Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B054808.268ON28028014670.0
KLLA0F19272g8.268ON2662627269e-96
TPHA0J007708.268ON2782757149e-94
SAKL0H16896g8.268ON2852517011e-91
NCAS0B038108.268ON3142907022e-91
KNAG0H032108.268ON2852436974e-91
YDR116C (MRPL1)8.268ON2852496922e-90
Smik_4.3608.268ON2852616888e-90
Ecym_43028.268ON2752446852e-89
KLTH0G13552g8.268ON2812466844e-89
Kwal_56.237758.268ON2812446826e-89
Skud_4.3768.268ON2852666828e-89
Suva_2.2758.268ON2852606829e-89
ZYRO0C01518g8.268ON2772776741e-87
NDAI0J013308.268ON3142456752e-87
AGR080W8.268ON2752696695e-87
Kpol_392.38.268ON2812526662e-86
TDEL0F039508.268ON2762546443e-83
CAGL0B01815g8.268ON2902705803e-73
TBLA0I031908.268ON2412264162e-49
TBLA0H002602.404ON307146693.0
Smik_16.375.31ON196749676.1
NCAS0E040605.31ON195995668.1
Kpol_538.477.7ON948114668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05480
         (280 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   569   0.0  
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   284   9e-96
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   279   9e-94
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   274   1e-91
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   275   2e-91
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   273   4e-91
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   271   2e-90
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   269   8e-90
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   268   2e-89
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   268   4e-89
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   267   6e-89
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   267   8e-89
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   267   9e-89
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   264   1e-87
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   264   2e-87
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   262   5e-87
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   261   2e-86
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   252   3e-83
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   228   3e-73
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   164   2e-49
TBLA0H00260 Chr8 complement(40021..40944) [924 bp, 307 aa] {ON} ...    31   3.0  
Smik_16.37 Chr16 complement(59747..65650) [5904 bp, 1967 aa] {ON...    30   6.1  
NCAS0E04060 Chr5 (797097..802976) [5880 bp, 1959 aa] {ON} Anc_5.31     30   8.1  
Kpol_538.47 s538 (110071..112917) [2847 bp, 948 aa] {ON} (110071...    30   8.2  

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/280 (100%), Positives = 280/280 (100%)

Query: 1   MNFLRVRGPTLPNLLFGTRSLQTSRLWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQARE 60
           MNFLRVRGPTLPNLLFGTRSLQTSRLWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQARE
Sbjct: 1   MNFLRVRGPTLPNLLFGTRSLQTSRLWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQARE 60

Query: 61  PASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNS 120
           PASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNS
Sbjct: 61  PASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNS 120

Query: 121 KVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNL 180
           KVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNL
Sbjct: 121 KVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNL 180

Query: 181 GKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENI 240
           GKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENI
Sbjct: 181 GKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENI 240

Query: 241 IATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280
           IATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI
Sbjct: 241 IATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  284 bits (726), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 138/262 (52%), Positives = 192/262 (73%), Gaps = 3/262 (1%)

Query: 18  TRSLQTSRLWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRF 77
           TR  Q +   L E +   +K  K+Q +K+ LR  ++ R QA+ PAS+HPLYM V  ALR+
Sbjct: 7   TRQFQITSFRLAEET--GTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRY 64

Query: 78  LRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQD 137
           LRA+EVGQP SQQTITLTTLV++E+GVPP+ GNV    PL++ KV V ++D  +   ++D
Sbjct: 65  LRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKD 124

Query: 138 NFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGT 197
            + +VHLVGG +LV + K  ++ IDFDK  ATPDI+      +G++ GP+GLLP  KKGT
Sbjct: 125 KY-SVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGT 183

Query: 198 VSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTK 257
           V+E+L  L+ +++SS+PFRQR   ISLG+ K  F+DK++LEN++AT++AF  +++NQ+TK
Sbjct: 184 VAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTK 243

