Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B055108.265ON27527512850.0
TDEL0F039208.265ON3222931394e-09
Suva_2.2738.265ON3763071361e-08
Smik_4.3588.265ON3712761342e-08
ZYRO0C01584g8.265ON2822981242e-07
YDR113C (PDS1)8.265ON3732711236e-07
AGR083W8.265ON2952161182e-06
Skud_4.3748.265ON3732281093e-05
NCAS0B038308.265ON325681084e-05
KNAG0H032308.265ON2811231022e-04
SAKL0H16962g8.265ON336248995e-04
NDAI0J013508.265ON42270996e-04
Kpol_543.418.265ON306314880.011
Kwal_56.237818.265ON293123850.026
Ecym_43058.265ON31131790.14
KLTH0G13618g8.265ON302321711.7
Kpol_1004.345.545ON53183702.2
CAGL0L12298g8.265ON286284692.9
CAGL0I03564g7.332ON46671666.7
KLLA0F19206g8.265ON263108657.7
NOTE: 2 genes in the same pillar as KAFR0B05510 were not hit in these BLAST results
LIST: TBLA0E04460 TPHA0A01780

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05510
         (275 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....   499   0.0  
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    58   4e-09
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    57   1e-08
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    56   2e-08
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    52   2e-07
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    52   6e-07
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    50   2e-06
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    47   3e-05
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    46   4e-05
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    44   2e-04
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    43   5e-04
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    43   6e-04
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    39   0.011
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    37   0.026
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    35   0.14 
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    32   1.7  
Kpol_1004.34 s1004 (71138..72733) [1596 bp, 531 aa] {ON} (71138....    32   2.2  
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    31   2.9  
CAGL0I03564g Chr9 (302137..303537) [1401 bp, 466 aa] {ON} simila...    30   6.7  
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    30   7.7  

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score =  499 bits (1285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/275 (92%), Positives = 254/275 (92%)

Query: 1   MSNQSDKENNLSTIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNS 60
           MSNQSDKENNLSTIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNS
Sbjct: 1   MSNQSDKENNLSTIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNS 60

Query: 61  ILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKDNXXXXXXXXDGLLNRKLKEAL 120
           ILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKDN        DGLLNRKLKEAL
Sbjct: 61  ILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKDNESSESEEEDGLLNRKLKEAL 120

Query: 121 SRSQNDEDREGDGSVGLFAKEAFQNHXXXXXXXXXXXXXGKEKDVELSYIPDHYEVIAAD 180
           SRSQNDEDREGDGSVGLFAKEAFQNH             GKEKDVELSYIPDHYEVIAAD
Sbjct: 121 SRSQNDEDREGDGSVGLFAKEAFQNHISNDDDSEIDIINGKEKDVELSYIPDHYEVIAAD 180

Query: 181 EIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENIDPSYNGVNRIGKNS 240
           EIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENIDPSYNGVNRIGKNS
Sbjct: 181 EIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENIDPSYNGVNRIGKNS 240

Query: 241 TKSKSIDFDITEEIGTKYAGSGLDDDDIEAMLRDL 275
           TKSKSIDFDITEEIGTKYAGSGLDDDDIEAMLRDL
Sbjct: 241 TKSKSIDFDITEEIGTKYAGSGLDDDDIEAMLRDL 275

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 114/293 (38%), Gaps = 60/293 (20%)

Query: 23  NTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNSI----------------LISHK 66
           N  +   +    R SP +R+QQ G+ PL SK+ N+S                   L   K
Sbjct: 49  NLTYRDCDAPVKRASPSRRVQQ-GRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSK 107

Query: 67  GNNT------------RIKKYGSILGLENPGNFKLPKTKSLILKD--------NXXXXXX 106
             N             R+KKYGS+LG        LPK KSL+LKD               
Sbjct: 108 KRNANVVDGQLLTNPRRLKKYGSVLGYN-----ALPKMKSLVLKDVDQVGEQGEDENDDE 162

Query: 107 XXDGLLNRKLKEALSRSQNDEDREGDGSVGLFAKEAF-----QNHXXXXXXXXXXXXXGK 161
             D +L  KL  A+ RS    D EG+   GLF K         +              G 
Sbjct: 163 DEDHILRLKLHNAIDRS----DEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGP 218

