKKLQMEADE 454
           +         ++L        G+   KP+G  ++   F ++ +P+      + L    D 
Sbjct: 336 QKFKIFTSVFEEL--------GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKDF 387

Query: 455 FYCHKLLENTGICTVPGSGFGQRE 478
              H L+   G+  +P + F  +E
Sbjct: 388 RISHWLINELGVVAIPPTEFYIKE 411

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/330 (20%), Positives = 138/330 (41%), Gaps = 54/330 (16%)

Query: 169 ADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PYY 222
           A+++ +T GA++ +   +M L  N    +++  P +  Y  +I +   K++      P  
Sbjct: 131 AENVTVTTGANEGILSCLMGLL-NSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 223 LDEESG----WSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVA 278
           LD+ +     W+   E+ EN++ +      K  A+++  P NP G V + + +  +  + 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 279 AKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVS-GEC 337
            K+ +V+I+DEVY+   F   F  +  +  ++ +            +L   S G S    
Sbjct: 244 VKHNVVIISDEVYEHLFFTDSFTRIATLSPEIGQ-----------LTLTVGSAGKSFAAT 292

Query: 338 GQRGGYM-----EIVGFSDEVRHLLLKLASINICSVVTGQALVD-LMVDPPHVGDESYEK 391
           G R G++     E++ ++ +  H  +  AS +        ++ D L +D        +EK
Sbjct: 293 GWRIGWVLSLNAELLSYAAKA-HTRICFASPSPLQEACANSINDALKID-------YFEK 344

Query: 392 DQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYL---FPRLILPDRAIEEAKKL 448
            ++E            DKL        G+    P+G  ++   F ++ +P+      + L
Sbjct: 345 MRQEYITKFKIFTSIFDKL--------GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEIL 396

Query: 449 QMEADEFYCHKLLENTGICTVPGSGFGQRE 478
               D    H L+   G+  +P + F  +E
Sbjct: 397 DKGKDFRISHWLINELGVVAIPPTEFYIKE 426

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 69/142 (48%), Gaps = 17/142 (11%)

Query: 169 ADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PYY 222
           A+++ +T GA++ +   +M L  N    +++  P +  Y  +I +   K++      P  
Sbjct: 115 AENVVVTTGANEGILSCLMGLL-NSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 223 LDEESG----WSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVA 278
           LD+ +     W+   E+ E ++ +      K  A+++  P NP G V + D +  +  + 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNIC 227

Query: 279 AKYGIVLIADEVYQDNIFNGEF 300
            K+ +V+I+DEVY+   F   F
Sbjct: 228 VKHNVVIISDEVYEHLYFTDSF 249

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 88/180 (48%), Gaps = 16/180 (8%)

Query: 158 ISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAK 217
           + K    E  + D++ L  G+ + +  L+ A C+ E   IL   P Y +Y+    I++ +
Sbjct: 73  LDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVE 132

Query: 218 MLPYYL-DEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIIT 276
           ++   L  E++ +   V E    V++ ++N  K   + + +PGNPTG +++   I+ I+ 
Sbjct: 133 IVECPLITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILE 188

Query: 277 VAAKYGIVLIADEVYQDNI-FNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSG 335
                G+V++ DE Y D     G  +SM K++         KY N+ +    S S G++G
Sbjct: 189 NWTN-GLVVV-DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSFGLAG 238

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/358 (20%), Positives = 146/358 (40%), Gaps = 49/358 (13%)

Query: 138 VGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGI 197
           V  YS  +G   +  +  +  S   N E   A+++ +T GA++ +   +M L  N    +
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNTEL-KAENVTVTTGANEGILSCLMGLL-NAGDEV 142

Query: 198 LIPIPQYPLYTASICIHNAKML------PYYLDEESG----WSTKVEEIENSVINAIENG 247
           ++  P +  Y  +I +   K++      P  LD+ +     W+   E+ E ++ +     
Sbjct: 143 IVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS----- 197

Query: 248 IKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKIL 307
            K  A+++  P NP G V + + +  +  +  K+ +V+I+DEVY+   F   F  +  + 
Sbjct: 198 -KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLS 256

Query: 308 RQLQKKYPGKYDNVQLASLHSTSKGVS-GECGQRGGYMEIVGFSDEVRHLLLKLASINIC 366
            ++ +            +L   S G S    G R G+  ++  + E+     K A   IC
Sbjct: 257 PEIGQ-----------LTLTVGSAGKSFAATGWRIGW--VLSLNAELLSYAAK-AHTRIC 302

Query: 367 SVVTG---QALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQ 423
                   +A  + + D   +G   +EK ++E            D+L        G+   
Sbjct: 303 FASPSPLQEACANSINDALKIG--YFEKMRQEYINKFKIFTSIFDEL--------GLPYT 352

Query: 424 KPQGAMYL---FPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQRE 478
            P+G  ++   F ++ +P+      + L    D    H L+   G+  +P + F  +E
Sbjct: 353 APEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKE 410

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 75/168 (44%), Gaps = 18/168 (10%)

Query: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199
            Y   QG + +R+  A   S  D     S +++ LT+GA  A  +L       +    + 
Sbjct: 54  TYGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAI-AANFLTHYTLAGKGDHFIC 110

Query: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVI--N 257
             P Y   ++   +  A++   +L +E+ +   + E+E          IKP+   ++   
Sbjct: 111 ISPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERM--------IKPNTKCIVLNT 162

Query: 258 PGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKK 305
           P NP  +V+  + ++ I  +A K+GIV+  DEVY        FHS +K
Sbjct: 163 PNNPLSSVIPTETLREIAELADKHGIVVFCDEVYSP-----LFHSCEK 205

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 90/431 (20%), Positives = 178/431 (41%), Gaps = 62/431 (14%)

Query: 73  ERIIYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVL-LSQGI--YKKDALERAEL 129
           +R I  N+   Q L +   + + +  +   +    K +D++ L QG   Y   A    E 
Sbjct: 16  QRQIVPNLALTQNLTKDVWSLTNEAAAAAAHNAQNKGRDLINLGQGFFSYSPPAFVVEEA 75

Query: 130 LQSQIGASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMAL 189
            ++   A V  YS  +G   +  +  +  S   N +   A++I +T GA++ +   ++ L
Sbjct: 76  QKALDDAMVNQYSPTKGRMSLINSLIKQYSPLYNTQL-QANNIQVTTGANEGILACLVGL 134

Query: 190 CQNEHTGILIPIPQYPLYTASICI----------HNAKMLPYYLDEESGWSTKVEEIENS 239
             N    +++  P +  Y ++I I          H  K +     E + W+   +E+  +
Sbjct: 135 L-NPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTVDYDELRAA 193

Query: 240 VINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGE 299
           +        K  A+++  P NP G V + + + +I  +  +  +V+I+DEVY+   F  E
Sbjct: 194 ITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYEHLYFTPE 247

Query: 300 FHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVS-GECGQRGGYMEIVGFSDEV----- 353
           F  +  +  ++ +            +L   S G S    G R G+  IV  + E+     
Sbjct: 248 FTRVATLSPEIGQ-----------ITLTIGSAGKSFAATGWRIGW--IVSLNPELLEYAS 294

Query: 354 -RHLLLKLASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYD 412
             H  +  AS +        AL      P  + +  ++K +EE     +   +  D+L  
Sbjct: 295 MAHTRICFASPSPLQEACANAL------PIALDNGYFKKMREEYIHKFNIFTRVFDEL-- 346

Query: 413 TFSNLEGIECQKPQGAMYL---FPRLILP-DRAIEEAKKLQMEADEF-YCHKLLENTGIC 467
                 G+   KP+G  ++   F ++ +P D    E  +L+ +A +F   + L+   G+ 
Sbjct: 347 ------GLPYTKPEGTYFVLVDFSKVKIPEDYPFPE--ELRSKAKDFRISYWLINELGVV 398