Query: 258 KQSTLGKTTLTSTHGPGIVIDF 279
           K S L +TTLTSTHGPGIVIDF
Sbjct: 244 KPSILSQTTLTSTHGPGIVIDF 265

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  279 bits (714), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 196/275 (71%), Gaps = 10/275 (3%)

Query: 13  NLLFGTR--SLQTSRLWLEEASVAP------SKTNKQQAKKKMLRDFLRSRKQAREPASN 64
           N L  TR  +   SR+  EE + A       SK +K Q KK+ LR F   +++A+ PA++
Sbjct: 5   NFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATS 64

Query: 65  HPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVV 124
           HPLYM+VP ALRFLRA EVGQP SQQTI LTTLV+SEKG P + G++   TPL+  K+ +
Sbjct: 65  HPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAI 124

Query: 125 LSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMF 184
            ++D  +++  ++ F N ++VGG EL+ K KN +IE+DFDK  ATPDI+     ++ ++ 
Sbjct: 125 FTNDETQMKIAKEKF-NCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELG-SVARIL 182

Query: 185 GPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATR 244
           GP+G+ P++KKGTVSEN+ +L+  N+ S+PFRQ   CIS+ IGK  FSD+QILEN+I+ R
Sbjct: 183 GPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVR 242

Query: 245 EAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDF 279
           +AF +++S QKTKK S LGKT L++THGPGIVIDF
Sbjct: 243 KAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  274 bits (701), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 133/251 (52%), Positives = 184/251 (73%), Gaps = 1/251 (0%)

Query: 29  EEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRS 88
           EE S   +K +K Q K++ LR  ++ +  AR+PA++HPLYM V  ALRFLRA EVGQP+S
Sbjct: 35  EEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQS 94

Query: 89  QQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGR 148
           QQTI+LTTLVISE+G P + GN+  P PL++ K+ V ++D  KL+  +D F N HLVGG 
Sbjct: 95  QQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQF-NCHLVGGS 153

Query: 149 ELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNE 208
           EL++K K  ++ +DFDK  ATPDI       LG++ GP+GLLPN KKGTV+E++  L+ +
Sbjct: 154 ELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKD 213

Query: 209 NVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLT 268
           ++ ++PFRQR  CIS+ + K  F+D Q+LENI+A +++F   L+NQK KK S LG+TTLT
Sbjct: 214 SMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLT 273

Query: 269 STHGPGIVIDF 279
           +THGPG+VIDF
Sbjct: 274 TTHGPGLVIDF 284

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  275 bits (702), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 144/290 (49%), Positives = 195/290 (67%), Gaps = 12/290 (4%)

Query: 2   NFLRVRGPTLPNLLFGTRS---LQTSRLWLEEA-SVAPSKT-------NKQQAKKKMLRD 50
           N + +RG  L      ++S     TS +  EEA S   S T       +K+Q KK+ LR 
Sbjct: 26  NRVPIRGGLLAQCTSSSQSRGIHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRR 85

Query: 51  FLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGN 110
             + + +A+ PAS HPLYM V +ALR++RA EVG+P  QQTITLT+LV++EKGV P+ G+
Sbjct: 86  LSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGH 145

Query: 111 VQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATP 170
           + LP PL+  KV V S + + L  +++ + + HLVGG EL++K KN +++ DFDK  A+ 
Sbjct: 146 ISLPRPLKALKVAVFSQNEELLTRMKEKY-HCHLVGGVELINKIKNGEVKTDFDKAFASS 204

Query: 171 DILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVE 230
           D+ N  +  LGK  G +GLLPN KKGTVS++L  L+ + + S+PFRQ   CIS+GIGK  
Sbjct: 205 DMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCH 264

Query: 231 FSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280
           FSD++IL NIIA R A +  LS QK+KK S LGKTTL+STHGPGIVIDFI
Sbjct: 265 FSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI 314

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  273 bits (697), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 178/243 (73%), Gaps = 1/243 (0%)

