Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B054908.267ON85854301e-56
Skud_4.3758.267ON105772323e-26
Suva_2.2748.267ON105572307e-26
Smik_4.3598.267ON105762282e-25
SAKL0H16918g8.267ON111562273e-25
YDR115W8.267ON105732254e-25
KLTH0G13574g8.267ON112882264e-25
Kpol_543.428.267ON112852231e-24
Kwal_56.237768.267ON130722241e-24
CAGL0B01793g8.267ON98722184e-24
NCAS0B038208.267ON115642161e-23
Ecym_43038.267ON109832142e-23
TPHA0A017708.267ON104502133e-23
KNAG0H032208.267ON86492113e-23
NDAI0J013408.267ON141552154e-23
ZYRO0C01540g8.267ON97522081e-22
AGR081C8.267ON130602083e-22
TBLA0E044708.267ON94532002e-21
TDEL0F039408.267ON110621987e-21
KLLA0F19250g8.267ON116611962e-20
KAFR0F002302.38ON100344690.22
KAFR0A063804.173ON187770631.4
CAGL0G01034g4.173ON186370631.5
KLTH0F16808g5.633ON37246621.8
Skud_7.1416.229ON140558612.2
KLTH0G17754g4.173ON189870612.4
Suva_7.1326.229ON140258594.5
NCAS0A020404.173ON183770595.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05490
         (85 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...   170   1e-56
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    94   3e-26
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    93   7e-26
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    92   2e-25
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    92   3e-25
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    91   4e-25
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    92   4e-25
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    91   1e-24
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    91   1e-24
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    89   4e-24
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    88   1e-23
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    87   2e-23
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    87   3e-23
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    86   3e-23
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    87   4e-23
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    85   1e-22
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    85   3e-22
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    82   2e-21
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    81   7e-21
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    80   2e-20
KAFR0F00230 Chr6 complement(58626..61637) [3012 bp, 1003 aa] {ON...    31   0.22 
KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa]...    29   1.4  
CAGL0G01034g Chr7 (93468..99059) [5592 bp, 1863 aa] {ON} highly ...    29   1.5  
KLTH0F16808g Chr6 (1360799..1361917) [1119 bp, 372 aa] {ON} simi...    28   1.8  
Skud_7.141 Chr7 complement(266063..270280) [4218 bp, 1405 aa] {O...    28   2.2  
KLTH0G17754g Chr7 complement(1534396..1540092) [5697 bp, 1898 aa...    28   2.4  
Suva_7.132 Chr7 complement(257924..262132) [4209 bp, 1402 aa] {O...    27   4.5  
NCAS0A02040 Chr1 (387566..393079) [5514 bp, 1837 aa] {ON} Anc_4....    27   5.3  

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa]
          {ON} Anc_8.267 YDR115W
          Length = 85

 Score =  170 bits (430), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MLPIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFL 60
          MLPIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFL
Sbjct: 1  MLPIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFL 60

Query: 61 SRAKSKQKSKILKDRKEKGRWYLSH 85
          SRAKSKQKSKILKDRKEKGRWYLSH
Sbjct: 61 SRAKSKQKSKILKDRKEKGRWYLSH 85

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 94.0 bits (232), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 2/77 (2%)

Query: 9   RNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQK 68
           +++ +  S  + T+  T + F   F GQ+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ 
Sbjct: 31  QSSMLLNSPPMKTMSLTALGF--GFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQG 88

Query: 69  SKILKDRKEKGRWYLSH 85
           SKILK RK KGRW+LSH
Sbjct: 89  SKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 93.2 bits (230), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 49/57 (85%)

Query: 29  FILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           F   F GQ+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ SKILK RK KGRW+LSH
Sbjct: 49  FGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.4 bits (228), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/76 (65%), Positives = 56/76 (73%), Gaps = 7/76 (9%)

Query: 10  NTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKS 69
           N+S  K++ L T       F   F  Q+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ S
Sbjct: 37  NSSPLKTMSLTT-------FGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89