Query: 468 TVPGSGFGQRE 478
            +P + F  +E
Sbjct: 399 AIPPTEFYIKE 409

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 82/162 (50%), Gaps = 14/162 (8%)

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASAD--DIFLTDGASKAVTYLMMALCQNEHTGIL 198
           YS  QG+  + +    FI+K +N    +    DI L +G+S ++  +   LC +E T +L
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLC-DESTTVL 195

Query: 199 IPIPQYPLYTASICIHNAKMLPYYLD---EESGWSTKVEEIENSVIN-----AIENGIKP 250
           +    +    +++    AK +P  L+   E+ G    +E +EN + N       ++  KP
Sbjct: 196 MEEFTFVPVISNVMATGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 251 SAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
             +  I+ G NP G  LS++  ++I T+A ++ ++++ D+ Y
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/325 (20%), Positives = 137/325 (42%), Gaps = 46/325 (14%)

Query: 170 DDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PYYL 223
           ++I +T GA++ +   +M L  N    +++  P +  Y ++I +   K++      P  L
Sbjct: 120 ENITITTGANEGILSCLMGLL-NAGDEVIVFEPFFDQYISNIELMGGKVVYVPINPPKDL 178

Query: 224 D----EESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAA 279
           D    E + W+   E+  N++        K  A++V +P NP G V + + + ++  +  
Sbjct: 179 DQRITEGTEWTIDFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELTKLGEICV 232

Query: 280 KYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQ 339
           +  +++I+DEVY+   FN  F  +  +  ++           QL     ++       G 
Sbjct: 233 ENNVIIISDEVYEFLYFNDSFTRIATLSPEIG----------QLTLTVGSAGKTFAATGW 282

Query: 340 RGGYMEIVGFSDEVRHLLLKLASINICSVVTG---QALVDLMVDPPHVGDESYEKDQEER 396
           R G+  ++  + E+   + K A   IC        +A  + + D    G   +EK ++E 
Sbjct: 283 RIGW--VISQNPELLQYVSK-AHTRICFASPSPLQEACANSINDALESG--YFEKMRKEY 337

Query: 397 NEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYL---FPRLILPDRAIEEAKKLQMEAD 453
            +          K+++      G+   KP+G  ++   F ++ +P+      + L    D
Sbjct: 338 VQKF--------KIFNAVFEELGLPYTKPEGTYFVLADFSKVKIPEDYPWPEEILDKGKD 389

Query: 454 EFYCHKLLENTGICTVPGSGFGQRE 478
               H L+   G+  +P + F  +E
Sbjct: 390 FRISHWLINELGVVAIPPTEFYIKE 414

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/361 (20%), Positives = 157/361 (43%), Gaps = 55/361 (15%)

Query: 138 VGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGI 197
           V  Y+  +G   +  +  +  S   N +   A ++ +T GA++ +   ++ L  N    +
Sbjct: 84  VNQYAPTKGRVSLINSLVKLYSPLYNTQL-DASNVQVTTGANEGILSCLVGLL-NPGDEV 141

Query: 198 LIPIPQYPLYTASICIHNAKM--LPYYLDEE--------SGWSTKVEEIENSVINAIENG 247
           ++  P +  Y ++I I   K+  +P +  +E        + W+   +E+E ++       
Sbjct: 142 IVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGTEWTVNYDELEAAITP----- 196

Query: 248 IKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKIL 307
            K  A+++  P NP G V + + + RI  +  K+ +V+I+DEVY+   F  EF  +  + 
Sbjct: 197 -KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISDEVYEHLYFTPEFTRIATLS 255

Query: 308 RQLQKKYPGKYDNVQLASLHSTSKGVS-GECGQRGGYMEIVGFSDEVRHLLLKLASI--- 363
            ++ +            +L   S G S    G R G+  +V  + E    LLK AS+   
Sbjct: 256 PEIGQ-----------ITLTVGSAGKSFAATGWRIGW--VVSLNPE----LLKYASMAHT 298

Query: 364 NICSVVTGQALVDLMVDPPHVGDES--YEKDQEERNEIHSTLKKRADKLYDTFSNLEGIE 421
            IC   +   L +   +  +   ++  +EK ++E         +  D+L        G+ 
Sbjct: 299 RIC-FSSPSPLQEACANSLNTALDNGYFEKMRQEYINKFKIFTRVFDEL--------GLP 349

Query: 422 CQKPQGAMYL---FPRLILPDRAIEEAKKLQMEADEF-YCHKLLENTGICTVPGSGFGQR 477
             +P+G  ++   F ++ +PD      ++L+ +  +F   + L+   G+  +P + F  +
Sbjct: 350 YTEPEGTYFVLVDFSKVKIPDN-YPFPEELRSKGKDFRISYWLVNELGVVAIPPTEFYIK 408

Query: 478 E 478
           E
Sbjct: 409 E 409

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 99/234 (42%), Gaps = 33/234 (14%)

Query: 249 KPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILR 308
           K  A+++ +P NP G V + + + ++  +  + GI +I+DEVY+   F  EF  +  +  
Sbjct: 212 KTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTDEFTRIATLSE 271

Query: 309 QLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLAS---INI 365
           ++              S H+ + G +G+     G+   +G+       LL LAS   + I
Sbjct: 272 EI--------------SQHTLTVGSAGKSFAATGWR--IGWVISRNKELLALASKAHVRI 315

Query: 366 CSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKP 425
           C            V   H    +Y  D        +  +K+ ++    F +L G+   + 
Sbjct: 316 CFSSPAPLQEACAVAIEHALKTTYYADT------RAAYQKKYERFQKPFDDL-GLPYTRA 368

Query: 426 QGAMYL---FPRLILP-DRAIEEAKKLQMEADEF-YCHKLLENTGICTVPGSGF 474
           +G+ +L   F RL LP D    E  +L  +  +F   + L+   G+  +P S F
Sbjct: 369 EGSYFLLVDFSRLPLPADYHFPE--ELADKGRDFRVAYWLINELGLVAIPCSSF 420

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 102/226 (45%), Gaps = 24/226 (10%)

Query: 150 IRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTA 209
           +R T + F  K  N    + +++ L  G+ + +  L+ A C      ILI  P Y +Y+ 
Sbjct: 70  LRNTDSVF--KDQNLPPLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSI 127

Query: 210 SICIHNAKMLPYYLD-EESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSV 268
              I++ + +   L  E++ +    E+    VI  ++N      + + +PGNPTGA++  
Sbjct: 128 CTDINDVEYVKVPLVVEDNSFQMDTEK----VIETLQNDPSIKLVFITSPGNPTGALIKP 183

Query: 269 DVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHS 328
           + I+++++   + G V++ DE Y D      F +    +  L  KYP       LA L +
Sbjct: 184 ENIEKLLS-QWQSGFVVV-DEAYID------FCTTGGSVAPLVNKYP------NLAVLQT 229

Query: 329 TSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQAL 374
            SK   G  G R G       SD  R L    A  NI ++ +  A+
Sbjct: 230 LSKSF-GLAGIRLGIT--FTSSDFSRILNAMKAPYNISAMASNLAI 272

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/354 (19%), Positives = 148/354 (41%), Gaps = 41/354 (11%)

Query: 138 VGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGI 197
           V  YS  +G   + ++  +F +   N +  +A+    T GA++A+  +++ L  N    +
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFT-GANEAIFSILIGLL-NPGDEV 133

