Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B05500singletonON45920711511e-154
NDAI0E04830singletonON3391946125e-75
NDAI0D01215singletonON6181786213e-73
NDAI0J03060singletonON4941725872e-69
Skud_9.200na 1ON3011675712e-69
KAFR0G02730singletonON2831615622e-68
NDAI0D00690singletonON5141745794e-68
YIR019C (MUC1)na 2ON13671676055e-68
NCAS0F00110singletonON6011665811e-67
Skud_4.216na 3ON3461595586e-67
NCAS0G00970singletonON3811995572e-66
TDEL0G00100singletonON7621635551e-62
Skud_9.199singletonOFF1431405074e-62
Suva_4.214na 3ON5811585302e-60
NCAS0I03180singletonON7551415365e-60
KAFR0D00730singletonON10631815392e-59
Suva_9.234na 1ON3401425063e-59
TDEL0B07680singletonON4801645163e-59
YDL037C (BSC1)na 3ON3281414983e-58
NCAS0A03060singletonON5041654781e-53
ZYRO0A13662gsingletonON9201764913e-53
KLLA0C19437gsingletonON7951574867e-53
SAKL0D09944gna 4ON13521584836e-52
KNAG0M00100singletonON7311654767e-52
SAKL0C03894gsingletonON6871924634e-50
KLLA0E01035gsingletonON18781574615e-49
SAKL0H21362gsingletonON10531804455e-47
NCAS0D04950singletonON2212073864e-43
Kwal_23.5441singletonON8301623739e-38
KLTH0A00550gsingletonON12881663713e-37
AEL023Cna 4ON14581543591e-35
TDEL0C00460na 5ON16521553474e-34
KNAG0G02540singletonON4571742962e-28
KNAG0L02480singletonON4311742934e-28
TDEL0A00100singletonON4821692706e-25
Ecym_2753na 4ON8901582631e-23
ZYRO0F02728gna 5ON23021592053e-16
ZYRO0F02750gsingletonON15941451511e-09
Smik_9.221na 2ON6330710.40
Smik_107.1singletonOFF19818711.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05500
         (459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05500 Chr2 (1126749..1128128) [1380 bp, 459 aa] {ON}            447   e-154
NDAI0E04830 Chr5 (1091882..1092901) [1020 bp, 339 aa] {ON}            240   5e-75
NDAI0D01215 Chr4 (285219..287075) [1857 bp, 618 aa] {ON}              243   3e-73
NDAI0J03060 Chr10 (773944..775428) [1485 bp, 494 aa] {ON}             230   2e-69
Skud_9.200 Chr9 complement(360408..361313) [906 bp, 301 aa] {ON}...   224   2e-69
KAFR0G02730 Chr7 complement(564437..565288) [852 bp, 283 aa] {ON}     221   2e-68
NDAI0D00690 Chr4 complement(146976..148520) [1545 bp, 514 aa] {O...   227   4e-68
YIR019C Chr9 complement(389572..393675) [4104 bp, 1367 aa] {ON} ...   237   5e-68
NCAS0F00110 Chr6 (8081..9886) [1806 bp, 601 aa] {ON}                  228   1e-67
Skud_4.216 Chr4 complement(379750..380787) [1038 bp, 346 aa] {ON...   219   6e-67
NCAS0G00970 Chr7 complement(164957..166102) [1146 bp, 381 aa] {O...   219   2e-66
TDEL0G00100 Chr7 complement(9857..12145) [2289 bp, 762 aa] {ON}       218   1e-62
Skud_9.199 Chr9 complement(359712..360140) [429 bp, 143 aa] {OFF...   199   4e-62
Suva_4.214 Chr4 complement(374649..376391) [1743 bp, 581 aa] {ON...   208   2e-60
NCAS0I03180 Chr9 complement(592003..594270) [2268 bp, 755 aa] {O...   211   5e-60
KAFR0D00730 Chr4 complement(137919..141110) [3192 bp, 1063 aa] {...   212   2e-59
Suva_9.234 Chr9 complement(377076..378095) [1020 bp, 340 aa] {ON...   199   3e-59
TDEL0B07680 Chr2 (1348302..1349744) [1443 bp, 480 aa] {ON}   pos...   203   3e-59
YDL037C Chr4 complement(384601..385587) [987 bp, 328 aa] {ON}  B...   196   3e-58
NCAS0A03060 Chr1 (601736..603250) [1515 bp, 504 aa] {ON}              188   1e-53
ZYRO0A13662g Chr1 (1088049..1090811) [2763 bp, 920 aa] {ON} some...   193   3e-53
KLLA0C19437g Chr3 (1740718..1743105) [2388 bp, 795 aa] {ON} some...   191   7e-53
SAKL0D09944g Chr4 (828689..832747) [4059 bp, 1352 aa] {ON} some ...   190   6e-52
KNAG0M00100 Chr13 complement(5975..8170) [2196 bp, 731 aa] {ON}       187   7e-52
SAKL0C03894g Chr3 (371240..373303) [2064 bp, 687 aa] {ON} some s...   182   4e-50
KLLA0E01035g Chr5 (109821..115457) [5637 bp, 1878 aa] {ON} some ...   182   5e-49
SAKL0H21362g Chr8 complement(1864400..1867561) [3162 bp, 1053 aa...   176   5e-47
NCAS0D04950 Chr4 complement(949734..950399) [666 bp, 221 aa] {ON}     153   4e-43
Kwal_23.5441 s23 (1160364..1162853) [2490 bp, 830 aa] {ON} YIR01...   148   9e-38
KLTH0A00550g Chr1 complement(49572..53438) [3867 bp, 1288 aa] {O...   147   3e-37
AEL023C Chr5 complement(589949..594325) [4377 bp, 1458 aa] {ON} ...   142   1e-35
TDEL0C00460 Chr3 (67471..72429) [4959 bp, 1652 aa] {ON}               138   4e-34
KNAG0G02540 Chr7 complement(573958..575331) [1374 bp, 457 aa] {O...   118   2e-28
KNAG0L02480 Chr12 (444470..445765) [1296 bp, 431 aa] {ON}             117   4e-28
TDEL0A00100 Chr1 complement(5449..6897) [1449 bp, 482 aa] {ON}        108   6e-25
Ecym_2753 Chr2 (1461692..1464364) [2673 bp, 890 aa] {ON} similar...   105   1e-23
ZYRO0F02728g Chr6 (220410..227318) [6909 bp, 2302 aa] {ON} some ...    84   3e-16
ZYRO0F02750g Chr6 (229681..234465) [4785 bp, 1594 aa] {ON} some ...    63   1e-09
Smik_9.221 Chr9 complement(366947..367135) [189 bp, 63 aa] {ON} ...    32   0.40 
Smik_107.1 Chr107 (1..594) [594 bp, 198 aa] {OFF}  YIR019C (HSP)       32   1.9  

>KAFR0B05500 Chr2 (1126749..1128128) [1380 bp, 459 aa] {ON} 
          Length = 459

 Score =  447 bits (1151), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MKLNNILSKTITVASIITNLVNALPTTNFFSRETTCLAATNGCPHLDFGHHAEVTNTLRY 60
           MKLNNILSKTITVASIITNLVNALPTTNFFSRETTCLAATNGCPHLDFGHHAEVTNTLRY
Sbjct: 1   MKLNNILSKTITVASIITNLVNALPTTNFFSRETTCLAATNGCPHLDFGHHAEVTNTLRY 60