Query: 70  KILKDRKEKGRWYLSH 85
           KILK RK KGRW+LSH
Sbjct: 90  KILKRRKLKGRWFLSH 105

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 92.0 bits (227), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 44/56 (78%), Positives = 49/56 (87%)

Query: 30  ILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           IL    Q+RWKSRGNTYQPSTLKRKR+ GFL+RAK+KQ SKILK RKEKGRWYL+H
Sbjct: 56  ILLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 91.3 bits (225), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 55/73 (75%), Gaps = 2/73 (2%)

Query: 13  IFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKIL 72
           +  S  L T   T + F L   GQ+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ SKIL
Sbjct: 35  LLNSSPLKTPSFTPLGFGL--IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKIL 92

Query: 73  KDRKEKGRWYLSH 85
           K RK KGRW+LSH
Sbjct: 93  KRRKLKGRWFLSH 105

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 91.7 bits (226), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 5/88 (5%)

Query: 3   PIIKTNRNTSIFKSVILNTVQ-----STNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKF 57
           P+   +   S+F++      +     S+ +F  L  F Q+RWKSRGNTYQPSTLKRKR+ 
Sbjct: 25  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRV 84

Query: 58  GFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           GFL+RAKSKQ  K+LK R+EKGRWYL+H
Sbjct: 85  GFLARAKSKQGYKVLKRRREKGRWYLTH 112

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 90.5 bits (223), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 61/85 (71%), Gaps = 9/85 (10%)

Query: 10  NTSIFK------SVILNTVQSTNVF--FILPFFG-QKRWKSRGNTYQPSTLKRKRKFGFL 60
           ++SIF+      SV L    +TN F   I    G Q+RWKSRGNTYQPSTLKRKRKFGFL
Sbjct: 28  SSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFL 87

Query: 61  SRAKSKQKSKILKDRKEKGRWYLSH 85
           +RA+S+  SKIL+ RK KGRWYLSH
Sbjct: 88  ARARSRSGSKILERRKAKGRWYLSH 112

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 90.9 bits (224), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 54/72 (75%), Gaps = 2/72 (2%)

Query: 16  SVILNTVQSTNVFFILPFFG--QKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILK 73
           S+   +  S    ++   FG  QKRWKSRGNTYQPSTLKRKR+ GFL+R KSKQ SKILK
Sbjct: 59  SIATGSSSSAMPSYLSSLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILK 118

Query: 74  DRKEKGRWYLSH 85
            R+EKGRWYL+H
Sbjct: 119 RRREKGRWYLTH 130

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
          similarities with uniprot|Q04598 Saccharomyces
          cerevisiae YDR115w
          Length = 98

 Score = 88.6 bits (218), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 16 SVILNTVQSTNVFF-ILPFFG-QKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILK 73
          S+I N + S   F  IL  F  Q+RWKSRGNTYQPSTLKRKRKFGFL+R  +K+ +KI+K
Sbjct: 27 SLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIK 86

Query: 74 DRKEKGRWYLSH 85
           RKEKGRWYL+H
Sbjct: 87 RRKEKGRWYLTH 98

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 87.8 bits (216), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)

Query: 23  QSTNVFFILPF-FGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRW 81
           QS  +  +LPF   Q+RWKSRGNTYQPSTLKRKRKFGFL++A+  QK KILK R+ KGRW
Sbjct: 52  QSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRW 111

Query: 82  YLSH 85
           YL+H
Sbjct: 112 YLTH 115

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 87.0 bits (214), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 6/83 (7%)

Query: 3   PIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSR 62
           P+  +  NTS+      +T Q  +V  ++    Q+RWKSRGNT+QPSTLKRKR+ GFL+R
Sbjct: 33  PLATSAANTSV------STFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLAR 86