Query: 198 LIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVE-----EIENSVINAIENGIKPSA 252
           ++  P +  Y  +I +   K++   +       T+V      +I+   + A  N  K  A
Sbjct: 134 IVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQAAMNS-KTKA 192

Query: 253 MVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQK 312
           +++  P NP G V +   ++R+  +  K  +V+I+DEVY+   F   F  +  +  ++  
Sbjct: 193 IIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKDSFTRIATLSPEIG- 251

Query: 313 KYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQ 372
                    QL    + + G +G+     G+   +G++  +   LL  A+         +
Sbjct: 252 ---------QL----TLTVGSAGKSFAATGWR--IGWALSLNQELLSYAA---------K 287

Query: 373 ALVDLMVDPPHVGDESYEK--DQEERNEIHSTLKKRADKLYDTFSNL---EGIECQKPQG 427
           A   +    P    E+     +  E+ E     + +  + Y+ F+N+    G+   +P+G
Sbjct: 288 AHTRICFASPSPLQEAVANAFNDAEKVEYFKETRLQYIRKYEIFTNVLNELGLPYTEPEG 347

Query: 428 AMYL---FPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQRE 478
             ++   F ++ +P       + L    D    + L+   G+  +P + F  +E
Sbjct: 348 TYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYWLMNELGVVAIPPTEFYIKE 401

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 62/125 (49%), Gaps = 7/125 (5%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEES 227
           +AD++ +T+GA  A  +L+          I+   P Y   ++   +  A +   +L+ E 
Sbjct: 80  TADNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAED 138

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIA 287
           G++  ++++++ V            +V+ NP NP G+V+S + +  II  A +  I ++ 
Sbjct: 139 GYTPNIQKLKSKV------RANTKYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVC 192

Query: 288 DEVYQ 292
           DEVY 
Sbjct: 193 DEVYS 197

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/332 (20%), Positives = 133/332 (40%), Gaps = 62/332 (18%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASI--CIHNAKMLPYYLDEE-- 226
           ++ +T GA++ +   +M +  N    +++  P +  Y  +I  C    + +P +  +E  
Sbjct: 106 NVLVTTGANEGILSCLMGIL-NAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMK 164

Query: 227 ------SGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAK 280
                   W    + +E +  N      K  A+++  P NP G V +   + ++  +  +
Sbjct: 165 TRNTTGDEWQIDWDALEKTFNN------KTKAVIINTPHNPIGKVFTEQELTKLAQLCVE 218

Query: 281 YGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHST--SKGVS-GEC 337
           +  V+I+DEVY+   F   F  +  I             N  +A+L  T  S G S    
Sbjct: 219 HNTVVISDEVYEHLYFTESFPRIANI-------------NEDIANLTLTVGSAGKSFAAT 265

Query: 338 GQRGGYMEIVGFSDEVRHLLLKLASINIC--------SVVTGQALVDLMVDPPHVGDESY 389
           G R G+  I+  +D++ + + K A   IC            G     L +D        +
Sbjct: 266 GWRIGW--IISKNDQLLNYVSK-AHTRICFASPSPLQEACAGSIEHALKID-------YF 315

Query: 390 EKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYL---FPRLILPDRAIEEAK 446
            K +EE  +    L    DKL        G+   +P+G  ++   F ++ +P+  +   +
Sbjct: 316 PKMREEYRKKFEILTTAFDKL--------GLNYTQPEGTYFILVDFSKVKIPEDYVYPEE 367

Query: 447 KLQMEADEFYCHKLLENTGICTVPGSGFGQRE 478
            L+   D    + L+   GI  +P + F  +E
Sbjct: 368 LLEKAKDFRISYWLINEIGIVAIPPTEFYIKE 399

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 81/175 (46%), Gaps = 20/175 (11%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEES 227
           +AD++ L  G+ +++  ++ A C      IL+  P Y +Y+    I++ +++   L    
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSD 145

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIA 287
           G      E   +V+  ++N      M V +PGNPTGA +   +I++++      G+V++ 
Sbjct: 146 GSFQMDTE---AVLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV- 200

Query: 288 DEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGG 342
           DE Y D  F G   +       L  KYP       L +L + SK   G  G R G
Sbjct: 201 DEAYVD--FCGGSTA------PLVTKYP------NLVTLQTLSKSF-GLAGIRLG 240

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 88/180 (48%), Gaps = 24/180 (13%)

Query: 165 EAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML--PYY 222
           ++ +AD++ L  G+ +++  ++ A C      IL+  P Y +Y+    I++ +++  P  
Sbjct: 83  KSLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLV 142

Query: 223 LDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYG 282
           + + S +   VE    +V+  +EN      + V +PGNPTGA +   +I++++    + G
Sbjct: 143 VSDNS-FQMDVE----AVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNG 196

Query: 283 IVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGG 342
           +V++ DE Y D  F G   +       L  KYP       L +L + SK   G  G R G
Sbjct: 197 LVVV-DEAYID--FCGGSTA------PLVTKYP------NLVTLQTLSKSF-GLAGIRLG 240

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 70/149 (46%), Gaps = 17/149 (11%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PY 221
           + +++ +T GA++ +   +M L  N    +++  P +  Y ++I +   K++      P 
Sbjct: 114 TTENVTVTTGANEGILSCLMGLL-NAGDEVIVFEPFFDQYISNIELCGGKVVYVPINPPK 172

Query: 222 YLDEESG----WSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITV 277
            LD  +     W+   E+ E ++        K  A+++  P NP G V + + +  +  +
Sbjct: 173 ELDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNI 226

Query: 278 AAKYGIVLIADEVYQDNIFNGEFHSMKKI 306
             K+ +++I+DEVY+   F   F  +  I
Sbjct: 227 CVKHNVIIISDEVYEHLYFTDSFTRIATI 255

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 87/202 (43%), Gaps = 26/202 (12%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAK---MLPYYLDEES 227
           D+  T G + A   ++   C     G  I   Q+  +++SI    A+   + P  LDE  
Sbjct: 134 DVLATIGNTGAWESVLRIFCNR---GDTILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLI 286
              +K+E I +   N  E   KP  +  +  G NPTG+ LS D  + I  +A K+  ++I
Sbjct: 190 IIPSKLETILD---NWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 287 ADEVY-----------QDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSG 335
            DE Y             N     +   K+ ++ L+K +       ++  L S SK ++ 
Sbjct: 247 EDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA- 305

Query: 336 ECGQRGGYMEIVGFSDEVRHLL 357
             G R G+  IVG  D +  +L
Sbjct: 306 -PGTRFGW--IVGAKDILARIL 324

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 91/195 (46%), Gaps = 20/195 (10%)

Query: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201
           +L + +   R  T+ F  K +     S  +I L  G+ + V  L+ A C  +   +L+  
Sbjct: 62  TLKELMANYRNNTSAF--KSEGLAPISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLP 119

Query: 202 PQYPLYTASICIHNAKMLPYYL-DEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260
           P Y +Y+    I++ +++   L  E++ +   ++ +  ++ N  ++ IK   + +  PGN
Sbjct: 120 PTYSMYSVFAMINDTEVVECPLITEDNSFDMDLDNVLETLSN--DDSIK--LLFITTPGN 175

Query: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDN 320
           PTGA +S   I+ ++   +  GIV++ DE Y D        S       L  KYP    N
Sbjct: 176 PTGASISTQKIEMLLNNWSA-GIVVV-DEAYID-------FSSSDSAAPLVNKYP----N 222

Query: 321 VQLASLHSTSKGVSG 335
           + +    S S G++G
Sbjct: 223 LVVIQTLSKSFGLAG 237

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 9/139 (6%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PY 221
           SAD+I +  GA++A+   +M L  N+   +++  P +  Y ++I +    +       P 
Sbjct: 103 SADNITVHTGANEAIFSCLMGLL-NKGDEVIVFEPFFDQYISNIELAGGVVRYVPINPPR 161