Query: 37  KTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTT 96
           K  K+Q +++ LR  +RS+  A+ PAS   +Y+ VP+A+R LRAVEVGQP SQQTITLTT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 97  LVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKN 156
           +V+SEKGVPP++G+V LPTPL+  ++   S DP+ L+ +Q+  + + +VGG EL+D+ K+
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVE-LEIVGGAELIDQLKS 161

Query: 157 EDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFR 216
            ++ + FDK  ATPDI    N  LG + G +GLLPN+KKGTV  +L+ ++   V +MPFR
Sbjct: 162 GEVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFR 221

Query: 217 QRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIV 276
           QRA  ++ GI K  FSD+Q+L N+IA REAF   + NQK+KK+S LG++TL+STHGPGIV
Sbjct: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281

Query: 277 IDF 279
           ID 
Sbjct: 282 IDL 284

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  271 bits (692), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 31  ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQ 90
           +S APS T K QAKK+ L+  ++ + +A+ PA+  PLYM V  ALR+LRA EVG+P+SQQ
Sbjct: 38  SSNAPSLT-KDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQ 96

Query: 91  TITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGREL 150
           TI LTTLV+ E+G  P+ G+V  P PLR  K+   ++D  KLEE+++ + N HL+GG +L
Sbjct: 97  TINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPN-HLIGGADL 155

Query: 151 VDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENV 210
           V K K+ +I +DFDK  ATPDI+      + ++ GP+G+LP+VKKGTVS+++  L+ E++
Sbjct: 156 VAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESL 215

Query: 211 SSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTST 270
            SMPFRQR   IS+G+GK  F+D++IL+NII+ R AF   + NQK+KK + L KTTL+ST
Sbjct: 216 GSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSST 275

Query: 271 HGPGIVIDF 279
           HGPGIVIDF
Sbjct: 276 HGPGIVIDF 284

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  269 bits (688), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 187/261 (71%), Gaps = 8/261 (3%)

Query: 25  RLWLEE------ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFL 78
           +L+ EE      +S APS T K QAKK+ L+   + + +A+ PA+ +PLYM V  ALR+L
Sbjct: 26  KLYAEEYKPTAMSSNAPSLT-KDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYL 84

Query: 79  RAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDN 138
           RA EVG+P+SQQTI LTTLV+ E+G  P+ G+V  P PLR  KV   ++D  KLEE++  
Sbjct: 85  RAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKK 144

Query: 139 FKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTV 198
           + N HL+GG +LV + K+ +I +DFDK  ATPDI+      + ++ GP+G+LP++KKGTV
Sbjct: 145 YPN-HLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTV 203

Query: 199 SENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKK 258
           S+++  L+ E++ SMPFRQR   ISLG+GK  FSD++IL+NII+ R AF   ++NQK+KK
Sbjct: 204 SDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKK 263

Query: 259 QSTLGKTTLTSTHGPGIVIDF 279
            + L KTTL+STHGPGIVIDF
Sbjct: 264 PNLLSKTTLSSTHGPGIVIDF 284

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  268 bits (685), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 176/244 (72%), Gaps = 1/244 (0%)

Query: 36  SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLT 95
           +K +K+Q KKK LR  L+ R  A++    HPLYM V  A RFLRA EVGQP SQQTI+LT
Sbjct: 32  TKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLT 91

Query: 96  TLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFK 155
           T+V+S+KG P + GN+  P PLR+ KV V +++ ++ E  ++ FK  HLVGG EL++  K
Sbjct: 92  TVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFK-CHLVGGTELIEAIK 150

Query: 156 NEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPF 215
           N D  IDFDK +ATPD++      L  + GP+ LLP VKKGTVSEN+  L+ EN+ ++PF
Sbjct: 151 NGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPF 210

Query: 216 RQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGI 275
           RQR   +S+ +GK +FSDKQ+L+NI+A ++AF   L++Q+ KK S LGKTT+TSTHGPGI
Sbjct: 211 RQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGI 270