Query: 162 EKDVELSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSD 221
           ++   L YIP+ +  +A ++ +KLK     + +        +D+D    FL+LE +  + 
Sbjct: 219 QRHEPLPYIPEGHLSLAQEDYDKLK--TFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAG 276

Query: 222 TEENIDPSYNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAMLRD 274
            +ENI+      N   K        D   T EI   Y G GLD  D+  +L+D
Sbjct: 277 DDENIERE----NLTVKQREMLPQYD---TFEIQPSYCGEGLDASDLNDLLKD 322

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 129/307 (42%), Gaps = 62/307 (20%)

Query: 7   KENNLSTIPVLALQTPNTN------FVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNS 60
           K+NN S   V AL+T N N        ++NT STR     +  Q  KL   S+N N+ N 
Sbjct: 90  KDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTR-----KNDQLRKLSQVSRNRNRGN- 143

Query: 61  ILISHKG--NNTR-IKKYGSILGLENPGNFKLPKTKSLILKD-----------NXXXXXX 106
               + G  NN+R ++KYGS+LG        LPK KSL+LKD           +      
Sbjct: 144 ----YNGMLNNSRKLQKYGSVLGYN-----ALPKMKSLVLKDLADPAKNQESSDDDDGSE 194

Query: 107 XXDGLLNRKLKEALSRSQNDED-REGDGSVGLFAKEAFQNH---XXXXXXXXXXXXXGKE 162
             D  L++KL+ A  +  + ED  E  G +GLF  +                     G +
Sbjct: 195 GTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAKGKEGPGKEDGDD 254

Query: 163 KDVE--------LSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLEL 214
            D+E        L Y+PD Y     ++I KLK  N         +S   ++   +  L L
Sbjct: 255 HDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSL 314

Query: 215 EHVSDSDTEENIDPSYNGVNRIGKNSTKSK-SIDFDITEE--------IGTKYAGSGLDD 265
             V++ D ++N        + IG     ++ S+    +E+        I + Y G GLD 
Sbjct: 315 VEVNEEDEKDNT------THTIGDQQEPAELSLALQNSEDDDNAAMPLIESLYNGEGLDS 368

Query: 266 DDIEAML 272
           +++E +L
Sbjct: 369 EELEDLL 375

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 107/276 (38%), Gaps = 80/276 (28%)

Query: 23  NTNFVKKNTTSTRISPLKRL----QQQGKLPLQSKNGNKSNSIL---------------- 62
           N N +K       +SP KRL    QQQG+LPL +K+ N++ S +                
Sbjct: 56  NCNALKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIP 115

Query: 63  --------------------------ISHKG--NNTR-IKKYGSILGLENPGNFKLPKTK 93
                                     ++H    NNTR ++KYGS+LG        LPK K
Sbjct: 116 QQQNTLSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYN-----ALPKMK 170

Query: 94  SLILKD-----NXXXXXXXXDGL------LNRKLKEAL-SRSQNDEDREGDGSVGLF--- 138
           SL+LKD              DG       L++KL+ AL  +  +D++ E  G +GLF   
Sbjct: 171 SLVLKDLVDPGKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQ 230

Query: 139 --AKEAFQNHXXXXXXXXXXXXXGKEKDV------ELSYIPDHYEVIAADEIEKLKQVNL 190
              ++  +N              G E ++       L Y+PD Y     ++I+KLK  N 
Sbjct: 231 GGLQQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNS 290

Query: 191 GTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENI 226
                     G  D    +  L LE +++   ++ I
Sbjct: 291 PYELDLEDDGGSTD---KVDLLPLEAINEESEQDEI 323

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 128/298 (42%), Gaps = 51/298 (17%)

Query: 4   QSDKENN------------LSTIPVLALQTPNTNFVK--KNTTSTRISPLKRLQQQGKLP 49
           Q +KENN            L   P+  L+    N +K  +NT   +   +  ++ Q +LP
Sbjct: 6   QDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRLP 65