Query: 222 YLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKY 281
            LD+     T+ E I+  ++    N  +   +++  P NP G V + + + R+  +    
Sbjct: 162 ELDDRVTRGTEWE-IDWDILEKTINS-RTKCVIINTPHNPIGKVFTREELLRLGKICVDN 219

Query: 282 GIVLIADEVYQDNIFNGEF 300
            IV+I+DEVY+   F+ EF
Sbjct: 220 NIVIISDEVYEHLYFSDEF 238

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 135/323 (41%), Gaps = 50/323 (15%)

Query: 170 DDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICI----------HNAKML 219
            ++ +T GA++A+   ++ L  N+   +++  P +  Y ++I I          H  K L
Sbjct: 119 SNVQVTTGANEAILSCLVGLL-NQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 220 PYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAA 279
              +   + W+   +E+  ++        K  A+++  P NP G V + + +  I  +  
Sbjct: 178 ENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICV 231

Query: 280 KYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQ 339
           +  +V+I+DEVY+   F  EF  +  +  ++         N+ L S+ S  K  +   G 
Sbjct: 232 ENNVVIISDEVYEHLYFTSEFTRIATLSPEI--------GNLTL-SVGSAGKTFAA-TGW 281

Query: 340 RGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDESYEKDQE--ERN 397
           R G+  IV  + E    LLK AS+         A   +    P    E+  K  E   +N
Sbjct: 282 RIGW--IVSQNAE----LLKYASM---------AHTRICFASPSPFQEACAKSIEIALQN 326

Query: 398 EIHSTLKKRADKLYDTFSNL---EGIECQKPQGAMYL---FPRLILPDRAIEEAKKLQME 451
                +++     +D F+ +    G+   +P+G  ++   F ++ +P+      + L   
Sbjct: 327 NYFEKMRQEYINKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKA 386

Query: 452 ADEFYCHKLLENTGICTVPGSGF 474
            D    + L+   G+  +P + F
Sbjct: 387 KDFRISYWLINELGVVAIPPTEF 409

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 78/354 (22%), Positives = 148/354 (41%), Gaps = 47/354 (13%)

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS  +G   + ++   F S   N E  +  ++ +T GA++ +   ++ L  N    +++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYN-ETLNESNVTITTGANEGILASLVGLL-NPGDEVIVF 145

Query: 201 IPQYPLYTASICIHNAKM------LPYYLDEES--GWSTKVE-EIENSVINAIENGIKPS 251
            P +  Y ++I I   K+       P  L E    G   K++ +I N  IN      +  
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE-----RTK 200

Query: 252 AMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQ 311
            +++  P NP G V + + + ++  +  K  I +I+DEVY+   F  EF  +  I +++ 
Sbjct: 201 CIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGDEFTRIATISKEIG 260

Query: 312 KKYPGKYDNVQLASLHSTSKGVS-GECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVT 370
                        +L   S G S    G R G+  +V  + E+   + K A   IC   +
Sbjct: 261 D-----------LTLSVGSAGKSFAATGWRIGW--VVSRNAELLSYVSK-AHTRIC-FSS 305

Query: 371 GQALVDLMVDPPHVG--DESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGA 428
                +       +G  +  +E  +EE  E  + L +  D+L        G+   KP G 
Sbjct: 306 PSPFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDEL--------GLPYTKPDGT 357

Query: 429 MYL---FPRLILPDRAIEEAKKLQMEADEF-YCHKLLENTGICTVPGSGFGQRE 478
            ++   F ++ +PD      ++L   A +F   + L+   G+  +P + F  +E
Sbjct: 358 YFVCVDFSKVQIPDE-YPFPRELNERAKDFKLSYWLVNELGVVAIPPTEFYIKE 410

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 98/216 (45%), Gaps = 26/216 (12%)

Query: 161 RDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLP 220
           +D  +  +A+++ L  G+ +++  ++ A C      IL+  P Y +Y+    I++ +++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 221 YYL-DEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAA 279
             L   ++ +    +E    VI   +N      + + +PGNPTGA +    I++I+    
Sbjct: 138 CPLITSDNSFQANTDE----VIKTAQNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWD 193

Query: 280 KYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQ 339
           + G+V++ DE Y D  F G   +       L  KYP       L  L + SK      G 
Sbjct: 194 R-GMVVV-DEAYID--FCGGSTA------PLVTKYP------NLCVLQTLSKSF----GL 233

Query: 340 RGGYMEIVGFSDEVRHLLLKL-ASINICSVVTGQAL 374
            G  + I   S E+  +L  + A  NI S+ +  AL
Sbjct: 234 AGIRLGITFASKEMARVLNSMKAPYNISSLASEYAL 269

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 22/176 (12%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLD-EE 226
           SAD++ L  G+ +++  ++ A C      IL+  P Y +Y+    I++ +++   L   +
Sbjct: 86  SADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSD 145

Query: 227 SGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLI 286
           + +    E    +V+  + N      M   +PGNPTGA +   +I+ ++      GIV++
Sbjct: 146 NSFQMNTE----AVLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVVV 200

Query: 287 ADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGG 342
            DE Y D  F G   +       L  KYP       L +L + SK   G  G R G
Sbjct: 201 -DEAYVD--FCGGSTA------PLVTKYP------NLVTLQTLSKSF-GLAGIRLG 240

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 81/176 (46%), Gaps = 18/176 (10%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEES 227
           +A +I L  G+ +++  ++ A C      +++  P Y +Y     I++   +   L   S
Sbjct: 86  TAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPL-ISS 144

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIA 287
             S +++E  + ++  +        + + +PGNPTGA + V  +++++      GIV++ 
Sbjct: 145 DNSFQIDE--DRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVVV- 200

Query: 288 DEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGY 343
           DE Y D      F + K  L  L  K+P       L  L + SK  SG  G R G+
Sbjct: 201 DEAYID------FSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 94/199 (47%), Gaps = 24/199 (12%)

Query: 177 GASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEI 236
           G+ +++  ++ A C      IL+  P Y +Y+    I++  ++   L  E   S +++  
Sbjct: 94  GSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDN-SFQIDAT 152

Query: 237 ENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIF 296
           E  ++N + N      + + +PGNPTGA + +D I+ ++    + G+V I DE Y D  F
Sbjct: 153 E--ILNILANDPLIKLVFITSPGNPTGAKIEIDRIEYLLKNWDQ-GLV-IVDEAYID--F 206

Query: 297 NGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHL 356
           +G   +       L  KYP       L +L + SK   G  G R G M I   + ++  +
Sbjct: 207 SGGSTA------PLVTKYP------NLVTLQTLSKSF-GLAGIRLG-MTIA--TKKLSKI 250

Query: 357 LLKL-ASINICSVVTGQAL 374
           L  + A  NI +V +  AL
Sbjct: 251 LNAMKAPYNISTVTSDMAL 269

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 67/143 (46%), Gaps = 17/143 (11%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PY 221
           + +++ +T GA++ +   +M +  N    +++  P +  Y  +I +   K++      P 
Sbjct: 114 TPENVLVTTGANEGILSCLMGII-NPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPK 172

Query: 222 YLDEE----SGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITV 277
            LD      + W+   +E   ++        K  A+++  P NP G V + + + ++  +
Sbjct: 173 ELDNRVTKGTEWTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNI 226

Query: 278 AAKYGIVLIADEVYQDNIFNGEF 300
             +  +++IADEVY+   F  EF
Sbjct: 227 CVENNVIIIADEVYEHLYFVDEF 249

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 90/195 (46%), Gaps = 28/195 (14%)