Query: 276 VIDF 279
           VIDF
Sbjct: 271 VIDF 274

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  268 bits (684), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 175/246 (71%), Gaps = 1/246 (0%)

Query: 34  APSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTIT 93
           A SK +K Q KK+ +R F + +  AR PAS HPLYM V  ALRFLRA EVGQP+SQQT++
Sbjct: 36  ATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLS 95

Query: 94  LTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDK 153
           +TT+VISE+G P + GNV  P  L+  K+ V ++D ++ +  ++ F N H+VGG ELV+K
Sbjct: 96  VTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKF-NCHVVGGSELVEK 154

Query: 154 FKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSM 213
            K   + +DFDK  ATP+I       LG++ GP+GLLP  KKGTVSENL  L+ +++ ++
Sbjct: 155 IKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTL 214

Query: 214 PFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGP 273
           PFRQR   IS+ +G+  F+DKQ+LENI+A +++    L+NQK KK S LG+TTLTST GP
Sbjct: 215 PFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGP 274

Query: 274 GIVIDF 279
           GIVIDF
Sbjct: 275 GIVIDF 280

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  267 bits (682), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 36  SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLT 95
           SK +K Q +K+ +R   + +  AR PA++HPLYM V  ALRFLRA E GQP SQQT+++T
Sbjct: 38  SKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVT 97

Query: 96  TLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFK 155
           T+VISE+G PP+ GN+  P PL++ K+ V ++D ++ +  ++ F   HLVGG +LV+K K
Sbjct: 98  TIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKF-GCHLVGGSDLVEKIK 156

Query: 156 NEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPF 215
              + +DFDK  ATP+I       LG++ GP+GLLP  KKGTV+ENL  L+  ++ ++PF
Sbjct: 157 EGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPF 216

Query: 216 RQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGI 275
           RQR   +S+ +GK  F+DKQ+LENI+A ++     L+ QKTKK S LG+TTLTSTHGPGI
Sbjct: 217 RQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGI 276

Query: 276 VIDF 279
           VIDF
Sbjct: 277 VIDF 280

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  267 bits (682), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 138/266 (51%), Positives = 191/266 (71%), Gaps = 8/266 (3%)

Query: 20  SLQTSRLWLEE------ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPD 73
           S   S+L+ EE      +S APS T K+QAKK+ L+   + R +A+ PA+ +PLYM V  
Sbjct: 21  SHTASKLYAEEYKSTAMSSNAPSLT-KEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTV 79

Query: 74  ALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLE 133
           ALR+LRA EVG+P+SQQTI LTTLV+ E+G  P+ G+V  P PLR  KV V ++D  KL+
Sbjct: 80  ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLK 139

Query: 134 EVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNV 193
           E+++ + N HL+GG +LV + KN +I +DFDK  AT DI+      + ++ GP+G+LP+V
Sbjct: 140 ELREKYPN-HLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSV 198

Query: 194 KKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSN 253
           KKGTVS+++  L+ E++ SMPFRQR   ISLGIGK  F+D+++L+NIIA R AF   +S+
Sbjct: 199 KKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSD 258

Query: 254 QKTKKQSTLGKTTLTSTHGPGIVIDF 279
           QK+KK + L KTTL+STHGPGIVIDF
Sbjct: 259 QKSKKPNILSKTTLSSTHGPGIVIDF 284

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  267 bits (682), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 181/260 (69%), Gaps = 6/260 (2%)

Query: 25  RLWLEEASVAPSKTN-----KQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLR 79
           +L+ EE   A   +N     K QAKK+ L+   + R +A+ PA+  PL+M V  ALR+LR
Sbjct: 26  QLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLR 85

Query: 80  AVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNF 139
           A EVG+P+SQQTI LTTLV+ E+G  P+ GNV    PLR  KV V ++D  KL+E+++ +
Sbjct: 86  AAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKY 145

Query: 140 KNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVS 199
            N+ +VGG +LV K KN +  +DFDK  ATPDI+      + ++ GP+G+LP+VKKGTVS
Sbjct: 146 PNL-IVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVS 204