Query: 61  YMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLID 120
           YMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLID
Sbjct: 61  YMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLID 120

Query: 121 NPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCH 180
           NPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCH
Sbjct: 121 NPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCH 180

Query: 181 SYDNNNISQTDFPGFYRRSPKCEDVKV 207
           SYDNNNISQTDFPGFYRRSPKCEDVKV
Sbjct: 181 SYDNNNISQTDFPGFYRRSPKCEDVKV 207

 Score =  136 bits (343), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 82/155 (52%)

Query: 305 FPGSVLDSSRVEXXXXXXXXXXXXXXXXXFPGSVLDSSRIESSPVPSTESGSVLSPADST 364
           FPGSVLDSSRVE                 FPGSVLDSSRIESSPVPSTESGSVLSPADST
Sbjct: 305 FPGSVLDSSRVESSTATDISSAVASSTSSFPGSVLDSSRIESSPVPSTESGSVLSPADST 364

Query: 365 GVISSSITXXXXXXXXXXXXXXXXXXXXXNTKAXXXXXXXXXXXXXXXXXXXHNPSSLKE 424
           GVISSSIT                     NTKA                   HNPSSLKE
Sbjct: 365 GVISSSITATSVDLSSDSSSIISSASPTSNTKASFSHTISTISSTAESTSVIHNPSSLKE 424

Query: 425 VTFXXXXXXXXXXXXXXXXDTTQSDRNVVHYFYSK 459
           VTF                DTTQSDRNVVHYFYSK
Sbjct: 425 VTFSSTAYSSLLTSYPSPSDTTQSDRNVVHYFYSK 459

>NDAI0E04830 Chr5 (1091882..1092901) [1020 bp, 339 aa] {ON} 
          Length = 339

 Score =  240 bits (612), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 112/194 (57%), Positives = 143/194 (73%), Gaps = 1/194 (0%)

Query: 3   LNNILSKTITVASIITNLVNALPTTNFFSRETTCLAATNGCPHLDFGHHAEVTNTLRYYM 62
           L+++L   I    ++++L+N    + +     TC    NGCP L+FG HA  TN L+YY+
Sbjct: 2   LSSVLLIIIQATYVLSSLINYQDQSLWKRGTLTCQTVMNGCPDLNFGWHAANTNILKYYL 61

Query: 63  SLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNP 122
            +  V  + +N YEITI VTGEEQIDLKYLYSLKIIGV GP+ T+QLYG NE+T+LID+P
Sbjct: 62  DILNVEWLGNNLYEITIQVTGEEQIDLKYLYSLKIIGVQGPKSTIQLYGKNENTFLIDSP 121

Query: 123 TDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSY 182
           T+Y  TFQVYG  +K D+C IW+PNF+IQYEYLQG+ S+Y  TW+WG T+FDLSTGC +Y
Sbjct: 122 TNYTVTFQVYGG-AKKDECNIWLPNFQIQYEYLQGDASKYQNTWKWGTTSFDLSTGCTNY 180

Query: 183 DNNNISQTDFPGFY 196
           DN   SQTDFPGFY
Sbjct: 181 DNQMNSQTDFPGFY 194

>NDAI0D01215 Chr4 (285219..287075) [1857 bp, 618 aa] {ON}
          Length = 618

 Score =  243 bits (621), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 112/178 (62%), Positives = 135/178 (75%), Gaps = 3/178 (1%)

Query: 28  NFFSRET-TCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQ 86
           + + RE+ TC   TNGCP L+FG HA  TN L+YY+ +  V  + DN YEITI VTGEEQ
Sbjct: 26  SLWERESSTCRTVTNGCPDLNFGWHATTTNLLKYYLDILYVEWLGDNLYEITIQVTGEEQ 85

Query: 87  IDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMP 146
           IDLKYLYSLK+IGV GP+ T+QLYG NE+T+LIDNPT+Y  TFQVYG  +K D C IW+P
Sbjct: 86  IDLKYLYSLKVIGVQGPKSTIQLYGKNENTFLIDNPTNYTVTFQVYGG-AKKDGCNIWLP 144

Query: 147 NFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKCED 204
           +F+IQYEYLQG+ S+Y  +W+WG T FDLSTGC +YDN   SQTDFPGFY  S  C D
Sbjct: 145 DFQIQYEYLQGDASKYQDSWKWGTTTFDLSTGCTNYDNQMNSQTDFPGFY-WSMHCSD 201

>NDAI0J03060 Chr10 (773944..775428) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score =  230 bits (587), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 106/172 (61%), Positives = 130/172 (75%), Gaps = 1/172 (0%)

Query: 36  CLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSL 95
           C    NGCP L+FG+HA  TNTLRYY+++  V  V DN Y ITI+V GE+QI +KYL+SL
Sbjct: 25  CQTIVNGCPDLNFGYHASNTNTLRYYLNILNVLWVQDNLYNITINVKGEKQIPMKYLHSL 84

Query: 96  KIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYL 155
           KIIGV GP+GTVQLYG NE+TYLIDNPTDY  TFQ+ G  S  D+C +W+PNF+IQYEYL
Sbjct: 85  KIIGVKGPQGTVQLYGGNEETYLIDNPTDYTVTFQISGG-SPKDECNVWLPNFQIQYEYL 143

Query: 156 QGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKCEDVKV 207
            G+ +QY  TWEWGA AFDL +GC  +DN   SQTDFPG+Y +S   E+ +V
Sbjct: 144 LGDAAQYEDTWEWGANAFDLGSGCDDFDNMGNSQTDFPGYYWKSKCNEECQV 195

>Skud_9.200 Chr9 complement(360408..361313) [906 bp, 301 aa] {ON}
           YIR019C (REAL)
          Length = 301

 Score =  224 bits (571), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (79%), Gaps = 3/167 (1%)

Query: 31  SRETTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLK 90
           S  T+C +  NGCP LDF  H    N ++Y + +  V+ V DNTY+I IHV G+E IDLK
Sbjct: 32  SDGTSCNSIVNGCPSLDFNWHMNQQNIMQYTLDVTSVSWVQDNTYQIQIHVKGKENIDLK 91

Query: 91  YLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKD-DDCEIWMPNFE 149
           YL+SLK+IGV+GP+GTVQLYG+NE+T+LIDNPTD+ ATF+VY   ++D + C++WMPNF+
Sbjct: 92  YLWSLKVIGVNGPKGTVQLYGFNENTFLIDNPTDFTATFEVYA--TQDVNSCQVWMPNFQ 149

Query: 150 IQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           IQ+EYLQG+ +QY+ TWEWG T+FDLSTGC++YDN   SQTDFPGFY
Sbjct: 150 IQFEYLQGSAAQYSSTWEWGTTSFDLSTGCNNYDNQGHSQTDFPGFY 196

>KAFR0G02730 Chr7 complement(564437..565288) [852 bp, 283 aa] {ON} 
          Length = 283

 Score =  221 bits (562), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (77%), Gaps = 2/161 (1%)

