Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B054708.269ON56255327940.0
Suva_2.2768.269ON56556115470.0
YDR117C (TMA64)8.269ON56556214970.0
Skud_4.3778.269ON56257714960.0
Smik_4.3618.269ON56556414690.0
NCAS0B038008.269ON56555814660.0
TDEL0F039608.269ON55855614170.0
ZYRO0C01496g8.269ON56755813970.0
NDAI0J013108.269ON57957413630.0
CAGL0B01837g8.269ON56956913480.0
TPHA0J007808.269ON58357913461e-180
KLTH0G13530g8.269ON57456412821e-171
SAKL0H16874g8.269ON56356012791e-170
Kwal_56.237718.269ON56256112621e-168
Kpol_392.28.269ON56657012201e-162
KNAG0H032008.269ON56156511161e-146
KLLA0F19294g8.269ON57056511091e-145
TBLA0I032008.269ON56357510981e-143
Ecym_43018.269ON56457510551e-137
AGR079W8.269ON5425629961e-128
KAFR0C059505.625ON719111920.017
NCAS0A150607.519ON138687724.0
KNAG0L008207.152ON208187695.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05470
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...  1080   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   600   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   581   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   580   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   570   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   569   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   550   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   542   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   529   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   523   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   523   e-180
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   498   e-171
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   497   e-170
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   490   e-168
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   474   e-162
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   434   e-146
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   431   e-145
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   427   e-143
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   410   e-137
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   388   e-128
KAFR0C05950 Chr3 complement(1185133..1187292) [2160 bp, 719 aa] ...    40   0.017
NCAS0A15060 Chr1 (2966614..2970774) [4161 bp, 1386 aa] {ON} Anc_...    32   4.0  
KNAG0L00820 Chr12 complement(144786..145320,145422..145513) [627...    31   5.4  

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score = 1080 bits (2794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/553 (96%), Positives = 531/553 (96%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
           SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
           STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240
           KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240

Query: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYXX 300
           FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKY  
Sbjct: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYFE 300

Query: 301 XXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGXXXXXXNL 360
                         IIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQG      NL
Sbjct: 301 KEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVSVSSVNL 360

Query: 361 YKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMVN 420
           YKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMVN
Sbjct: 361 YKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMVN 420

Query: 421 RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMKI 480
           RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMKI
Sbjct: 421 RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMKI 480

Query: 481 GRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKKVSEVQVQGPHGQLIIDHFN 540
           GRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKKVSEVQVQGPHGQLIIDHFN
Sbjct: 481 GRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKKVSEVQVQGPHGQLIIDHFN 540

Query: 541 KSGIPSKFIQFEN 553
           KSGIPSKFIQFEN
Sbjct: 541 KSGIPSKFIQFEN 553

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/561 (53%), Positives = 393/561 (70%), Gaps = 12/561 (2%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP IKALS LKNS+RKKL+Q+ K Q  ++E+ +    +I QTNF    + GT+YTD
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQT-NNEEYTFPTSTIKQTNFSGQKSLGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            N+ PI+FK KH++ L+PT +  W N+ LL  V TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 60  ENNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
               IGT+C VA+++AP + +AVGIV+++LP Y +V+G+TGVAV+I+HHF D L   FK 
Sbjct: 120 PRCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKV 179

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPP-----SGSEGPDDIAEVLDELTV 235
           KLE PA+     ++E   D+       QE    TE         +   ++IAEVLD L+V
Sbjct: 180 KLEPPAAFDVASEDE---DIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSV 236

Query: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKF 295
            DVDYFI RALY+T+ QD +L LP+ AS F+SNHIMRNLP +DH +VN+KRTSWKK+AKF
Sbjct: 237 SDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKF 296

Query: 296 LKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIG--NTAKKAASKSDSTQTQGX 353
           LK+                 IVG N DKDELKNFVPYK+G  N+AK+    ++S +    
Sbjct: 297 LKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSG 356

Query: 354 XXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDD 413
                 LYKP NL +  +KE+N+     YTS +IR+ I  YI  KNLVD KDK  V++DD
Sbjct: 357 MMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDD 416

Query: 414 LLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKID 473
           LL+ MVN+K ++P   R+IPRA IL+PL+ANNF E++Q+YK D+T L + P+KG  P+I 
Sbjct: 417 LLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIK 476

Query: 474 IVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQGPHG 532
           I+TEMKIGRKV+T+VSNFE  +I PE LAADLRK+CSGSTTI E+   K +EVQVQGPHG
Sbjct: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHG 536

Query: 533 QLIIDHFNKSGIPSKFIQFEN 553
           QLIIDH NKSG+P+K+I FEN
Sbjct: 537 QLIIDHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/562 (52%), Positives = 383/562 (68%), Gaps = 14/562 (2%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP IKALS LKNS+RKKL+Q+ + Q  ++E+ S    +I QTNF    + GT+YTD
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQ-TNNEEYSFRTSTIKQTNFNGQKSVGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            N+ PI+FK KH + L+PT +  W    LL  V TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 60  ENNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
               IGT+C +A+K+AP+  +A+GIV+L+LP + +V+G+TGVAV+I+HHF D L   FK 
Sbjct: 120 PRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKM 179