Query: 200 ENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQ 259
           +++  L+ E++ SMPFRQR   ISLGIGK  F+D+++L+NII+ R AF   + NQK KK 
Sbjct: 205 DDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKP 264

Query: 260 STLGKTTLTSTHGPGIVIDF 279
           S L KTTL+STHGPGIVIDF
Sbjct: 265 SLLSKTTLSSTHGPGIVIDF 284

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  264 bits (674), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 130/277 (46%), Positives = 186/277 (67%), Gaps = 10/277 (3%)

Query: 9   PTLPNLLFGTRSLQTSRLWLEEASV-----APSKTNKQQAKKKMLRDFLRSRKQAREPAS 63
           P+L + L G+    TSR     A++     A SK  K+Q +K+ +R   R + +A++PA 
Sbjct: 6   PSLRSQLLGS----TSRCLFHTAALLRAEEAGSKLTKEQLRKREVRRAARRKVEAKKPAH 61

Query: 64  NHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVV 123
            HPLYM  P ALR+LRAVEVG P SQQ IT+TT V++++G PP+ GNV LP+PL++  V 
Sbjct: 62  THPLYMPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVA 121

Query: 124 VLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKM 183
           V S+D ++L   +D F+  HLVGG +++ K K  +I +DFDK  ATPDI       + ++
Sbjct: 122 VFSNDEQQLSMARDKFR-CHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARI 180

Query: 184 FGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIAT 243
            GPK +LP  K+GTV+ +L  L+ ++  S+PFRQ+   ISL + K EFSD+Q+LEN++A 
Sbjct: 181 LGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAV 240

Query: 244 REAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280
           + AF   +SNQK K+ S LG+TTLT+THGPGIVID +
Sbjct: 241 QTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV 277

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  264 bits (675), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 36  SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLT 95
           +K +K+Q KK+ +R   + ++QAR+PA++HPLYM+V DALRF+RA EVG+P  QQTITLT
Sbjct: 71  TKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLT 130

Query: 96  TLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFK 155
           TL++SEKG   + GN++L  PL+  K+ V S D + LEEV+  F N  LVGG E V+  K
Sbjct: 131 TLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQF-NCQLVGGNETVEGIK 189

Query: 156 NEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPF 215
           +  I  +FD   ATP+I+ + N  LGK  G +G+LPN KKGTVS++L+ LMN  + ++PF
Sbjct: 190 DGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPF 249

Query: 216 RQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGI 275
           +Q    IS+ IGK  FSDK IL NIIA R+AF   L+NQK K+ S L KTTL+STHGPGI
Sbjct: 250 KQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGI 309

Query: 276 VIDFI 280
           VIDF+
Sbjct: 310 VIDFV 314

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  262 bits (669), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 137/269 (50%), Positives = 188/269 (69%), Gaps = 2/269 (0%)

Query: 13  NLLFGTRSLQTSRLWL-EEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKV 71
            LL   R L  + + L +EA+   SK +K Q KK+ LR   + +  AR PAS  PLYM V
Sbjct: 7   GLLSFRRGLHLTAVQLSQEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPV 66

Query: 72  PDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKK 131
             ALRFLRA EVGQP +QQTI++ T+VI +KG   + G V LP+P+R +KV V ++DP++
Sbjct: 67  QQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQ 126

Query: 132 LEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLP 191
            E  +  +   +LVGG ELV++ K+ ++++DFDK  ATPDI       LG++ GPKGLLP
Sbjct: 127 AETARTKY-GCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLP 185

Query: 192 NVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTL 251
           +VKKGTV+ +L EL+ ++++S PF+QR  CISL IGK  FSD+QI+EN++A + AF   +
Sbjct: 186 SVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAM 245

Query: 252 SNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280
           ++QKTKK S  G TTLTSTHGPGIVIDF+
Sbjct: 246 TSQKTKKTSLFGTTTLTSTHGPGIVIDFL 274