Query: 36  CLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSL 95
           C   TNGCP L+F  HA+   +++Y + +  V  V+D+TY +TIH TG EQI LKYLYSL
Sbjct: 34  CQEITNGCPSLNFDFHAQNIGSIQYNLDILSVWWVSDSTYNMTIHATGAEQIPLKYLYSL 93

Query: 96  KIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYL 155
           KIIGVDGPE TVQLYG NE+TYLIDNPTD+ ATF VY   S DDD ++WMPNF+IQ+EYL
Sbjct: 94  KIIGVDGPESTVQLYGKNENTYLIDNPTDFTATFAVYA--SADDDGKVWMPNFQIQFEYL 151

Query: 156 QGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           QG+ +QY ++WEWG++ FDL TGC +YDNN  SQTDFP FY
Sbjct: 152 QGDAAQYWESWEWGSSTFDLMTGCDNYDNNGNSQTDFPDFY 192

>NDAI0D00690 Chr4 complement(146976..148520) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  227 bits (579), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (77%), Gaps = 3/174 (1%)

Query: 32  RET-TCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLK 90
           RET  C   TNGCP+L+F   ++ TNTL+Y + +  V  + +N Y+ITI+V GE+QI LK
Sbjct: 32  RETEICQTVTNGCPNLNFDFKSKCTNTLKYDLKILNVEWLHENLYQITINVKGEKQIPLK 91

Query: 91  YLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEI 150
           YLYSLKII VDGP+GTVQLYG NE+TYLIDNPTD+ ATFQ+YG  S  D C+IW+PNF+I
Sbjct: 92  YLYSLKIIEVDGPQGTVQLYGKNENTYLIDNPTDFTATFQIYGG-SPRDRCDIWLPNFQI 150

Query: 151 QYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKCED 204
           QYEYLQG+ +QY  TWEWG TAFDL +GC+++DN   SQTDFPG+Y +   C+D
Sbjct: 151 QYEYLQGDAAQYADTWEWGTTAFDLISGCNNFDNMGNSQTDFPGYYWKI-NCDD 203

>YIR019C Chr9 complement(389572..393675) [4104 bp, 1367 aa] {ON}
           MUC1GPI-anchored cell surface glycoprotein (flocculin);
           required for pseudohyphal formation, invasive growth,
           flocculation, and biofilms; transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p); required for the formation of
           fibrous interconnections between cells in a colony of a
           wild S. cerevisiae strain
          Length = 1367

 Score =  237 bits (605), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 134/167 (80%), Gaps = 3/167 (1%)

Query: 31  SRETTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLK 90
           S  T+C +  NGCP+LDF  H +  N ++Y + +  V+ V DNTY+ITIHV G+E IDLK
Sbjct: 32  SEGTSCNSIVNGCPNLDFNWHMDQQNIMQYTLDVTSVSWVQDNTYQITIHVKGKENIDLK 91

Query: 91  YLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKD-DDCEIWMPNFE 149
           YL+SLKIIGV GP+GTVQLYGYNE+TYLIDNPTD+ ATF+VY   ++D + C++WMPNF+
Sbjct: 92  YLWSLKIIGVTGPKGTVQLYGYNENTYLIDNPTDFTATFEVYA--TQDVNSCQVWMPNFQ 149

Query: 150 IQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           IQ+EYLQG+ +QY  +W+WG T+FDLSTGC++YDN   SQTDFPGFY
Sbjct: 150 IQFEYLQGSAAQYASSWQWGTTSFDLSTGCNNYDNQGHSQTDFPGFY 196

>NCAS0F00110 Chr6 (8081..9886) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  228 bits (581), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 104/166 (62%), Positives = 122/166 (73%), Gaps = 1/166 (0%)

Query: 33  ETTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYL 92
           ++ C + TNGCP L+F  HA   N ++Y M L  V  + DN YEITI V G EQIDLKYL
Sbjct: 32  DSICQSITNGCPDLNFNWHASTQNIMQYSMDLQNVCWLHDNLYEITIQVLGAEQIDLKYL 91

Query: 93  YSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQY 152
           YSLKIIG+DGP GTVQLYG NE+TYLIDNPT+Y  TFQ+YG+  KD +   W+PNF+IQY
Sbjct: 92  YSLKIIGIDGPVGTVQLYGANENTYLIDNPTNYTVTFQIYGDNEKDTN-NTWIPNFQIQY 150

Query: 153 EYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRR 198
           EYLQG    Y  TW WG T+FDL TGC++YDN   SQTDFPGFY R
Sbjct: 151 EYLQGKAYAYADTWVWGTTSFDLMTGCNNYDNQGNSQTDFPGFYWR 196

>Skud_4.216 Chr4 complement(379750..380787) [1038 bp, 346 aa] {ON}
           YDL037C (REAL)
          Length = 346

 Score =  219 bits (558), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 101/159 (63%), Positives = 118/159 (74%), Gaps = 1/159 (0%)

Query: 38  AATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKI 97
            A NGCP LDF  H    N L Y + +  V+ + DN YEI+IHV   + I LKYL+SLKI
Sbjct: 46  VAINGCPKLDFNWHMSQQNILHYDLDVTSVSWIKDNVYEISIHVKAVKDIPLKYLWSLKI 105

Query: 98  IGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQG 157
           IGV+GP  TVQLYG NE TYLID+PTD+ +TFQVY NPS  D C +WMPNF+IQ+EYLQG
Sbjct: 106 IGVNGPSRTVQLYGKNEKTYLIDDPTDFTSTFQVYANPSS-DGCTVWMPNFQIQFEYLQG 164

Query: 158 NTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           +  QY QTWEWG T FDLSTGC++YDN   SQTDFPGFY
Sbjct: 165 DAGQYWQTWEWGTTTFDLSTGCNNYDNQGHSQTDFPGFY 203

>NCAS0G00970 Chr7 complement(164957..166102) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  219 bits (557), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 137/199 (68%), Gaps = 6/199 (3%)

Query: 10  TITVASIITNLVNALPTTNFFSRET---TCLAATNGCPHLDFGHHAEVTNTLRYYMSLDC 66
           T+ +AS +   +    T++  S+ T    C   TNGCP LDF       N +RYY+ L  
Sbjct: 8   TLLLASQLEASIINHDTSHELSKRTDYEVCKTVTNGCPDLDFSFKFMNENVMRYYIDLLN 67

Query: 67  VTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYK 126
           V  ++ N YEI I VTGEEQIDLKYLYSLKIIGV GP+GT+QLYG NE+TYLIDNPTDY 
Sbjct: 68  VKWISGNRYEIKIRVTGEEQIDLKYLYSLKIIGVQGPQGTIQLYGKNENTYLIDNPTDYT 127

Query: 127 ATFQV-YGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNN 185
           ATF+V   N  + DDC +W+PNFEIQYEYLQG+ S+Y  TW WG TAFDLSTGC S DN 
Sbjct: 128 ATFKVDVRNSDQTDDCYVWLPNFEIQYEYLQGDASKYEDTWVWGTTAFDLSTGCSS-DNQ 186

Query: 186 NISQTDFPGFYRRSPKCED 204
             +QT FPGFY    +C+D
Sbjct: 187 GRAQTSFPGFYWPI-RCDD 204

>TDEL0G00100 Chr7 complement(9857..12145) [2289 bp, 762 aa] {ON} 
          Length = 762