Query: 50  LQSKNGNKSNSILISHK----------GNNTRIKKYGSILGLENPGNFKLPKTKSLILKD 99
           L SK+ NKS++     K           N  +++KYGS+LG  +     LP+TKSL+LKD
Sbjct: 66  LASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLGYTD-----LPRTKSLVLKD 120

Query: 100 --NXXXXXXXXDGLLNRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHXXXXXXXXXXX 157
             +        +  L +KL++A++R ++    EG G +    ++   +            
Sbjct: 121 GDDEDDDEEEENSELQKKLQDAMNRRED--SNEGLGGLAKLVRDTKDD-----------I 167

Query: 158 XXGKEKDVELSYIPDHYEVIAADEIEKLKQVNLGTRFKS---SASSGLNDNDSTIQFLEL 214
                +   L Y PD +     ++I KLK+V+L  R        +    ++D  +  + +
Sbjct: 168 EYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSI 227

Query: 215 EHVSDSDTEENIDPSYNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAML 272
           E  ++   E   D      +RI     K +  D D  E I   Y G GL+ +++E +L
Sbjct: 228 ESNNEDSNENEADEILPKNHRIHP-FPKLRVFDEDQVENI---YNGEGLNAEELEDLL 281

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 100/271 (36%), Gaps = 87/271 (32%)

Query: 23  NTNFVKKNTTSTRISPLKRL----QQQGKLPLQSKNGNKSNSILISHKGNNTR------- 71
           N N +K       +SP KRL    QQQG+LPL +K+ N+S S +     N ++       
Sbjct: 57  NGNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQL 116

Query: 72  ------------------------------------IKKYGSILGLENPGNFKLPKTKSL 95
                                               ++KYGS+LG        LPK KSL
Sbjct: 117 QNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYN-----ALPKMKSL 171

Query: 96  ILKD-----------NXXXXXXXXDGLLNRKLKEAL-SRSQNDEDREGDGSVGLFAKEA- 142
           +LKD           +        +  L +KL+ AL  +  +D + E +G +GLF ++  
Sbjct: 172 VLKDLADSGKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGG 231

Query: 143 FQNHXXXXXXXXXXXXXGK-----EKDVE--------LSYIPDHYEVIAADEIEKLKQVN 189
            Q                K     + D+E        L Y+P+ Y     D+IEKLK   
Sbjct: 232 LQQLIKNSTKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLK--- 288

Query: 190 LGTRFKSSASSGLNDNDST---IQFLELEHV 217
               F S     L D D T   +  L LE +
Sbjct: 289 ---TFNSPYKLDLEDEDDTPDKVDLLPLEQI 316

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 89/216 (41%), Gaps = 31/216 (14%)

Query: 1   MSNQSDKENNLST---------IPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQ 51
           M    DKEN +++          P+  L+  ++N   +N+T   ++   R Q QG   L+
Sbjct: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLK 60

Query: 52  S----------KNGNKSNSILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKDNX 101
           +              +  S  I+    ++++KKYGS+LG+   G   L K KSL+LKD  
Sbjct: 61  TSGAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGV---GYGSLAKAKSLVLKDTS 117

Query: 102 XXXXXXXDGL------LNRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHXXXXXXXX- 154
                  +        L  KLK  L  S  +   E DGS GL   EA             
Sbjct: 118 DCESANEESEEEEGNPLAAKLKSRLC-SAEEGGNEDDGSSGLLLGEALSQLAAAGETQED 176

Query: 155 -XXXXXGKEKDVELSYIPDHYEVIAADEIEKLKQVN 189
                   EK  EL ++P+ YE + + ++ KL + +
Sbjct: 177 VPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYH 212

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 86/228 (37%), Gaps = 79/228 (34%)

Query: 36  ISPLKRL----QQQGKLPLQSKNGNKSNSILISHKG------------------------ 67
           +SP KRL    QQQG+LPL +K+ N+S S +   +                         
Sbjct: 69  VSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRKNDQ 128

Query: 68  --------------------NNTR-IKKYGSILGLENPGNFKLPKTKSLILKD-----NX 101
                               NN+R ++KYGS+LG        LPK KSL+LKD       
Sbjct: 129 LRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYN-----ALPKMKSLVLKDLAGPAKN 183