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  261 bits (666), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 178/252 (70%), Gaps = 2/252 (0%)

Query: 29  EEASVAP-SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPR 87
           E AS  P SK+ K + K++ LR   + +  AR+PAS++PLYM +  ALR+LRA EVGQP 
Sbjct: 30  ETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPI 89

Query: 88  SQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGG 147
           SQQ IT+TT V+SE+G   + GN+   TP+++ K+ V S+DP+KL ++++   N HL+GG
Sbjct: 90  SQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEH-NCHLIGG 148

Query: 148 RELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMN 207
            +LV+K K+    +DFDK  ATPDI       L ++ GP+G+LP +KKGTVSE++  L+ 
Sbjct: 149 TDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIK 208

Query: 208 ENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTL 267
            ++  MPFRQ    IS+ +G+  FSDKQILENIIA R A+  TLS+QK+KK S LGKTT+
Sbjct: 209 GSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTLSSQKSKKPSLLGKTTI 268

Query: 268 TSTHGPGIVIDF 279
           TSTHGPGI IDF
Sbjct: 269 TSTHGPGITIDF 280

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  252 bits (644), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 180/254 (70%), Gaps = 1/254 (0%)

Query: 26  LWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQ 85
           L  EEA+   SK +K Q KK+ +R   + +  A++  S+HPLYM +P ALRFLRA EVGQ
Sbjct: 23  LRAEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFLRAAEVGQ 82

Query: 86  PRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLV 145
           P++QQTITLTT V++E+GVP + G+V  P PL+  K+ V S D  +L+  ++ F N HLV
Sbjct: 83  PQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREKF-NCHLV 141

Query: 146 GGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIEL 205
           GG E+++K K+ +I +DFDK  ATPDI       L ++ GP+G+LP VKKGTV+ ++  L
Sbjct: 142 GGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVATDVSRL 201

Query: 206 MNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKT 265
           + +++ SMPFRQR   IS+ +GK  FSD+QILEN IAT +A    L+NQ +KK S LGKT
Sbjct: 202 VQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKTSLLGKT 261

Query: 266 TLTSTHGPGIVIDF 279
           TL+STHGPGIVIDF
Sbjct: 262 TLSSTHGPGIVIDF 275

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  228 bits (580), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 175/270 (64%), Gaps = 7/270 (2%)

Query: 15  LFGTRSLQTSRLWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDA 74
           LFG R L T          A     K+QAKK+ ++     + +A++PA+ HPLYM +P A
Sbjct: 22  LFGRRLLATE--AAPIPQAAAPTLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLA 79

Query: 75  LRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEE 134
           LR+LR+ EVG+P   QTIT+TTLV+++KG   + GN+  P PL+  K+ + S + +KL+E
Sbjct: 80  LRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDE 139

Query: 135 VQDNF-KNVHLVGGRELVDKFKNEDIEID-FDKVVATPDILNYTNQNLGKMFGPKGLLPN 192
           ++  + K V + GG +++   K+  I++D  +KV ATP+I       LG++ GPKGL+PN
Sbjct: 140 LKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPN 199

Query: 193 VKK---GTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLN 249
           +KK    TV E+L  L+ EN+  + FRQR   +S+ +G+  FSD+ ILENIIA R AF  
Sbjct: 200 LKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQ 259

Query: 250 TLSNQKTKKQSTLGKTTLTSTHGPGIVIDF 279
           ++S+Q  KK S LGKTT+++T GPGIVIDF
Sbjct: 260 SVSSQVAKKPSILGKTTISTTAGPGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  164 bits (416), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 139/226 (61%), Gaps = 9/226 (3%)

Query: 57  QAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTP 116
           +AR  + NHPL M+VP ALR+LRA+E G+  S+QT+TL T+V + +G  P+ G +     
Sbjct: 21  KARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHML 80

Query: 117 LRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYT 176
           +R   + V ++DP++ +  ++    + ++GG EL+DK  + + +I F    AT D++   
Sbjct: 81  IRKPVIAVFTEDPEQHKIAKE--MGIDIIGGSELIDKIASGEQKITFQTAFATTDMV--- 135