 Score =  218 bits (555), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 126/163 (77%), Gaps = 1/163 (0%)

Query: 40  TNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIG 99
           TN CP+L+F  HA+ TNT+ YYM L  V  V DNTYE++I+V G++QID+KYLYSLKIIG
Sbjct: 46  TNMCPNLNFKWHAKNTNTMPYYMDLLSVDWVGDNTYELSINVKGDQQIDMKYLYSLKIIG 105

Query: 100 VDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNT 159
           ++GP GT QL+G NE+TY+IDNPTD+    QVYG     D+C++ MP+F+IQYEYLQG+ 
Sbjct: 106 INGPMGTKQLWGKNENTYIIDNPTDFTTKIQVYGQKYNGDECKVAMPSFQIQYEYLQGDA 165

Query: 160 SQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKC 202
           +QY QTW+WGATAFDL TGC++ DNN  S  DFP +Y  + KC
Sbjct: 166 AQYWQTWKWGATAFDLMTGCNA-DNNGNSNADFPLWYWDNAKC 207

>Skud_9.199 Chr9 complement(359712..360140) [429 bp, 143 aa] {OFF}
           YIR019C (HSP)
          Length = 143

 Score =  199 bits (507), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 115/140 (82%), Gaps = 1/140 (0%)

Query: 56  NTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNED 115
           N + Y + +  V+ V DNTY+I IHV G+E IDLKYL+SLK+IGV+GP+GTVQLYG+NE+
Sbjct: 5   NIMEYTLDVTSVSWVQDNTYQIQIHVKGKENIDLKYLWSLKVIGVNGPKGTVQLYGFNEN 64

Query: 116 TYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDL 175
           T+LIDNPTD+ ATF+VY      + C++WMPNF+IQ+EYLQG+ +QY+ TWEWG T+FDL
Sbjct: 65  TFLIDNPTDFTATFEVYATQDV-NSCQVWMPNFQIQFEYLQGSAAQYSSTWEWGTTSFDL 123

Query: 176 STGCHSYDNNNISQTDFPGF 195
           STGC++YDN   SQTDFPGF
Sbjct: 124 STGCNNYDNQGHSQTDFPGF 143

>Suva_4.214 Chr4 complement(374649..376391) [1743 bp, 581 aa] {ON}
           YDL037C (REAL)
          Length = 581

 Score =  208 bits (530), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 118/158 (74%), Gaps = 1/158 (0%)

Query: 39  ATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKII 98
           A NGCP+LDF  H    N L Y M +  V+ V DN Y+I+IHVT  + I LKYLYSLK+I
Sbjct: 39  AINGCPNLDFNWHMSQQNILHYDMDVTSVSWVKDNVYQISIHVTAVQDIPLKYLYSLKVI 98

Query: 99  GVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGN 158
           GV GP  TVQLYG NE+TYLI +PTD+  TFQVY NPS  D C +WMPNF+IQ+EY+QG+
Sbjct: 99  GVTGPSSTVQLYGKNENTYLITDPTDFTTTFQVYANPSS-DGCTVWMPNFQIQFEYMQGD 157

Query: 159 TSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
            +QY QTW+WG T FDLSTGC +YDN   SQTDFPGFY
Sbjct: 158 AAQYWQTWQWGTTTFDLSTGCTNYDNQGHSQTDFPGFY 195

>NCAS0I03180 Chr9 complement(592003..594270) [2268 bp, 755 aa] {ON} 
          Length = 755

 Score =  211 bits (536), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 115/141 (81%), Gaps = 1/141 (0%)

Query: 58  LRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTY 117
           + Y M ++ V  + D+ YEITIHV G EQIDLKYLYSLKIIGVDGP+GTVQLYG NE+TY
Sbjct: 1   MHYTMDIENVVWLHDDLYEITIHVLGSEQIDLKYLYSLKIIGVDGPKGTVQLYGKNENTY 60

Query: 118 LIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLST 177
           LID+PTDY+ATFQVYG+ ++ D+C +W+PNF+IQYEYLQG+   Y  TW WG T+FDL T
Sbjct: 61  LIDSPTDYRATFQVYGD-TQRDECNVWLPNFQIQYEYLQGDAWAYADTWVWGTTSFDLMT 119

Query: 178 GCHSYDNNNISQTDFPGFYRR 198
           GC++YDN   SQTDFPG+Y +
Sbjct: 120 GCNNYDNQGNSQTDFPGYYWK 140

>KAFR0D00730 Chr4 complement(137919..141110) [3192 bp, 1063 aa] {ON}
           
          Length = 1063

 Score =  212 bits (539), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 125/181 (69%), Gaps = 2/181 (1%)

Query: 25  PTTNFFSRE-TTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTG 83
           P  N   RE  TC    NGCP L+F +H ++   + Y +S+D V     NTY +T+ VTG
Sbjct: 27  PPVNLAKREEQTCGQIINGCPDLNFTYHEKLNGIMDYDLSIDSVVWTGANTYNLTVTVTG 86

Query: 84  EEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEI 143
           +E I LKYL+SLK+IGV GPE T+ LYG NE+TYLID+PT +  TF+VY  PS D+   +
Sbjct: 87  QEAIALKYLWSLKLIGVQGPESTIVLYGKNENTYLIDDPTHFTVTFEVYAEPSSDNPDIV 146

Query: 144 WMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKCE 203
           WMPNFEI+YEYLQG+ SQY+ TWEWG   F L TGC+ YDN   S+TDFPG++  S +C+
Sbjct: 147 WMPNFEIKYEYLQGDASQYSSTWEWGTATFTLITGCYDYDNQCRSETDFPGYF-WSYQCD 205

Query: 204 D 204
           D
Sbjct: 206 D 206

>Suva_9.234 Chr9 complement(377076..378095) [1020 bp, 340 aa] {ON}
           YIR019C (REAL)
          Length = 340

 Score =  199 bits (506), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 115/142 (80%), Gaps = 3/142 (2%)

Query: 56  NTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNED 115
           N + Y + +  V+ V DNTY+I IHV G+E IDLKYL+SLK+IGV GP+GTVQLYG NE+
Sbjct: 5   NIMEYTLDVTSVSWVQDNTYQIQIHVKGKENIDLKYLWSLKVIGVTGPQGTVQLYGTNEN 64

Query: 116 TYLIDNPTDYKATFQVYGNPSKD-DDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFD 174
           TYLIDNPTD+ ATF+VY   ++D + C++WMPNF+IQ+EYLQG  +QY  TWEWG T+FD
Sbjct: 65  TYLIDNPTDFTATFEVYA--TQDVNSCQVWMPNFQIQFEYLQGTAAQYASTWEWGTTSFD 122

Query: 175 LSTGCHSYDNNNISQTDFPGFY 196
           LSTGC++YDN   SQTDFPGFY
Sbjct: 123 LSTGCNNYDNQGHSQTDFPGFY 144

>TDEL0B07680 Chr2 (1348302..1349744) [1443 bp, 480 aa] {ON} 
           possible pseudogene; NNN added to avoid internal stop
           codon
          Length = 480

 Score =  203 bits (516), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 121/164 (73%), Gaps = 2/164 (1%)