Query: 63  AKSKQKSKILKDRKEKGRWYLSH 85
           A+SK   KILK RKEKGRWYL++
Sbjct: 87  ARSKTGQKILKRRKEKGRWYLTY 109

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 86.7 bits (213), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%)

Query: 36  QKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           Q+RWKSRGNTYQPSTLKRKR+ GFL+RA+SKQ +KIL+ RK KGRWYL+H
Sbjct: 55  QRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
          Anc_8.267 YDR115W
          Length = 86

 Score = 85.9 bits (211), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 45/49 (91%)

Query: 37 KRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
          +RWKSRGNTYQPSTLKRKRKFGFL+R ++  +SK+LK RKEKGRWYLSH
Sbjct: 38 RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 87.4 bits (215), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 1/55 (1%)

Query: 32  PFF-GQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           PF   QKRWKSRGNTYQPSTLKRKRK+GFLSR + +Q SKILK RK KGRW+LSH
Sbjct: 87  PFMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
          similar to uniprot|Q04598 Saccharomyces cerevisiae
          YDR115W
          Length = 97

 Score = 84.7 bits (208), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 34 FGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           GQ+RWKSRGNT+QPSTLKRKR+ GFL+RA+SKQ SKIL+ RK KGRW+L+H
Sbjct: 46 MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 84.7 bits (208), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%)

Query: 26  NVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
           ++  +L    QKRWKSRGNTYQPSTLKRKR+ GFL+RA+S+    ILK R+EKGRWYL+H
Sbjct: 71  SMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON}
          Anc_8.267 YDR115W
          Length = 94

 Score = 81.6 bits (200), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%)

Query: 33 FFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85
              +RWKSRGNTYQPSTLKRKRK GFLSRAKS   +KILK RK KGRW+LSH
Sbjct: 42 MIDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 80.9 bits (198), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 51/62 (82%), Gaps = 1/62 (1%)

Query: 25  TNVFFILPF-FGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYL 83
           +++  + PF   Q+RWKSRGNT+QPSTLKRKR+ GFL+RA+SK  S++L+ RK KGRWYL
Sbjct: 49  SSISLLFPFGIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYL 108

Query: 84  SH 85
           ++
Sbjct: 109 TY 110

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 50/61 (81%)

Query: 25  TNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLS 84
           +++F +L    Q+RWKSRGNT+QPSTLKRKR+ GFL+RA+S+   +ILK RK KGRWYL+
Sbjct: 56  SSIFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLT 115

Query: 85  H 85
           +
Sbjct: 116 Y 116

>KAFR0F00230 Chr6 complement(58626..61637) [3012 bp, 1003 aa] {ON}
           Anc_2.38 YDL231C
          Length = 1003

 Score = 31.2 bits (69), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 27  VFFILPFFGQKRWKSRGNTYQPST-LKRKRKFGFLSRAKSKQKS 69
           +F +   F   R ++R   Y PST L RKR F +LS+ K  Q+S
Sbjct: 915 IFVLYILFNSFRSENRIPMYLPSTILARKRLFAYLSKIKRSQES 958

>KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa] {ON}
            Anc_4.173 YLR342W
          Length = 1877

 Score = 28.9 bits (63), Expect = 1.4,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 13   IFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQ---KS 69
            IF   + N  Q +   F L +    RW SRGN    +   R    GF+  ++S+    K 
Sbjct: 1484 IFSPFLFNPHQFSREDFFLDYRDFIRWLSRGN----NKYHRNSWIGFVRMSRSRITGFKR 1539

Query: 70   KILKDRKEKG 79
            K+  D  EKG
Sbjct: 1540 KLTGDDSEKG 1549

>CAGL0G01034g Chr7 (93468..99059) [5592 bp, 1863 aa] {ON} highly
            similar to uniprot|P40989 Saccharomyces cerevisiae
            YGR032w GSC2 or uniprot|P38631 Saccharomyces cerevisiae
            YLR342w FKS1
          Length = 1863