Query: 151 RETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTAS 210
           R  T+ +  K +N    +++++ L  G+ +++  ++ A C      IL+  P Y +Y+  
Sbjct: 72  RNKTSTY--KAENLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVC 129

Query: 211 ICIHNAKMLPY-YLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVD 269
             I++ +++    L + + +    E    SV+  ++N      + + +PGNPTGA +   
Sbjct: 130 AEINDIEIVECPLLYKNNSFQMDTE----SVLTVLQNDPLIKLLFITSPGNPTGARIET- 184

Query: 270 VIQRIITVAAKY--GIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLH 327
             +RI TV   +  G+V++ DE Y D  F G   +       L  KYP       L +L 
Sbjct: 185 --ERIETVLQNWTDGLVVV-DEAYID--FCGGSTA------PLVTKYP------NLVTLQ 227

Query: 328 STSKGVSGECGQRGG 342
           + SK   G  G R G
Sbjct: 228 TLSKSF-GLAGIRLG 241

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 64/126 (50%), Gaps = 5/126 (3%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEES 227
           ++ +I L  G+ +++  ++ A C      IL+  P Y +Y+    I++ +++   L  E 
Sbjct: 86  TSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITED 145

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIA 287
                 +   + V++ + N  +   + + +PGNPTGA +    I++++    + G+V++ 
Sbjct: 146 N---SFQMDSDKVLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV- 200

Query: 288 DEVYQD 293
           DE Y D
Sbjct: 201 DEAYVD 206

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 26/208 (12%)

Query: 169 ADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML--PYYLDEE 226
           AD++ L  G+ +++  ++ A C      IL+  P Y +Y+    I++ +++  P  + + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 227 SGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLI 286
           S +    E    + +  ++N      + V +PGNPTGA +   +I++I+    + G+V++
Sbjct: 147 S-FQMDTE----AALTILKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV 200

Query: 287 ADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEI 346
            DE Y D  F G   +       L  KYP       L +L + SK   G  G R G    
Sbjct: 201 -DEAYID--FCGGSTA------PLVTKYP------NLVTLQTLSKSF-GLAGIRLGMT-- 242

Query: 347 VGFSDEVRHLLLKLASINICSVVTGQAL 374
              SD    L    A  NI S+ +  AL
Sbjct: 243 YATSDLANILNAMKAPYNISSLASEYAL 270

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 69/145 (47%), Gaps = 9/145 (6%)

Query: 155 ARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIH 214
           A+ + +R N  A    ++ + +G+S A+  +   LC  + T +L      P+  ++I + 
Sbjct: 107 AKKMIERINPPAYGGWNVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPV-ISNIKLQ 165

Query: 215 NAKMLPYYLD-----EESGWSTK--VEEIENSVINAIENGIKPSAMVVINPG-NPTGAVL 266
            A ++P  +      E+ G       + ++N  +   ++  KP A+  +  G NPTG  L
Sbjct: 166 GASVVPVKMQLSADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKALYTVATGQNPTGMTL 225

Query: 267 SVDVIQRIITVAAKYGIVLIADEVY 291
           S    +RI  +A K+  +++ D+ Y
Sbjct: 226 SPTKRRRIYEIAQKHDFLIVEDDPY 250

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           D+  T G + A    +   C      IL     +    A+         P  +DE     
Sbjct: 132 DVVATTGNTNAWESTLRVFCDKGDV-ILAEAHSFSSCLAAAQAQGIITFPIPIDEHGIIP 190

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+E+I +   N  E   KP  +  I  G NPTG+ LS D  ++I  VA K+  ++I DE
Sbjct: 191 EKLEQILD---NWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 290 VY 291
            Y
Sbjct: 248 PY 249

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 103/230 (44%), Gaps = 28/230 (12%)

Query: 155 ARFISKRDNCEAA---SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASI 211
           A + + +DN       S  ++ L  G+ + +  L+ A C+     I++  P Y +Y+   
Sbjct: 67  AHYRNSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCA 126

Query: 212 CIHNAKMLPYYL-DEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDV 270
            I++  ++   L  E++ +   V+      +  ++       + + +PGNPTG +++   
Sbjct: 127 NINDVDVVNCPLIVEDNSFQMDVKR----TLETLKKDDLIRLLFITSPGNPTGKIIA--- 179

Query: 271 IQRIITVAA--KYGIVLIADEVYQD--NIFNGEFHSMKKI-LRQLQKKYPGKYDNVQLAS 325
           I+ II V    K G+V++ DE Y D    FN E    +   + +L  KYP       L  
Sbjct: 180 IKDIIYVLEHWKNGLVVV-DEAYVDFSTYFNEETKKTEYFSVAKLVTKYP------NLTV 232

Query: 326 LHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKL-ASINICSVVTGQAL 374
           L + SK   G  G R G   +   S+E+  +L  + A  NI S  +  A+
Sbjct: 233 LQTLSKSF-GLAGIRLG---VTFASEELARILNAMKAPYNISSTTSNHAI 278

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 90/212 (42%), Gaps = 44/212 (20%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSM---KKILRQLQKKY-- 314
           NPTG   S +   ++I +A KY +++IAD+VY    F+  F ++   KK    L ++   
Sbjct: 202 NPTGTTYSTETKLKLIEIARKYDMLIIADDVYDMLDFSPPFDNLPQPKKRFVHLDRETNN 261

Query: 315 -PGKYDNVQLASLHSTSKGVSGECGQRGGYMEIV----------GFSDEVRHLLLKLASI 363
            P  Y N    S  + SK ++   G R GY E V          G ++       +L S+
Sbjct: 262 DPESYGNT--ISNATFSKLIA--PGLRFGYHETVTDKLAGQLSHGGANTSGGTPSQLNSM 317

Query: 364 NICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNL--EGIE 421
            + +++   +   L+                  N++ ST  +RA+ +Y        +  +
Sbjct: 318 IVGTMLKNGSTATLL------------------NQLRSTYAERAETMYAAVKGYMPKNTK 359

Query: 422 CQKPQGAMYLFPRLILPD--RAIEEAKKLQME 451
            +KP+G    F  L LP    A E  K+LQ E
Sbjct: 360 FEKPEGGY--FSWLTLPQGYDAHEIGKRLQQE 389

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 129/291 (44%), Gaps = 41/291 (14%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYL-DEE 226
           +A+++ L  G+ +++  ++ A C      I+   P Y +Y+    +++ +++   L   +
Sbjct: 83  TAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSD 142

Query: 227 SGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLI 286
           + +    E    +V++ ++       + + +PGNPTGA +    I++I+    +   +L+
Sbjct: 143 NSFQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQNWDQG--ILV 196

Query: 287 ADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEI 346
            DE Y D  F G   +       L  KYP       + +L + SK   G  G R G   +
Sbjct: 197 VDEAYID--FCGGSTA------PLVNKYP------NICTLQTLSKSF-GLAGIRVG---M 238

Query: 347 VGFSDEVRHLLLKL-ASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKK 405
              S E   +L  + A  NI S+ +  AL         V D+++   +E    ++    K
Sbjct: 239 TFTSKEFAKVLNSMKAPYNISSITSEYAL-------KAVEDDAFTAMEENAKAVN----K 287

Query: 406 RADKLYDTFSNLEGIECQKPQG--AMYLFPRLILPDRAIEEA--KKLQMEA 452
              +L  + ++L+ ++ Q   G  + +L  R+   D  + +A  +KL  E+
Sbjct: 288 EKQRLLKSLTSLDFVDDQYVGGIDSNFLLLRINKGDNKLAKALYRKLATES 338