Query: 102 XXXXXXXDGL------LNRKLKEA-LSRSQNDEDREGDGSVGLF-----AKEAFQNHXXX 149
                  DG       L  KL+ A L +  +D++ E +G +GLF      ++  +N    
Sbjct: 184 QESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKG 243

Query: 150 XXXXXXXXXX--------GKEKDVELSYIPDHYEVIAADEIEKLKQVN 189
                               ++   L Y+PD Y     ++IEKL+  N
Sbjct: 244 KQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFN 291

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 12/68 (17%)

Query: 36  ISPLKR--LQQQGKLPLQSKNGNKSNSILISHKG---NNTRIKKYGSILGLENPGNFKLP 90
           ISP +R  LQ Q +LPL  K+ N  NS   S K    N  ++KKYGS+LG++      LP
Sbjct: 59  ISPRRRQLLQLQNRLPLAKKDNN--NSSFSSRKNGLNNIKKLKKYGSVLGMD-----ALP 111

Query: 91  KTKSLILK 98
           +TKSLILK
Sbjct: 112 RTKSLILK 119

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 36/123 (29%)

Query: 1   MSNQSDKENNLSTIPVLALQTPNTNFVK-------------KNTTSTRISPLKRLQQQGK 47
           M +  DKEN ++ +P    QTP +N +              K + S R SP +     G+
Sbjct: 1   MQDNEDKENAVA-VP----QTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTR----GGR 51

Query: 48  LPLQSKNGNKSNSIL-----------ISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLI 96
           LPL SK+ N S  ++           +    ++ ++K+YGS+LG +   N +L ++KSLI
Sbjct: 52  LPLASKDNNASGLVVSGKLGRQPADQVREANSSRKLKRYGSLLGYD---NRQLTRSKSLI 108

Query: 97  LKD 99
           LKD
Sbjct: 109 LKD 111

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 96/248 (38%), Gaps = 69/248 (27%)

Query: 69  NTRIKKYGSILGLENPGNFKLPKTKSLILKD----------------NXXXXXXXXDGLL 112
           ++R+KKYGS+LG        LP+ KSL+LKD                         D  L
Sbjct: 113 DSRLKKYGSVLGYNG-----LPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPL 167

Query: 113 NRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHXXXXXXXXXXXXXGKEKDVELSYIPD 172
             KL +AL+ + N++D+E +GS+GL       N              G+  D E+  +P 
Sbjct: 168 AAKLLKALN-NHNEDDKE-EGSIGLLG----SNTGLQQLLKHRNVEEGENSDFEIEIVPP 221

Query: 173 HYEVIAADEIEKLKQVNLG-TRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENIDPSYN 231
           H         E+L  V  G + FK S    LN   S        H  DSD EE  D  Y+
Sbjct: 222 HS--------EELPHVPNGYSPFKESDVIKLNTFTSPFSM----HKEDSDCEECDD--YD 267

Query: 232 GVNRI--------------------------GKNSTKSKSIDFDITE-EIGTKYAGSGLD 264
           G+  I                          G  + +    DF+  E  I   Y G GL+
Sbjct: 268 GLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATARHGLFDFNKPELYIEPHYNGEGLN 327

Query: 265 DDDIEAML 272
            +D+E++L
Sbjct: 328 KEDLESLL 335

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 8/70 (11%)

Query: 36  ISPLKRLQQ-QGKLPLQSKNGNKSNSILISHKG---NNTRIKKYGSILGLENPGNFK--L 89
           ISP ++L Q Q + PL  K+ N  NS ++  +    ++ R+KKYGS+LGL   GN    L
Sbjct: 81  ISPRRQLLQLQNRFPLSKKDNN--NSFILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNL 138

Query: 90  PKTKSLILKD 99
            + KSL+LKD
Sbjct: 139 TRIKSLVLKD 148

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 122/314 (38%), Gaps = 60/314 (19%)

Query: 6   DKENNLSTIPVL--ALQTPNTNFVKKNTTSTRISPLKRLQ--------QQGKLPLQSKNG 55
           +KENN+    +L    QTPN N +K+  +  +    K +Q         Q +LPL SK+ 
Sbjct: 4   NKENNIFRHAMLKDMPQTPN-NLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDN 62