Query: 181 KLEIPASVKSILQEETTADVAKESD-----AEQESQSVTEPPSGSEGPDDIAEVLDELTV 235
           KLE P  + +  ++   +    ES       E+E + V E    S   ++IAEVLD  TV
Sbjct: 180 KLEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKE---ASVDVEEIAEVLDHFTV 236

Query: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKF 295
            DVDYFI RALY+T+ QD  L LP+ AS F+SNHIMRNLP +DH +VN+K+TSWKK+AKF
Sbjct: 237 SDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKF 296

Query: 296 LKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDST---QTQG 352
           LK+                 IVG N DKDELKNFVPYK+G +     S+  +T   +T G
Sbjct: 297 LKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSG 356

Query: 353 XXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLD 412
                  LYKP NL +  +KE N++    YTS +IR+ ++ YI  KNL D KDK  V++D
Sbjct: 357 MMYSL-TLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMD 415

Query: 413 DLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKI 472
           DLLF MVN+K +     RII R  IL PL+ NNF E++Q++K D+T LFK P+KG  P I
Sbjct: 416 DLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHI 475

Query: 473 DIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQGPH 531
            I+TEMKIGRKV+TRVSNFE F++ PE LAADLRK+CSGSTTISE+   K +EVQVQGPH
Sbjct: 476 KIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPH 535

Query: 532 GQLIIDHFNKSGIPSKFIQFEN 553
           GQ IIDH NK GIPSK+I FEN
Sbjct: 536 GQSIIDHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/577 (50%), Positives = 393/577 (68%), Gaps = 33/577 (5%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP IKALS LKNS+RKKL+Q+ K Q  +DE  +    +I QTNF S  + G +YTD
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDE-YTFPTSTIKQTNFCSQKSVGVVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            N+ PI+FK KH++ L+PT +  W N  LL  + TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 60  ENNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
               +GT+C VA++EAP V +A+GIV+++LP Y +VLG+TGVAV+++HHF D L    K 
Sbjct: 120 PRSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKV 179

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSE--------------GPDDI 226
           KL+ P              +AK  D +  S+ V +PP  ++                +++
Sbjct: 180 KLDPP--------------IAKSGDEDINSKQV-QPPEEAKIVENAQENMQKAQVHVEEL 224

Query: 227 AEVLDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKR 286
           AEVLD  +V DVDYFI RALY+T+ QD +L LP+  S F+SNHIMRNLP +DH +VN+K+
Sbjct: 225 AEVLDHFSVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKK 284

Query: 287 TSWKKTAKFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNT--AKKAASK 344
           TSW+K+AKFLK+                 IVG   DKDELKNFVPYK+G++  A+++   
Sbjct: 285 TSWRKSAKFLKHFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEH 344

Query: 345 SDSTQTQGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEK 404
           ++S +          LYKP ++ + F+KE+N+     YTS +IR+ ++ YI   NL D K
Sbjct: 345 ANSKEKTPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTK 404

Query: 405 DKKMVMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNP 464
           DK  V++DDLLF MVN+K +N    RI+PRA IL+PL+ANNF E++Q++K D++ LFK P
Sbjct: 405 DKGKVVMDDLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAP 464

Query: 465 IKGQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVS 523
           IKG  P+I I TEMKIGRKV+TRVSNFE F+I PE LA DLRK+CSGSTTI E+   K +
Sbjct: 465 IKGSPPRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSA 524

Query: 524 EVQVQGPHGQLIIDHFNKSGIPSKFIQFENKVKRQKK 560
           EVQVQGPHGQLIIDH N  G+P+K+I FENK+K++K+
Sbjct: 525 EVQVQGPHGQLIIDHLNNLGVPNKWIDFENKLKKKKR 561

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/564 (52%), Positives = 393/564 (69%), Gaps = 18/564 (3%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP IKALS LKNS+RKKL+Q+   Q  ++E+ +     I QTNF    + GT+YTD
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQ-TNNEEYTFPTSIIKQTNFGGQKSVGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            N+IPI+FK KH + LYPT +  W N  LL  V TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 60  ENNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
           S   +GT+C VA K++P V +A+G+V+L+LP Y +V+G+TGVAV+++HHF D LF  FK 
Sbjct: 120 SRCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKV 179

Query: 181 KLEIPASVKSILQEET-------TADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDEL 233
           KLE P  + +  ++E        T +  K +D  QES   T P       +++AEVLD L
Sbjct: 180 KLEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAP-----DLEEVAEVLDHL 234

Query: 234 TVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTA 293
           TV DVDYFI RALY+++ QD  L LP+ AS F+SNHIMRNLP +DH +VN+K++SWKK+A
Sbjct: 235 TVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSA 294

Query: 294 KFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDST---QT 350
           KFLK+                 IVG N DKDELKNFVPYK+G ++    S  ++T   +T
Sbjct: 295 KFLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRT 354