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 17/135 (12%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNA--KMLPYY--- 222
           + ++I +T GA +A+   +MAL +     I+I  P +  Y   I I     K +P     
Sbjct: 97  TNENILVTTGAIQALLESLMALIKPGDEVIVIE-PFFDPYIHLIKIAGGVVKYVPLTNPN 155

Query: 223 -----LDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITV 277
                + E + W    E +  +  +      K   M++ NP NP G V + D +  + T+
Sbjct: 156 QGKKRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATL 209

Query: 278 AAKYGIVLIADEVYQ 292
               G  +IADEVY+
Sbjct: 210 CVNNGAYIIADEVYE 224

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 74/164 (45%), Gaps = 10/164 (6%)

Query: 136 ASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHT 195
           A    YS  +G+  + E + + I KR N  A    D+ L +G+S ++  +   LC +E  
Sbjct: 127 ARAFQYSETRGLPSVVEFSKK-IVKRFNPPAYDNWDVLLANGSSDSLFKIFETLC-DEGV 184

Query: 196 GILIPIPQYPLYTASICIHNAKMLPYYLD-----EESGWSTK--VEEIENSVINAIENGI 248
            +L+    +     ++     K++P  ++     E  G   +   + +EN  +   ++  
Sbjct: 185 TVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKHLS 244

Query: 249 KPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           KP  +  I  G NPTG  LS +  + I  +A  +  +++ D+ Y
Sbjct: 245 KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 71/145 (48%), Gaps = 9/145 (6%)

Query: 155 ARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIH 214
           +R I K+ N  A    D+ L +G+S ++  L   +C +E+T +++    +     +I   
Sbjct: 108 SRNIIKKANNPAYDNWDVILGNGSSDSMFKLFETIC-DENTTVMMEEFTFSPVIYNIKAT 166

Query: 215 NAKMLPYYLD-----EESGWSTKVEE--IENSVINAIENGIKPSAMVVINPG-NPTGAVL 266
            A  +P  ++     E+ G      +  +EN   +  ++  KP+ +  I  G NPTG  L
Sbjct: 167 GAAHIPIKMELSENPEKQGIDVDYMQTLLENWDSSEHKHLPKPTVLYTIATGQNPTGMTL 226

Query: 267 SVDVIQRIITVAAKYGIVLIADEVY 291
           S++  ++I  +  K+ I+++ D+ Y
Sbjct: 227 SMEKRRKIYKICQKHDIIIVEDDPY 251

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 64/133 (48%), Gaps = 17/133 (12%)

Query: 170 DDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML------PYYL 223
           +++ +T GA++ +   +M +  N    +++  P +  Y  +I +   K++      P  +
Sbjct: 123 ENVTITTGANEGILSSLMGIL-NPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDM 181

Query: 224 D----EESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAA 279
           D    E   W+   EE+  +  +      K  A+++  P NP G V + + + +I  +  
Sbjct: 182 DQRIVEGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLCV 235

Query: 280 KYGIVLIADEVYQ 292
           +  +V+I+DEVY+
Sbjct: 236 ENNVVIISDEVYE 248

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           DI LT G +      +   C N+   IL     +    AS         P  +DE     
Sbjct: 132 DIILTTGNTNGWESTLRVFC-NKGDVILAEAHSFSSSLASAEAQGITTFPIPIDEHGIIP 190

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+EEI   + N      KP  +  I  G NPTG  L+ +    I  +A K+  ++I DE
Sbjct: 191 EKLEEI---LDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 290 VY 291
            Y
Sbjct: 248 PY 249

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 10/159 (6%)

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS  QG+  I +     ++  +N    + D + L +G+S ++  L   L  +E T +L+ 
Sbjct: 112 YSQTQGLAPILDFLKLIVANCNNPPYQNWD-LLLANGSSDSMFKLFDTLT-DETTTVLVE 169

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTK-------VEEIENSVINAIENGIKPSAM 253
              +    ++I    A  +P  L+  S  S +          +EN      ++  +PS +
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 254 VVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
             I+ G NPTG  +S++   RI  +A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 31/127 (24%)

Query: 249 KPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILR 308
           K  A+++ +P NPTG V + + +  +  +  +  + +I+DEVY++  F  E         
Sbjct: 182 KTKAVIINSPHNPTGKVFTREELLTLGNICVEKNVYIISDEVYENLYFTPEC-------- 233

Query: 309 QLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGF------SDEVRHLLLKLAS 362
                       V+LASL      ++   G  G    + G+      S+ V   LLKLAS
Sbjct: 234 ------------VKLASLSPEISNITLTIGSAGKIFAVTGWRIGWIISENVE--LLKLAS 279

Query: 363 ---INIC 366
              I IC
Sbjct: 280 SAHIKIC 286

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 81/177 (45%), Gaps = 19/177 (10%)

Query: 160 KRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML 219
           K  N    +A++I L  G+ +++  L+   C      I+I  P Y +Y+    I++   +
Sbjct: 78  KDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCV 137

Query: 220 PYYL-DEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVA 278
              L  E++ +     ++  ++  A +  IK   + + +PGNPT A++    I++++   
Sbjct: 138 KVPLVAEDNSFQMDTSKVLETL--AQDPTIK--LIFITSPGNPTAALIDTAEIEKVLNNW 193

Query: 279 AKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSG 335
              G +++ DE Y D  F G   +       L  KYP    N+ +    S S G++G
Sbjct: 194 T--GGLVVVDEAYID--FCGGSTT------PLVNKYP----NLAVIQTMSKSFGLAG 236

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 151 RETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTAS 210
           R TT+ F  K  +    + +++ L  G+ +++  ++ A C      IL+  P Y +Y+  
Sbjct: 71  RNTTSAF--KDRDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVC 128

Query: 211 ICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDV 270
             I++ +++   L  E       +   + V++ ++N      + + +PGNPTG  +    
Sbjct: 129 ANINDIEVVECPLIYEDN---SFQLNSDKVLDILKNDPLIKLVFITSPGNPTGVKIETKR 185

Query: 271 IQRIITVAAKYGIVLIADEVYQD 293
           I++++      G+V++ DE Y D
Sbjct: 186 IEKVLQ-NWDNGLVVV-DEAYID 206

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 5/126 (3%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEES 227
           + D++ L  G+ +++  ++ A C      IL   P Y +Y+    I++ ++L   L  E 
Sbjct: 85  TEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYED 144

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIA 287
                 +     VI+ + +      + + +PGNPTGA +  ++I +I+   +  G  ++ 
Sbjct: 145 N---SFQPDSQKVISILSSDPLIKLVFLTSPGNPTGAKIDSNIIIKIL--ESWDGGFVVV 199

Query: 288 DEVYQD 293
           DE Y D
Sbjct: 200 DEAYID 205

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 62/152 (40%), Gaps = 6/152 (3%)

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           Y  +QG   + E   +  S   + + A  D +  T G + A    +   C    T IL  
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVHDIKYADWD-VLATAGNTNAWESTLRVFCNRGDT-ILAE 163

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG- 259
              +     +       + P  LDE   +    E++E+ + N      KP  +  I  G 
Sbjct: 164 AYSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQ 220

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NPTG+ LS D   +I  +A K+  ++I DE Y
Sbjct: 221 NPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 168 SADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEES 227
           + DDI LT+GA  A  +L           ++   P Y    +   +  A++    L +E 
Sbjct: 77  TMDDILLTNGAIGA-NFLAFYTLVGAGDHVICVEPTYSQLYSVPEMFGAEVDLLTLKKED 135

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIA 287
            +   ++ +++     I+N  K   +++ NP NP G+V+  D++++I  +  +  I L +
Sbjct: 136 DFLPNLQTLKS----MIKNNTK--LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHS 189

Query: 288 DEVYQ 292
           DEVY+
Sbjct: 190 DEVYR 194

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 72/171 (42%), Gaps = 21/171 (12%)