Query: 177 NQNLGKM---FGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSD 233
            Q+L ++    G + +LP +KK TV +N+ EL+ + +  +PF ++A  IS  +GK  F+D
Sbjct: 136 -QDLARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTD 194

Query: 234 KQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDF 279
           ++IL N+I  RE     L  Q  KK ST+ K TLTSTHGPGI ID 
Sbjct: 195 EEILRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>TBLA0H00260 Chr8 complement(40021..40944) [924 bp, 307 aa] {ON}
           Anc_2.404 YMR130W
          Length = 307

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 21/146 (14%)

Query: 144 LVGGRELVDKFKNEDIEIDFDKVVA--TPDILNYTNQNLGKMFGPKGLLPNVKKGTVSEN 201
           L+G   L   F +EDI + +D  ++   P+I NY   ++ + +      P++KK  V  +
Sbjct: 152 LLGNLGLYKFFDSEDIYLSYDLDISKPNPEIFNYCFNDICRRY------PHLKKVGVPCD 205

Query: 202 LIELMNENVSSMP---FR--QRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKT 256
            ++ +  ++   P   F   Q +G  S+ I + +      L  I A  +  LN   N  T
Sbjct: 206 QLKKLFWHIGDEPKNDFEGSQLSGWSSILINRFD------LPGISANPKVTLNYKKNLST 259

Query: 257 KKQSTLGKTTLT--STHGPGIVIDFI 280
              + + ++TLT  S+   G+ + FI
Sbjct: 260 NTDAWVSRSTLTASSSSQKGVEMSFI 285

>Smik_16.37 Chr16 complement(59747..65650) [5904 bp, 1967 aa] {ON}
           YGR271W (REAL)
          Length = 1967

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 28/49 (57%)

Query: 118 RNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKV 166
           + S++ VLS D    +++ D F+N+  V  + ++D +K E+    + K+
Sbjct: 53  QKSELTVLSQDRNDWDDIFDEFQNISFVQLQSVIDSYKKENAVAVYKKI 101

>NCAS0E04060 Chr5 (797097..802976) [5880 bp, 1959 aa] {ON} Anc_5.31
          Length = 1959

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 122 VVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLG 181
           + VLS D    +++ D+F ++     +E+VD +K  + +  + K+         +     
Sbjct: 58  LTVLSQDRNNWDDIYDDFNDISFEKLQEVVDSYKKGNTDSIYKKLYLLAASSTSSLSTDS 117

Query: 182 KMFGPKGLLPNVKKGTVSENLIELM-NENVSSMPF 215
            +     L  N +KG +++ L++L+  EN+  + F
Sbjct: 118 LLESALQLTYNYEKGELAKELLDLVGTENIELLSF 152

>Kpol_538.47 s538 (110071..112917) [2847 bp, 948 aa] {ON}
           (110071..112917) [2847 nt, 949 aa]
          Length = 948

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 18/114 (15%)

Query: 171 DILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVE 230
           D ++  NQNL  + G   LLPN+++  +  N I     ++S +P    +G I L + + +
Sbjct: 590 DAIDLANQNLVSLVGMNELLPNLEEIDLKNNEI----NSLSGLP----SGIIILNMSENK 641

Query: 231 FSDK-------QILENIIATREAF---LNTLSNQKTKKQSTLGKTTLTSTHGPG 274
            S+        Q LE+I  +  A    LN LS+ K  K+  L    + S +G G
Sbjct: 642 LSNNFISLENYQELEDIDLSSNALKFNLNFLSHNKHLKKVNLRYNGVESLNGLG 695

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,542,358
Number of extensions: 1318187
Number of successful extensions: 4844
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4951
Number of HSP's successfully gapped: 45
Length of query: 280
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 172
Effective length of database: 41,097,471
Effective search space: 7068765012
Effective search space used: 7068765012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)