Query: 40  TNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIG 99
           T  CP L+F  HA  TNT+ YYM L  V  V  N YE+TIHV G+EQI LKYL+SLKIIG
Sbjct: 43  TKMCPDLNFEWHAMNTNTMPYYMDLLSVVNVDGNVYELTIHVKGKEQIPLKYLWSLKIIG 102

Query: 100 VDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNT 159
           ++GP+GT QLYG NE+TY+IDNPTD+  T Q+YG     DDC++ MP F+IQYEYLQG+ 
Sbjct: 103 INGPQGTKQLYGKNENTYIIDNPTDFTTTVQIYGQTYNGDDCKVAMPPFQIQYEYLQGDA 162

Query: 160 SQYNQT-WEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKC 202
           +QY+Q+  +WG TAFDL TGC++ DNN  S  DFP +Y  +PKC
Sbjct: 163 AQYSQSXXKWGTTAFDLMTGCNA-DNNGNSNADFPLWYWNNPKC 205

>YDL037C Chr4 complement(384601..385587) [987 bp, 328 aa] {ON}
           BSC1Protein of unconfirmed function, similar to cell
           surface flocculin Muc1p; ORF exhibits genomic
           organization compatible with a translational
           readthrough-dependent mode of expression
          Length = 328

 Score =  196 bits (498), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 1/141 (0%)

Query: 56  NTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNED 115
           N L Y M +  V+ V DNTY+ITIHV   + I LKYL+SLKIIGV+GP  TVQLYG NE 
Sbjct: 5   NILHYDMDVTSVSWVKDNTYQITIHVKAVKDIPLKYLWSLKIIGVNGPSSTVQLYGKNEK 64

Query: 116 TYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDL 175
           TYLI +PTD+ +TFQVY  PS  D C +WMPNF+IQ+EYLQG+ +QY QTW+WG T FDL
Sbjct: 65  TYLISDPTDFTSTFQVYAYPSS-DGCTVWMPNFQIQFEYLQGDAAQYWQTWQWGTTTFDL 123

Query: 176 STGCHSYDNNNISQTDFPGFY 196
           STGC++YDN   SQTDFPGFY
Sbjct: 124 STGCNNYDNQGHSQTDFPGFY 144

>NCAS0A03060 Chr1 (601736..603250) [1515 bp, 504 aa] {ON} 
          Length = 504

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 82/165 (49%), Positives = 120/165 (72%), Gaps = 1/165 (0%)

Query: 34  TTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLY 93
           T C +  N CP L+F    +  + + YY+S++ V  +  N YEIT+HV G EQID+KYLY
Sbjct: 35  TKCKSIDNACPDLNFSWDFDNQDIMPYYLSIESVIWLDQNLYEITVHVMGAEQIDIKYLY 94

Query: 94  SLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYE 153
           +LKIIGV+GP+ T+ LYG  + +++I +PT++  +F+VY +  K D+C++W+P+F+IQYE
Sbjct: 95  ALKIIGVNGPKSTILLYGDGDISHVITSPTNFSVSFEVYADTPK-DNCDVWLPDFKIQYE 153

Query: 154 YLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRR 198
           YL+G+ ++++ TW WG + FDL TGC  YDNN  SQTDFPGFY R
Sbjct: 154 YLEGSAAKFSDTWVWGDSTFDLRTGCTIYDNNGNSQTDFPGFYWR 198

>ZYRO0A13662g Chr1 (1088049..1090811) [2763 bp, 920 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 920

 Score =  193 bits (491), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/176 (53%), Positives = 120/176 (68%), Gaps = 3/176 (1%)

Query: 30  FSRET--TCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQI 87
           ++R T  T    TN CP L+F  H+   N + Y M L  V  V  NTYE+TI+V GEE I
Sbjct: 38  YNRRTSSTVSGVTNMCPGLNFHWHSSNENIMPYSMDLLSVDWVGGNTYELTINVKGEEHI 97

Query: 88  DLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPN 147
           DLKYL+SLKIIG+ GP+ T QLYG NE+TYLID+PTD+    QVYG     DDC++ MP+
Sbjct: 98  DLKYLWSLKIIGISGPQSTKQLYGKNENTYLIDDPTDFTTQIQVYGQTYNGDDCKVVMPS 157

Query: 148 FEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKCE 203
           F+IQYEYLQG+ +QY +TW+WG T FDL TGC + DNN  S  DFP +Y  + K +
Sbjct: 158 FQIQYEYLQGDAAQYWKTWKWGKTDFDLMTGCDA-DNNGNSNADFPLWYWDNSKAK 212

>KLLA0C19437g Chr3 (1740718..1743105) [2388 bp, 795 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 795

 Score =  191 bits (486), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 89/157 (56%), Positives = 118/157 (75%), Gaps = 2/157 (1%)

Query: 41  NGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGV 100
           NG P LDF +HA+ T T+RY + ++ V  V DN Y +T+HVTGEEQI LK L+SLKIIG+
Sbjct: 41  NGYPCLDFSYHAQNTRTMRYDIVVEQVNWVKDNIYTVTVHVTGEEQIPLKSLWSLKIIGI 100

Query: 101 DGPEG-TVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNT 159
           D P+G T+QLYGYNE+T+LIDNPTD+ ATF+VYG    +D   +WMP FE+QYEY QG+ 
Sbjct: 101 DSPDGSTIQLYGYNENTFLIDNPTDWTATFRVYGQTDSNDQSIVWMPTFEVQYEYCQGSR 160

Query: 160 SQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           +  +  W++G   FDL TGC++YDNN+ SQTD P ++
Sbjct: 161 TDCSN-WKYGTKNFDLITGCNNYDNNHRSQTDAPSYF 196

>SAKL0D09944g Chr4 (828689..832747) [4059 bp, 1352 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1352

 Score =  190 bits (483), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 119/158 (75%), Gaps = 6/158 (3%)

Query: 41  NGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGV 100
           NGCP+L+F   +  TNT+ Y +S+D V+ V+D+ Y +TIHV G+EQI ++ ++SLK+IGV
Sbjct: 45  NGCPNLNFEWKSGNTNTMPYTISVDSVSWVSDDIYTVTIHVVGKEQIPIESMWSLKLIGV 104

Query: 101 DGPE-GTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCE-IWMPNFEIQYEYLQGN 158
           D P+ GT Q+YG+NE+TYLI+NPTD+ ATF+VYG       C  +WMPNF+IQ+EY QG+
Sbjct: 105 DSPDGGTFQVYGHNENTYLINNPTDWYATFRVYGT--SSSKCGLVWMPNFQIQFEYCQGD 162

Query: 159 TSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           T   N  W  GATAFDL TGC++YDNN  SQTD PG+Y
Sbjct: 163 TDCSN--WSHGATAFDLQTGCNNYDNNGNSQTDSPGYY 198

>KNAG0M00100 Chr13 complement(5975..8170) [2196 bp, 731 aa] {ON} 
          Length = 731

 Score =  187 bits (476), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 116/165 (70%), Gaps = 3/165 (1%)

Query: 35  TCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPV--ADNTYEITIHVTGEEQIDLKYL 92
           TC + +NGC +LDF    +    ++Y M +  V+    ++NTY + I V GE+QIDLKYL
Sbjct: 31  TCGSVSNGCSNLDFNWSFKNQKIMKYTMDVTSVSFAEGSENTYNVKIRVVGEQQIDLKYL 90