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200
           YS  +G+  +   T  F+ +  N    +  D  L +G+S ++ Y +  +  + +T +L+ 
Sbjct: 115 YSATEGLDPLLNFTKSFLQRIGNTPLYNGWDTILANGSSDSL-YKVFDILADRNTTVLVE 173

Query: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEE-------------------IENSVI 241
              +     +I    A ++P  L+ +   S                        +EN  +
Sbjct: 174 EFTFVPVVGTILGTGAHIVPMKLNLDEVTSDNFNNDKQFDPNHEGIDVEYLADLLENWAV 233

Query: 242 NAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
              ++  KP+ M  +  G NPTG  LS +  ++I  +A ++  +++ D+ Y
Sbjct: 234 GPHKHLPKPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYD 319
           NP+G   SV    +++ +A KY I+LI+D+VY   +++    ++ K L +L       Y+
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYDQPCDALPKCLPRLTHLDRASYE 258

Query: 320 NVQLASLHSTSKGVSGEC---GQRGGYMEIVGFS 350
             +    ++ S     +    G R GY E V  +
Sbjct: 259 YGENGYGNTISNATFSKVIAPGLRCGYQESVNMN 292

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 23/133 (17%)

Query: 168 SADDIFLTDGASKAVTYLMMALC-QNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEE 226
           SAD++ +T+GA  A   L   L  + +H                IC+H      Y + + 
Sbjct: 78  SADNVLVTNGAIGANFLLYYTLVGKGDHV---------------ICVHPTYSQLYSVPKM 122

Query: 227 SGWSTKVEEIENS-----VINAIENGIKPSAMVVI--NPGNPTGAVLSVDVIQRIITVAA 279
            G    + E+         ++ ++  IK +  ++I  NP NP G V+S +++  I  +  
Sbjct: 123 FGAEVTLLELSEKDSFLPNLDTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCK 182

Query: 280 KYGIVLIADEVYQ 292
           +  + L  DEVY+
Sbjct: 183 EKNVYLHCDEVYR 195

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 170 DDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGW 229
           D++ +T+GA  A  +L+          ++   P Y    +   +  A++    L +E G+
Sbjct: 79  DNVLVTNGAI-AANFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSLLKLQKEDGF 137

Query: 230 STKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
              +E ++  + +  +       +++ NP NP G+ +S + +  I  +  +  I L  DE
Sbjct: 138 IPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDE 191

Query: 290 VYQDNIFNGEFHSM 303
           VY+       FHSM
Sbjct: 192 VYKP-----IFHSM 200

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 252 AMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQ 292
            +V+ NP NP G+V+    ++ I  +A K  I +I DEVY+
Sbjct: 157 CIVLNNPNNPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 234 EEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           E++E+ + N   N  KP  +  I  G NPTG  L  D  + I  +A K+  +++ DE Y
Sbjct: 190 EKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML---PYYLDEES 227
           DI  T G+++     +   C    T +L    +   Y++S+   +A+ L   P  LD E 
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLI 286
              +K+EE+  +  +       P  +  I  G NPTG  LS +    I  +A +Y I++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 287 ADEVY 291
            D+ Y
Sbjct: 248 EDDPY 252

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML---PYYLDEES 227
           DI  T G+++A    +   C    T +L    +   Y++S+   +A+ L   P  +D + 
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLI 286
               K+EE+ ++  +       P  +  I  G NPTG  LS      I  +A KY I+++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 287 ADEVY 291
            D+ Y
Sbjct: 249 EDDPY 253

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           D  LT G +      +   C N+   IL     +    AS         P  +D +    
Sbjct: 132 DSILTTGNTNGWESTLRIFC-NKGDVILAEAHSFSSSLASAEAQGVITFPVPIDSDGIIP 190

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+E I   + N      KP  +  I  G NPTG+ LS +  + I  +A K+  ++I DE
Sbjct: 191 EKLESI---LDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDE 247

Query: 290 VY 291
            Y
Sbjct: 248 PY 249

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 55/144 (38%), Gaps = 12/144 (8%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           D+  T G + A    +   C N    IL     +    A+         P  +D++    
Sbjct: 133 DVVATAGNTNAWESTLRVFC-NRGDVILAEAHSFSSCLAAAQAQGITTFPVPIDDKGIIP 191

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+E I +   N      KP  +  I  G NPTG  L+ +    I  +A K+  ++I D 
Sbjct: 192 AKLEAILD---NWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 290 VYQDNIFNGEFHSMKKILRQLQKK 313
            Y        F  M K  R LQK+
Sbjct: 249 PYY-------FLQMDKYERDLQKR 265

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKML---PYYLDEES 227
           DI  T G+++     +   C    T +L    +   Y++S+   +A+ L   P  LD E 
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EEYTYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 228 GWSTKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLI 286
               K+EE+  +  +   +   P  +  I  G NPTG  LS      I  +A KY +++I
Sbjct: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247

Query: 287 ADEVY 291
            DE Y
Sbjct: 248 EDEPY 252

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 234 EEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           E++E  + N  E   KP  +  I  G NPTG+ L+ +  + I  +A K+  ++I DE Y
Sbjct: 191 EKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 238 NSVINAIENGIKPSAMV-------VINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEV 290
           N  ++ I+N  KP+  V       V    NP+G   S++   ++I +A +Y +++I D+V
Sbjct: 165 NGDVSIIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDV 224

Query: 291 YQDNIFNGEFHSMKKILRQL 310
           Y    ++ + H   +  ++L
Sbjct: 225 YDLLDYSTDVHEWPRPQKRL 244

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
            NP+G   S++  +R+I +A KY +++I D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 24/32 (75%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NP+G   +++  +R+I +A KY ++++AD+VY
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 24/33 (72%)

Query: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
            NP+G   S++  +R+I +A KY +++I+D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 123/329 (37%), Gaps = 43/329 (13%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           D+F T G + A    +   C N    IL     +    AS         P  +D +    
Sbjct: 134 DVFATAGNTNAWESTLRLFC-NRGDVILAEAHSFSSSLASAEAQGVITFPVPIDADGIIP 192

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+ +I +   N   N  KP  +  I  G NPTG  ++    + I  +A K+  +++ DE
Sbjct: 193 EKLAKIMD---NWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 290 VYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGEC------------ 337
            Y     N     +K+  R+  +  P +  +  L SL +T   +  E             
Sbjct: 250 PYYFLQMNPYIKDLKE--REKAQNCPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFSKVL 307

Query: 338 --GQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDP--PHVGDESY-EKD 392
             G R G+  I G S  ++H L    S++  +V +      ++V       G + Y +  
Sbjct: 308 APGTRLGW--ITGSSRILKHYL----SLHEMTVQSPAGFTQVLVSSTLSRWGQKGYLDWL 361

Query: 393 QEERNEIHSTLKKRA--DKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEAKKLQM 450
              R+E   TLK+    D LY      +      P   M+    +   D +       + 
Sbjct: 362 LGLRHEY--TLKRDCAIDALYKYLPQCDAFVINPPIAGMFFTVNI---DASTHPEFSTKY 416

Query: 451 EADEFYC-----HKLLENTGICTVPGSGF 474
            +D +       HK++E  G+  VPGS F
Sbjct: 417 NSDPYQLEQSIYHKVVER-GVLVVPGSWF 444

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NP+G   S++  +R+I +A KY +++I D+VY
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 24/32 (75%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NP+G+  S++   R++ +A +Y ++LI+D++Y
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 73/161 (45%), Gaps = 12/161 (7%)