 Score = 28.9 bits (63), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 13   IFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQ---KS 69
            +F   I N  Q +   F L +    RW SRGN    S   R    G++  A+S+    K 
Sbjct: 1470 LFSPFIFNPHQFSWEDFFLDYRDYIRWLSRGN----SKYHRNSWIGYVRMARSRITGFKR 1525

Query: 70   KILKDRKEKG 79
            K++ D  EK 
Sbjct: 1526 KLVGDESEKA 1535

>KLTH0F16808g Chr6 (1360799..1361917) [1119 bp, 372 aa] {ON}
          similar to uniprot|P04803 YDR268W Saccharomyces
          cerevisiae MSW1 Mitochondrial tryptophanyl-tRNA
          synthetase
          Length = 372

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 6  KTNRNTSIFKSVILNTVQSTNVFFILPFFGQKR-WKSRGNTYQPST 50
          K N N    KSVI + VQ T  F +  + G  R WK   +  QP T
Sbjct: 24 KLNANDVPNKSVIFSMVQPTGKFHLGNYLGSVRVWKDLCDLKQPET 69

>Skud_7.141 Chr7 complement(266063..270280) [4218 bp, 1405 aa] {ON}
           YGL131C (REAL)
          Length = 1405

 Score = 28.1 bits (61), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 1   MLPIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPS-TLKRKRKF 57
           + P++K       F  VIL  + STN   +  F   KR  SR +  +P+ T +  RKF
Sbjct: 511 LCPVLKVRGEICNFIDVILKNLLSTNYDTVAAFEKSKRELSRESLNEPTFTTEEIRKF 568

>KLTH0G17754g Chr7 complement(1534396..1540092) [5697 bp, 1898 aa]
            {ON} highly similar to uniprot|P40989 Saccharomyces
            cerevisiae YGR032W GSC2 or uniprot|P38631 Saccharomyces
            cerevisiae YLR342W FKS1
          Length = 1898

 Score = 28.1 bits (61), Expect = 2.4,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 13   IFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQ---KS 69
            +F   I N  Q +   F L +    RW SRGN    +   R    G++  ++S+    K 
Sbjct: 1499 MFSPFIFNPHQFSWQDFFLDYRDFIRWLSRGN----NKYHRNSWIGYVRMSRSRVTGFKR 1554

Query: 70   KILKDRKEKG 79
            K++ D  EKG
Sbjct: 1555 KLVGDESEKG 1564

>Suva_7.132 Chr7 complement(257924..262132) [4209 bp, 1402 aa] {ON}
           YGL131C (REAL)
          Length = 1402

 Score = 27.3 bits (59), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 1   MLPIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPS-TLKRKRKF 57
           + P++K    T  F  VIL  + STN      F   KR  SR +  +P+ T++   KF
Sbjct: 508 LCPVLKVKGETCNFIDVILKNLLSTNYDTAEAFEKSKRELSRESLNEPTFTVEEIHKF 565

>NCAS0A02040 Chr1 (387566..393079) [5514 bp, 1837 aa] {ON} Anc_4.173
          Length = 1837

 Score = 27.3 bits (59), Expect = 5.3,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 13   IFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQ---KS 69
            +F   I N  Q +   F L +    RW SRGN    S   +    G++  ++S+    K 
Sbjct: 1448 LFSPFIFNPHQFSWQDFFLDYRDFIRWLSRGN----SKYHKNSWIGYIRMSRSRITGFKR 1503

Query: 70   KILKDRKEKG 79
            K+  D  EKG
Sbjct: 1504 KLTGDESEKG 1513

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,221,936
Number of extensions: 345793
Number of successful extensions: 1419
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1419
Number of HSP's successfully gapped: 36
Length of query: 85
Length of database: 53,481,399
Length adjustment: 57
Effective length of query: 28
Effective length of database: 46,945,437
Effective search space: 1314472236
Effective search space used: 1314472236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)