Query: 93  YSLKIIGVDGPEGTVQLYGYNED-TYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQ 151
           +SLKI GV GP+ T+QL+G NE  + LI NPTD+KA FQVYG  S  D+C++W+P+F++ 
Sbjct: 91  WSLKIFGVFGPQSTIQLHGKNEGVSGLITNPTDFKAEFQVYGKTSPTDECKVWLPSFQVN 150

Query: 152 YEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
           YEYLQG+ +QY+  W+WG + FDLS GC +YDN   SQT+FP  +
Sbjct: 151 YEYLQGDAAQYSGDWKWGTSTFDLSVGCDNYDNQGHSQTNFPSVF 195

>SAKL0C03894g Chr3 (371240..373303) [2064 bp, 687 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 687

 Score =  182 bits (463), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 127/192 (66%), Gaps = 8/192 (4%)

Query: 7   LSKTITVASIITNLVNALPTTNFFSRETTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDC 66
           L + I   +I +N VN +P     S  +     TNGCP L+F   +  TNT+ Y +S+D 
Sbjct: 13  LVQNIAATAISSNRVNFVPPGQ--SSGSKSCQPTNGCPDLNFAWKSGNTNTMPYTISVDS 70

Query: 67  VTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEG-TVQLYGYNEDTYLIDNPTDY 125
           V  V+ + Y ITIHVTGE+ I +  ++S+KIIGVD P+G T Q+YG+NE    IDNPTD+
Sbjct: 71  VAWVSSDIYTITIHVTGEKTISIDAMWSVKIIGVDSPDGSTFQVYGHNEGADFIDNPTDW 130

Query: 126 KATFQVYGNPSKDDDC-EIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDN 184
            ATF+V+G  S   +C  +WMPNF+IQ+EY QG+T   N  W +G+TAFDL TGC +YDN
Sbjct: 131 YATFRVHGKSSS--ECGRVWMPNFQIQFEYCQGDTDCSN--WSYGSTAFDLETGCDNYDN 186

Query: 185 NNISQTDFPGFY 196
           N  SQTD PG+Y
Sbjct: 187 NGNSQTDSPGYY 198

>KLLA0E01035g Chr5 (109821..115457) [5637 bp, 1878 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1878

 Score =  182 bits (461), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 111/157 (70%), Gaps = 3/157 (1%)

Query: 41  NGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGV 100
           NGCP LDF  H++ T T++Y +  + V  V DN Y +T+HVTG++QI LK L+SLKIIGV
Sbjct: 302 NGCPCLDFSFHSQNTGTMQYSIVPEEVNWVQDNIYTVTLHVTGQKQIPLKSLWSLKIIGV 361

Query: 101 DGPEG-TVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNT 159
           + P+G T QL+GYNE TYLIDNPTD+ ATF+VYG    +D   +WMP F+IQYEY QG+ 
Sbjct: 362 NSPDGSTFQLFGYNEKTYLIDNPTDWTATFRVYGQADSNDPSIVWMPTFQIQYEYCQGSA 421

Query: 160 SQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
              +  W +G T FDL TGC++YDN   SQTD   ++
Sbjct: 422 DCSD--WSYGTTTFDLITGCNNYDNYKRSQTDAGSYF 456

 Score =  178 bits (452), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 84/157 (53%), Positives = 109/157 (69%), Gaps = 3/157 (1%)

Query: 41  NGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGV 100
           NGCP LDF   ++ T T+ Y + L+ V  V  N Y +T+HVTG++QI LK L+SLKIIGV
Sbjct: 42  NGCPCLDFSFRSQNTRTMPYNIELENVKWVESNIYTVTLHVTGQKQIPLKSLWSLKIIGV 101

Query: 101 DGPEG-TVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNT 159
           + P+G T QL+GYNE TYLIDNPTD+ ATF+VYG    +D   +WMP F+IQYEY QG+ 
Sbjct: 102 NSPDGSTFQLFGYNEKTYLIDNPTDWTATFRVYGQADSNDPSIVWMPTFQIQYEYCQGSA 161

Query: 160 SQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
              +  W +G T FDL TGC++YDN   SQTD   ++
Sbjct: 162 DCSD--WSYGTTTFDLITGCNNYDNYKRSQTDAGSYF 196

>SAKL0H21362g Chr8 complement(1864400..1867561) [3162 bp, 1053 aa]
           {ON} some similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1053

 Score =  176 bits (445), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/180 (52%), Positives = 127/180 (70%), Gaps = 5/180 (2%)

Query: 18  TNLVNALPTTNFFSRETTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEI 77
           T+ VN +P++   S+       TNGCP+LDF  HA  TNT+ Y +S+  V+ V  N Y I
Sbjct: 20  TSYVNFVPSSA--SKGAVSCQPTNGCPNLDFTFHAAQTNTVVYSISVVSVSWVESNIYTI 77

Query: 78  TIHVTGEEQIDLKYLYSLKIIGVDGPEG-TVQLYGYNEDTYLIDNPTDYKATFQVYGNPS 136
            IHVT E++I +  ++S+KIIGV+GP+G T+QLYG+NE+TYLID+PTDY ATF+VYG   
Sbjct: 78  QIHVTAEKKISINDVWSIKIIGVNGPDGGTLQLYGHNENTYLIDDPTDYYATFRVYGQTD 137

Query: 137 KDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
             D  ++WMPNF+IQYEY  G  S  +  W++GA AFDL TGC++YDN   SQTD PG+Y
Sbjct: 138 SSDSSKVWMPNFQIQYEYCMGTVSCSD--WKYGARAFDLITGCNNYDNQGHSQTDSPGYY 195

>NCAS0D04950 Chr4 complement(949734..950399) [666 bp, 221 aa] {ON} 
          Length = 221

 Score =  153 bits (386), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 121/207 (58%), Gaps = 8/207 (3%)

Query: 6   ILSKTITVASIITNLVNALPTTNFFSRET-----TCLAATNGCPHLDFGHHAEVTNTLRY 60
           +LS+ I +  +I+    ++   +   + +      C +A NGC +LDF +     N +RY
Sbjct: 1   MLSQLIIIFLLISQYCGSIINLDEAQKSSKKDPAVCHSAYNGCRNLDFDYWFNSRNIMRY 60

Query: 61  YMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLID 120
           YM ++ V  + DN YE+TIHV G++QIDLKYL  L I  +DGP+  + L+    +   I 
Sbjct: 61  YMDVEKVMWLQDNLYEVTIHVHGQQQIDLKYLSMLYIHEIDGPKRGITLFHRGLNISDII 120

Query: 121 NPTDYKATFQVYGNPSKDDD--CEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLSTG 178
           +PTDY  TFQVYGN + + D  C I +P F+I YEYL    S Y  TWEWG  +F L+ G
Sbjct: 121 SPTDYTVTFQVYGNFTTEIDFQCLIKLPAFKIHYEYLLDEQSVYKDTWEWGTPSFTLTNG 180

Query: 179 CHSYDNNNISQTDFPGFYRRSPKCEDV 205
           C  YDN   S T FPG++  S +CE++
Sbjct: 181 CRYYDNEFRSYTSFPGYF-WSLECENL 206