Query: 56  NKSNS---------------------------------ILISHK----GNNTRIKKYGSI 78
           N+SNS                                 I   +K     ++ ++KKYGS+
Sbjct: 63  NRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGILADDRKLKKYGSV 122

Query: 79  LGLENPGNFKLPKTKSLILKDNXXXXXXXXDGLLNRKLKEALSRSQNDEDREGDGSVGLF 138
           LG        LPK KSL+LKD         D L  +       +S N    + +  +GL 
Sbjct: 123 LGYN-----ALPKVKSLVLKDISDNEDDDDDLLSLKLRDSMNKKSIN--TNKSNSGIGLL 175

Query: 139 AKEAFQNHXXXXXXXXXXXXXGKEKDVELSYIPDHYEVIAADEIEKLKQVNLGTRFKSSA 198
           +    Q                     +  YIPD +     ++I KLK  N  + FK   
Sbjct: 176 SGGNLQQLIRDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFN--SPFKLEQ 233

Query: 199 SSGLNDNDSTIQFLELEHVSDSDTEENIDPSYNGVNRIGKNSTKSKSIDFDITEEIGTKY 258
           S+  ++ DS+ + L L + SD +   N   + N    I         I  DI  +I   Y
Sbjct: 234 SNSDDEEDSS-ELLLLANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADIL-DIEPSY 291

Query: 259 AGSGLDDDDIEAML 272
            G GLD +D+E +L
Sbjct: 292 -GEGLDSNDLEDLL 304

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 54/123 (43%), Gaps = 20/123 (16%)

Query: 1   MSNQSDKENNL---STIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNK 57
           M  + +KEN +    ++PV    TP     +  +    ISP KR +Q  + PL SK+ NK
Sbjct: 1   MGARENKENAIWSERSVPV----TPTHLLSRSQSFMKNISP-KRAEQ--RKPLASKDNNK 53

Query: 58  SNSILIS----HKGNNTRIKKYGSILGLENPGNFKL------PKTKSLILKDNXXXXXXX 107
           S   L +     K     +   GS +G   PG   +      P+ KSL+LKD+       
Sbjct: 54  STGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQ 113

Query: 108 XDG 110
            DG
Sbjct: 114 SDG 116

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 24/31 (77%), Gaps = 3/31 (9%)

Query: 69  NTRIKKYGSILGLENPGNFKLPKTKSLILKD 99
           ++++KKYGS+LG+  P    L KTKSL+LKD
Sbjct: 94  DSKLKKYGSVLGVNYP---HLTKTKSLVLKD 121

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 124/321 (38%), Gaps = 69/321 (21%)

Query: 1   MSNQSDKENNL---STIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNK 57
           M    DKEN++   S +PV    TP     +  +     SP +    + + PL SK+ N+
Sbjct: 1   MGRHEDKENSIWSESNVPV----TPRHLLSRSQSFMKNKSPKR---AEARRPLASKDNNR 53

Query: 58  SNSIL-------------ISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKDNXXXX 104
           S S L             ++H G+     + G    L   G    PK KSL+LKD     
Sbjct: 54  SVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASG---APKIKSLVLKDGIEEE 110

Query: 105 XXXXDGL------------LNRKLK-EALSRSQNDEDREGDGSVGLFAKEAFQNHXXXXX 151
               +G             L  KL+ + LSR   D D EG+   GL              
Sbjct: 111 GSQSEGAEVDEDDDDDSNRLAAKLRTKLLSR---DRDAEGE-QTGLLGATGGLQSLLGPK 166

Query: 152 XXXXXXXXGKEKDVE--------LSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASS--- 200
                     +++VE        L ++P+ Y      EI KL+ V++ + F+ + S    
Sbjct: 167 LSQRAEESDSDQEVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDV-SPFQLNFSGVDE 225

Query: 201 --GLNDNDSTIQFLELEHVSDSDTEENIDPSYNGVNRIGKNST-------KSKSIDFDIT 251
              +N  DST Q   L    D + + + D S    +   + +T       + KS  F   
Sbjct: 226 DEDINSQDST-QLFTLNFDRDDNDDTDADQSGRKRHHTPERTTIPISTGQRRKSDVF--- 281