Query: 141 YSLAQGVYGIRETTARFISKRDNCEAASAD--DIFLTDGASKAVTYLMMALCQNEHTGIL 198
           Y+   G+  IR   A+++  + N  A SAD  D+ L+ G+  ++       C  + T ++
Sbjct: 125 YNEVPGLPQIR-NFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLM 183

Query: 199 IPIPQYPLYTASICIHNAKMLPYYLDEESGWSTK-------VEEIENSVINAIENGIKPS 251
                 P+  + +    A+ +P  ++     ST+        + ++N      ++  KP 
Sbjct: 184 EEFTFTPV-ISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPR 242

Query: 252 AMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
            +  I  G NPTG  + ++  ++I  +A K+  +++ D+ Y
Sbjct: 243 ILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {ON}
           similar to uniprot|P41734 Saccharomyces cerevisiae
           YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase
           required in balance with alcohol acetyltransferase to
           maintain optimal amounts of isoamyl acetate which is
           particularly important in sake brewing
          Length = 243

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 21/134 (15%)

Query: 302 SMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGY--MEIVGFSDEVRHLLLK 359
           ++K + R L+ + PG    + +++L+    G +  C   GG+  +E+  F D V  LL  
Sbjct: 61  ALKLLPRILENESPG----IVMSTLYF---GSNDAC--HGGHQKVELPEFKDNVERLLDI 111

Query: 360 LASINICSVVTGQALVDLMVDPPHVGDE---SYEKDQEERNEIHSTLKKRADK------- 409
             S  I  ++ G AL D     P   DE    Y +  E        L++ ADK       
Sbjct: 112 FKSKGIKPILVGPALFDKDNWNPRKADEVAQGYVRSNENNKLYSDALQEIADKEQIPFVN 171

Query: 410 LYDTFSNLEGIECQ 423
           LYD FS   G E +
Sbjct: 172 LYDAFSREGGNEWR 185

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NPTGA+ S     +++ +A KY I++I+D+VY
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 234 EEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           E +E  + N   +  KP  +  I  G NPTG+ LS D    I  +A K+ +++I DE Y
Sbjct: 194 ERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NPTGA+ S     +++ +A KY I++I+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 234 EEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           E +E  + N      KP  +  I  G NPTG+ LS D  + I  +A K+  ++I DE Y
Sbjct: 194 ERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
            NP+G   S++  ++++ +A KY +++IAD+VY
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 6/124 (4%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICI--HNAKMLPYYLDEESG 228
           D+  T G + A    +   C     G  I   +Y   ++ +       +  P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFCNR---GDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENGM 188

Query: 229 WSTKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIA 287
              ++ E+ ++     +   +P  +  +  G NPTG  LS D  Q +  +A ++ ++++ 
Sbjct: 189 VPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVE 248

Query: 288 DEVY 291
           DE Y
Sbjct: 249 DEPY 252

>NDAI0I02500 Chr9 (576038..577198) [1161 bp, 386 aa] {ON} 
          Length = 386

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 13/95 (13%)

Query: 222 YLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKY 281
           ++ E+S W  K    +N+   +++N +           NP       D   R+ T A+K 
Sbjct: 156 FIQEKSKWLEK----QNTAFKSLKNYLS---------DNPVLVTFKSDGRYRLTTDASKT 202

Query: 282 GIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPG 316
           G+  +  EV +DN   G      K L   Q++YP 
Sbjct: 203 GVGAVLKEVDKDNKLLGVVGYFSKSLHGAQQRYPA 237

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 125/328 (38%), Gaps = 41/328 (12%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           D+  T G + A    +   C N    IL+    +    AS         P  +D +    
Sbjct: 134 DVLATAGNTNAWESTLRVFC-NRGDVILVEAHSFSSSLASAEAQGVITFPVPIDADGIIP 192

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+ ++   + N      KP  +  I  G NPTG  ++    + I  +A KY  +++ DE
Sbjct: 193 EKLAKV---MENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 290 VYQDNIFNGEFHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGEC------------ 337
            Y     N     +K+  R+  +  P +  +  L SL +T   +  E             
Sbjct: 250 PYYFLQMNPYIKDLKE--REKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFSKVL 307

Query: 338 --GQRGGYMEIVGFSDEVR-HLLLKLASINICSVVTGQALVDLMVDPPHVGDESY-EKDQ 393
             G R G+  I G S  ++ +L L   +I   +  T Q LV+  +     G + Y +   
Sbjct: 308 APGTRLGW--ITGSSKILKPYLSLHEMTIQAPAGFT-QVLVNATLS--RWGQKGYLDWLL 362

Query: 394 EERNEIHSTLKKRA--DKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEAKKLQME 451
             R+E   TLK+    D LY      +      P   M+    +   D ++    K +  
Sbjct: 363 GLRHEY--TLKRDCAIDALYKYLPQSDAFVINPPIAGMFFTVNI---DASVHPEFKTKYN 417

Query: 452 ADEFYC-----HKLLENTGICTVPGSGF 474
           +D +       HK++E  G+  VPGS F
Sbjct: 418 SDPYQLEQSLYHKVVER-GVLVVPGSWF 444

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
            NP+G   S++  +R+I +A +Y +++I D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 27/40 (67%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGE 299
           NP+GA  S +   +++ +A +Y I++I+D+VY    F+G+
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQ 239

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 5/122 (4%)

Query: 171 DIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWS 230
           DI  T G + A    +   C N    IL     +    A+         P  +D+     
Sbjct: 133 DIIATAGNTNAWESTLRVFC-NRGDVILAEAHSFSSCLAAAQAQGITTFPIPIDDNGIIP 191

Query: 231 TKVEEIENSVINAIENGIKPSAMVVINPG-NPTGAVLSVDVIQRIITVAAKYGIVLIADE 289
            K+E+I +   N      KP  +  I  G NPTG  L    ++ I  +A K+  +++ D 
Sbjct: 192 EKLEKILD---NWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 290 VY 291
            Y
Sbjct: 249 PY 250

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 65/155 (41%), Gaps = 8/155 (5%)

Query: 197 ILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVI 256
           + IP P +P +     ++  K L YY     G  T    +E++      +  K    +++
Sbjct: 156 VWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLESTETEVRSSNSKLPQSIIL 215

Query: 257 NPG--NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQL--QK 312
           +    NPTG   ++D    II    +  ++ I D  YQ  + +G  +    +LR    + 
Sbjct: 216 HACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQ-GLESGSLYDDAYLLRHCLDES 274

Query: 313 KYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIV 347
           +Y G    + L    + + G+ GE   R G + IV
Sbjct: 275 RYKGWKHGLFLCQSFAKNMGLYGE---RVGSLSIV 306

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVY 291
           NP+G   S+    R++ +A KY I++I D+VY
Sbjct: 200 NPSGHTYSLTTKLRLLELARKYDILIITDDVY 231

>NDAI0J01100 Chr10 (255308..256402) [1095 bp, 364 aa] {ON} Anc_8.289
           YLR100W
          Length = 364

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEFHSMKKILRQLQKKYPGKYD 319
           NP  AV       + I + +K G+ LI    +Q N+F G ++ MK++LRQL K+  GK  
Sbjct: 130 NPVKAVTDPSYKLQEIGLKSKDGMGLI----FQVNVF-GPYYLMKQLLRQLSKR-NGKV- 182

Query: 320 NVQLASLHSTSKGVS 334
            + ++S+ S SK +S
Sbjct: 183 -IWISSIRSDSKYLS 196

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 259 GNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQ 292
            NP+G   S+   +++I +A  Y I++I D+VY+
Sbjct: 225 ANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,232,793
Number of extensions: 2265853
Number of successful extensions: 6582
Number of sequences better than 10.0: 126
Number of HSP's gapped: 6627
Number of HSP's successfully gapped: 126
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)