>Kwal_23.5441 s23 (1160364..1162853) [2490 bp, 830 aa] {ON} YIR019C
           (MUC1) - cell surface flocculin with structure similar
           to serine/threonine-rich GPI-anchored cell wall proteins
           [contig 8] PARTIAL
          Length = 830

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 105/162 (64%), Gaps = 9/162 (5%)

Query: 36  CLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSL 95
           C   TNGCP+LDF    + T  + Y +S+  V  V DN YEIT+HV GE+ I+++ +  L
Sbjct: 42  CPEFTNGCPNLDFTWKPKNTGQMLYDISMKRVKWVRDNIYEITVHVQGEKNINIQCVDGL 101

Query: 96  KIIGVDGPE-GTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEY 154
           K+IG++GP+ GT  LY  N +   +D+PTDY ATF+VYG     ++C +WMPNF+IQY+Y
Sbjct: 102 KVIGINGPDGGTFWLYDRNNNIARVDSPTDYDATFRVYGQ-EDTENCRVWMPNFQIQYDY 160

Query: 155 LQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
                   N+   + + +FDL TGC++YDN   SQTD PGFY
Sbjct: 161 -------NNKCDTYSSKSFDLITGCNNYDNQGHSQTDAPGFY 195

>KLTH0A00550g Chr1 complement(49572..53438) [3867 bp, 1288 aa] {ON}
           some similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1288

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 104/166 (62%), Gaps = 10/166 (6%)

Query: 33  ETTCLAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYL 92
           + TC   TNGCP+LDF    + T  + Y +S+  V  V DN YEIT+HV GE+ I +  +
Sbjct: 39  QATCTEITNGCPNLDFTWKPKNTGQMLYDISMKKVQWVKDNIYEITVHVQGEKNIAISCI 98

Query: 93  YSLKIIGVDGPE-GTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQ 151
             LK+IG++GP+ GT  LY  N +   +D+PTDY ATF+VYG      +C +WMPNF+IQ
Sbjct: 99  DGLKVIGINGPDGGTFWLYDRNNNIAKVDSPTDYDATFRVYGQ-EDTSNCRVWMPNFQIQ 157

Query: 152 YEYLQGNTSQYNQTWEWG-ATAFDLSTGCHSYDNNNISQTDFPGFY 196
           Y+Y        NQ   +G + +F L TGC++YDN   S+TD PGFY
Sbjct: 158 YDY-------NNQCDVYGNSKSFGLITGCNNYDNQGHSKTDAPGFY 196

>AEL023C Chr5 complement(589949..594325) [4377 bp, 1458 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIR019C
           (MUC1)
          Length = 1458

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/154 (46%), Positives = 97/154 (62%), Gaps = 5/154 (3%)

Query: 43  CPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDG 102
           CP  DF   A+ +    Y +S++ V    DN Y +TI   G +   LK L+SLKIIGVD 
Sbjct: 52  CPQYDFTWKAKNSGYAPYKVSVEKVEWEYDNVYTVTIRAKGTDPTPLKSLWSLKIIGVDS 111

Query: 103 PEGTV-QLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQ 161
           P+G+  QL+GYNE T+LIDNP+DY+ATF+VY       D ++ MP ++IQYEY QG+T  
Sbjct: 112 PDGSSFQLFGYNEHTFLIDNPSDYQATFRVYAQ--DGGDGKVCMPEYKIQYEYCQGHTDC 169

Query: 162 YNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGF 195
            +  W++G TA DL  GC + DN N SQ D P +
Sbjct: 170 SD--WKYGTTAIDLEMGCSNVDNMNHSQKDSPAY 201

>TDEL0C00460 Chr3 (67471..72429) [4959 bp, 1652 aa] {ON} 
          Length = 1652

 Score =  138 bits (347), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 93/155 (60%), Gaps = 2/155 (1%)

Query: 41  NGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGV 100
           N CP LDF   +     + Y M++  V  +  ++YE+TIHV G++QI LK+LYSL I  +
Sbjct: 58  NACPGLDFKWRSTYYGIMNYDMNVIGVNYLGKDSYEVTIHVVGDKQIPLKFLYSLSISNI 117

Query: 101 DGPEGTVQLYGYNEDTYLIDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTS 160
            GP+  V L+  ++    IDNPTD+ ATF V   P  D    +WMP+F++ +EY+ G   
Sbjct: 118 GGPDRIVPLHHCDKGINKIDNPTDFTATFVVNSRP--DLFGRVWMPDFKLDFEYVLGPAR 175

Query: 161 QYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGF 195
           QY + W+WG T+F L++GC   D    S  DFPGF
Sbjct: 176 QYAKEWKWGKTSFSLASGCDLADFWGRSYADFPGF 210

>KNAG0G02540 Chr7 complement(573958..575331) [1374 bp, 457 aa] {ON} 
          Length = 457

 Score =  118 bits (296), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 104/174 (59%), Gaps = 13/174 (7%)

Query: 33  ETTCLAAT--NGCPHLDFGHHAEVTNT-LRYYMSLDCVTPVADNT-YEITI--HVTGEEQ 86
           ET C A T  +GCPHLDF +  E      ++ + L  V  + +   Y++TI  +    E+
Sbjct: 38  ETGCPATTIQHGCPHLDFDYFYENERINPKFSLDLKDVRWLPNQKLYKVTIRAYTRNGEK 97

Query: 87  IDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLID-NPTDYKATFQVYGNPSKDDDCEIWM 145
           IDLKYL+SLK+IG+    GT QLYG+NE     D +P+D+  TF + G P  ++ C +W+
Sbjct: 98  IDLKYLWSLKVIGLS--TGTHQLYGFNEGVLPEDFDPSDFTTTFLIRGRPDYEN-CIVWL 154

Query: 146 PNFEIQYEYLQGNTSQYNQTW---EWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
             F++QYE+L G+T+QY + W    +G   FDLS GCH+ +N+  SQ   P ++
Sbjct: 155 DYFQLQYEFLDGHTAQYKEDWYNEGFGKPHFDLSVGCHNSNNHGQSQLGLPNYF 208

>KNAG0L02480 Chr12 (444470..445765) [1296 bp, 431 aa] {ON} 
          Length = 431

 Score =  117 bits (293), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 103/174 (59%), Gaps = 13/174 (7%)

Query: 33  ETTCLAAT--NGCPHLDFGHHAEVTNT-LRYYMSLDCVTPVADNT-YEITI--HVTGEEQ 86
           ET C  AT  +GCPHLDF H  E  N   ++ + L  V  + +   Y++TI  ++T  E+
Sbjct: 38  ETICPVATVQHGCPHLDFEHFYETENINPKFSLDLTDVRWLPNQKLYQVTIRAYITNGEK 97

Query: 87  IDLKYLYSLKIIGVDGPEGTVQLYGYNEDTYLID-NPTDYKATFQVYGNPSKDDDCEIWM 145
           IDLKYL+SLK IG+    GT Q+YG+NE       +P+D+  TF + G P  ++ C +W+
Sbjct: 98  IDLKYLWSLKAIGLS--MGTHQIYGFNEGVLPEGFDPSDFTTTFLIRGRPDYEE-CIVWL 154