Query: 252 EEIGTKYAGSGLDDDDIEAML 272
            E+   YAG+GL   ++E++L
Sbjct: 282 -ELEPTYAGNGLTAKELESLL 301

>Kpol_1004.34 s1004 (71138..72733) [1596 bp, 531 aa] {ON}
           (71138..72733) [1596 nt, 532 aa]
          Length = 531

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 166 ELSYIPDHYEVIAADEIEKLKQVNLGTRFKSS--ASSGLNDNDSTIQFLELEHVSDSDTE 223
           ++SY+ D  EV + D+  +   +NL   F SS  A +GLN  +ST   +E   +S +  E
Sbjct: 261 DISYVADISEVSSIDDFSEAVGLNLAIVFPSSGTAPTGLNFINSTELTIEGTDIS-TQWE 319

Query: 224 ENIDPSYNGVNRIGKNSTKSKSI 246
             + P + GV  I K   KSK++
Sbjct: 320 SFVIPQW-GVLIINKYPLKSKAV 341

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 117/284 (41%), Gaps = 36/284 (12%)

Query: 4   QSDKENNL-STIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSK--NGNKSNS 60
           ++DKENN+  T+      TP T  +K+  T + + P K  Q+Q   PL SK  N N+S+S
Sbjct: 5   ETDKENNVVGTLREKGPATP-TQLLKR--TRSTLLPKKNGQRQ---PLASKDKNYNRSSS 58

Query: 61  ILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKD-----------NXXXXXXXXD 109
            L S K N+ + K   ++    +  N    +  SLILKD                     
Sbjct: 59  YL-SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIASGDEKESASESDSEDDEES 117

Query: 110 GLLNRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHXXXXXXXXXXXXXGKEKDVELSY 169
             L  K+K+AL+ S        +G  GL   ++                    ++ E  Y
Sbjct: 118 NPLALKIKQALTHSI----ASAEGKTGLLNGKSGLRKIFNDRDLDREIEVASVREPEKPY 173

Query: 170 IPDHYEVIAADEIEKLK---QVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENI 226
            P+ YE +   ++EKLK    +N  T    S  +     D + Q L L+ + +S  EE +
Sbjct: 174 EPEGYEPLDDSDLEKLKLKNAINRPTFIMDSPRAISIVGDDSPQLLPLD-LEESKLEEGV 232

Query: 227 -------DPSYNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGL 263
                  D      N   KN+  ++SID   + EI + Y G GL
Sbjct: 233 LNDKNTTDEVITRANTQAKNANITESIDDCSSVEIDSIYDGRGL 276

>CAGL0I03564g Chr9 (302137..303537) [1401 bp, 466 aa] {ON} similar
           to uniprot|P24870 Saccharomyces cerevisiae YDL155w CLB3
           cyclin or uniprot|P24871 Saccharomyces cerevisiae
           YLR210w CLB4 cyclin
          Length = 466

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 4   QSDKENNLSTIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNSILI 63
           +SD+EN +S      L TPN+N V       ++  ++R+ Q       + NG+ S+S  +
Sbjct: 75  ESDQENMVSIYASNTLDTPNSNDVSSLLEDQQLESIRRVTQHMS---NTSNGDDSDSTTV 131

Query: 64  ----SHKGNNT 70
               SH+G+N+
Sbjct: 132 ANKDSHQGDNS 142

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 12/108 (11%)

Query: 166 ELSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEEN 225
           EL YIP+ Y+    + IEKL+      + +S         D+  +  EL  ++ +D E+ 
Sbjct: 166 ELPYIPNGYDPFDKESIEKLQHHRSPFQVESITF------DTEERDPELISLAATD-EDL 218

Query: 226 IDPS-YNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAML 272
           + P+ YN      K++ +  S +  IT E+G +Y G GLD  ++ ++L
Sbjct: 219 VSPTRYNN----HKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.129    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,674,698
Number of extensions: 1425035
Number of successful extensions: 4063
Number of sequences better than 10.0: 79
Number of HSP's gapped: 4140
Number of HSP's successfully gapped: 85
Length of query: 275
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 167
Effective length of database: 41,097,471
Effective search space: 6863277657
Effective search space used: 6863277657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 65 (29.6 bits)