Query: 146 PNFEIQYEYLQGNTSQYNQTW---EWGATAFDLSTGCHSYDNNNISQTDFPGFY 196
             F++Q+E+L G+T QY   W    +G + FDLS GCH+ +N   S+   P +Y
Sbjct: 155 DYFQLQFEFLDGHTGQYRSDWYREGFGNSHFDLSVGCHNSNNYGQSKVGLPNYY 208

>TDEL0A00100 Chr1 complement(5449..6897) [1449 bp, 482 aa] {ON}
          Length = 482

 Score =  108 bits (270), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 93/169 (55%), Gaps = 10/169 (5%)

Query: 40  TNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIG 99
           T  CP L+F  HA  TNT+ YYM L  V  V  N YE+TIHV G+EQI LKYL+SLKIIG
Sbjct: 43  TKMCPDLNFEWHAMNTNTMPYYMDLLSVVNVDGNVYELTIHVKGKEQIPLKYLWSLKIIG 102

Query: 100 VDGPEGTVQLYGYNEDTYL-IDNPTDYKAT-FQVYGNPSKDDDCEIWMPNFEI----QYE 153
           ++GP   +  +       + IDNPTD+  T   ++ N       ++    F+I     Y+
Sbjct: 103 INGPPRVLNNFMVRTKIPIYIDNPTDFTTTSSNLWSNVITVMIVKLPCLPFQIPSMNTYK 162

Query: 154 YLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSPKC 202
            +Q N  +     +     FDL TGC++ DNN  S  DFP +Y  +PKC
Sbjct: 163 VMQHNILKVESGVQL---LFDLMTGCNA-DNNGNSNADFPLWYWNNPKC 207

>Ecym_2753 Chr2 (1461692..1464364) [2673 bp, 890 aa] {ON} similar to
           Ashbya gossypii AEL023C
          Length = 890

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (53%), Gaps = 8/158 (5%)

Query: 37  LAATNGCPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLK 96
           L ATN C   DF   A       Y ++++ V    +N Y IT+HV G   I ++ L+SLK
Sbjct: 43  LPATNACLQYDFSWKARNNGYPPYSLTVERVAWEYENVYTITVHVQGSVSIPIESLWSLK 102

Query: 97  IIGVDGPEG-TVQLYGYNEDTYLIDNPTDYKATFQVYG--NPSKDDDCEIWMPNFEIQYE 153
           I+  + P+G T QLY  NE  +LI++PT+Y  +F+V+G   P  +  C    P F IQYE
Sbjct: 103 IVDANSPDGSTFQLYSRNESRHLINDPTNYYVSFRVFGRQGPVNELMC---TPEFGIQYE 159

Query: 154 YLQGNTSQYNQTWEWGATAFDLSTGCHSYDNNNISQTD 191
           Y QG+    N  W +G TAF L+ GC   D    S  D
Sbjct: 160 YCQGSADCSN--WTYGTTAFTLNMGCTGVDRQGRSSKD 195

>ZYRO0F02728g Chr6 (220410..227318) [6909 bp, 2302 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 2302

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 77/159 (48%), Gaps = 18/159 (11%)

Query: 43  CPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDG 102
           CP   F +   +   L+  M +  V+ + +NTY +TIHVTG   I    L SL I  +DG
Sbjct: 624 CPGRSFLNSVSI---LQQNMDVTDVSYLGNNTYNVTIHVTGSSTIASNLLQSLAITNIDG 680

Query: 103 PEGTVQLYGYNEDTYL-IDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQ 161
           PE  V LY  +    L   +PTDY ATF+ YG        EIW+P F++ Y Y  G    
Sbjct: 681 PENQVTLYSTDSAGLLNTVSPTDYTATFESYG---VQQGNEIWLPAFQLTYTYSNGLPDP 737

Query: 162 YNQTWEWGATAFDLSTGCHSYDNNNISQTDFPGFYRRSP 200
                   + +++L+ GC + D      +   G++ R+P
Sbjct: 738 L-----AASNSYNLAAGCPAVD------SSLAGYHWRNP 765

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 72/144 (50%), Gaps = 15/144 (10%)

Query: 58  LRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDGPEGTVQLYGYNEDTY 117
           L+  M +  V+ + +NTY +TIHVTG   I    L SL I  +DGPE  V LY  +    
Sbjct: 61  LQQNMDVTDVSYLGNNTYNVTIHVTGSSTIASNLLQSLAITNIDGPENQVTLYSTDSAGL 120

Query: 118 L-IDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEYLQGNTSQYNQTWEWGATAFDLS 176
           L   +PTDY ATF+ YG        EIW+P F++ Y Y  G            + +++L+
Sbjct: 121 LNTVSPTDYTATFESYG---VQQGNEIWLPAFQLTYTYSNGLPDPL-----AASNSYNLA 172

Query: 177 TGCHSYDNNNISQTDFPGFYRRSP 200
            GC + D      +   G++ R+P
Sbjct: 173 AGCPAVD------SSLAGYHWRNP 190

>ZYRO0F02750g Chr6 (229681..234465) [4785 bp, 1594 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 1594

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 43  CPHLDFGHHAEVTNTLRYYMSLDCVTPVADNTYEITIHVTGEEQIDLKYLYSLKIIGVDG 102
           CP  +  +       + + M +  V+ +  NTY +TIHV+G+  I       L +  +DG
Sbjct: 49  CPVRNILNSLGAEKLISFDMEVTDVSYLGGNTYNVTIHVSGKINIASYLFRGLHVSDIDG 108

Query: 103 PEGTVQLYGYNEDTYL-IDNPTDYKATFQVYGNPSKDDDCEIWMPNFEIQYEY---LQGN 158
           P+  V LY       L +  P+DY A F VYG    D    +W+P+F + YEY   L G 
Sbjct: 109 PDSEVTLYSTTTPNLLNLLCPSDYTANFLVYGVEQGD---TVWLPSFRLVYEYSNGLPGV 165

Query: 159 TSQYNQTWEWGATAFDLSTGCHSYD 183
               NQ         +L TGC   D
Sbjct: 166 LETVNQ--------LELITGCLEVD 182

>Smik_9.221 Chr9 complement(366947..367135) [189 bp, 63 aa] {ON}
          YIR019C (HSP)
          Length = 63

 Score = 32.0 bits (71), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 31 SRETTCLAATNGCPHLDFGHHAEVTNTLRY 60
          S  T+C +  NGCP LDF  H    N ++Y
Sbjct: 32 SGGTSCNSIVNGCPSLDFNWHMNQQNIMQY 61

>Smik_107.1 Chr107 (1..594) [594 bp, 198 aa] {OFF}  YIR019C (HSP)
          Length = 198

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 179 CHSYDNNNISQTDFPGFY 196
           C++YDN   SQTDFPGFY
Sbjct: 1   CNNYDNQGHSQTDFPGFY 18

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query: 35  TCLAATNGCPHLDFGHHAEVTNTLRYYM 62
           TC    NGCP LDF  H    N ++Y +
Sbjct: 171 TCTTVVNGCPSLDFNWHMNQQNIMQYTL 198

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,738,286
Number of extensions: 1378548
Number of successful extensions: 3126
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3107
Number of HSP's successfully gapped: 46
Length of query: 459
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 346
Effective length of database: 40,524,141
Effective search space: 14021352786
Effective search space used: 14021352786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)