Query: 351 QGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410
            G       LYKP +L +  ++E+ +     YTS ++RN +++YI  KNL D+KDK+ V+
Sbjct: 355 SGMMHSL-TLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVV 413

Query: 411 LDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTP 470
           +DDLLF MVN+K + P   RII R+ IL+PL++NNF E++Q+++ D+T LF+ P+KG  P
Sbjct: 414 MDDLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPP 473

Query: 471 KIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQG 529
           +I IVTEMKIGRKV+T+VSNFE F I PE LAADLRK+CSGSTTI E+   K +EVQVQG
Sbjct: 474 RIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQG 533

Query: 530 PHGQLIIDHFNKSGIPSKFIQFEN 553
           PHGQ IID+ NKSGIPSK+I FEN
Sbjct: 534 PHGQFIIDYLNKSGIPSKWIDFEN 557

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/558 (51%), Positives = 379/558 (67%), Gaps = 7/558 (1%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MF+KEP IKALS LKNSDRKKL Q++ AQ  +D+        + QTNF + T  GTIYTD
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDK--YTCPSIVKQTNFQTPTTIGTIYTD 58

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
             +IPI FK KH   LY T +  W+   LL    +H  V++  +FNGA+LMI+GT+PPFD
Sbjct: 59  EKNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFD 118

Query: 121 STLTIGTICAVATKEAPD-VAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFK 179
             L +GT+C VA+ + P  V  A+GIV ++LP++++V+G++GVAV+I+HHFED LF +FK
Sbjct: 119 EKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFK 178

Query: 180 AKLEIPAS--VKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVED 237
             L+ P     K  + +E   +  KE +   E    T+  S +   +D+AEVLD L+V+D
Sbjct: 179 IDLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQD 238

Query: 238 VDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLK 297
           VDYFI RALY+T+  D  L+LP+ AS F+S HI +NLPDVDH +VNIK++SWKKTAKFLK
Sbjct: 239 VDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLK 298

Query: 298 YXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGXXXXX 357
           +                 +VGMNK KDELKNFVPYK+G++  +         +Q      
Sbjct: 299 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYS 358

Query: 358 XNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFA 417
              YKPINL +  IKES +    +Y   EIR+ +N+YI  KNLVD K+KKMV+LDDLLF 
Sbjct: 359 ITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFG 418

Query: 418 MVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTE 477
           MVN+K  +P   R I RA ILEP + NNF E+FQ+Y    TPLFK+P++G  P+I I+TE
Sbjct: 419 MVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTE 478

Query: 478 MKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHGQLI 535
           MKIGRKV+T+VSNFE F I+PE LAADLRK+CSGSTTI E  T  K +EVQVQGPHGQ+I
Sbjct: 479 MKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQII 538

Query: 536 IDHFNKSGIPSKFIQFEN 553
           IDH NK G+P+K+I +EN
Sbjct: 539 IDHLNKLGVPTKWIDYEN 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 375/556 (67%), Gaps = 11/556 (1%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP IKALS LKNS+RKKL+QS K Q  +  D + +   + QTN+    + GT+YTD
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGA-SDYNFSTSIVKQTNYKGQHSDGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            N++PI FK KH + L+PT +  W+   LL  V TH  V+E  +FNGA+LM+AGT+PPFD
Sbjct: 60  QNNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
                  +C +A++  P V +A+G+V+LNLP Y  V+G+ G+AV+++H+F D L   FK 
Sbjct: 120 ERCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI 179

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240
            +E PA + S   EE   +  KE   E   +         E   D+A+VLDEL+VEDVD+
Sbjct: 180 DIE-PAVLSSEPVEEEEEEEGKEKLTESPKRETFHTEISIE---DVAQVLDELSVEDVDH 235

Query: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYXX 300
           F  RALY+T   D  L +P+ AS F+SNHI+ NLP VD  +VN+K+TSWKKTAKFLK+  
Sbjct: 236 FFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFE 295

Query: 301 XXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKI-GNTAKKAASKSDSTQTQGXXXXXXN 359
                         +IVG+NK+KDELKNFVPYK  G TA K  S  DS+           
Sbjct: 296 KVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGM---MYSEK 352

Query: 360 LYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMV 419
           LYKPINLG+ FI+ S++    +YT  E+++ +N YI  K LVD K+KKMV+LDDLLF M 
Sbjct: 353 LYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDMF 412

Query: 420 NRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMK 479
            RK +    PR + RA I++P IANNF E++QL+K ++TPLFKNPI+G  P++ IVTEMK
Sbjct: 413 YRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMK 472

Query: 480 IGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHGQLIID 537
           IGRKVVTRVS+FE F++ PE+LAA+LRKLCSGSTTI E  T  KV+EVQVQG HG LIID
Sbjct: 473 IGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIID 532

Query: 538 HFNKSGIPSKFIQFEN 553
           + NK GIP+K+I FE+
Sbjct: 533 YLNKQGIPTKWIDFES 548

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/558 (51%), Positives = 375/558 (67%), Gaps = 7/558 (1%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK+P +KALS LKNS+ KKL+ + +AQ   +++ S     I QTNF + +  GT+YTD
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQ-TGNQEYSFPTGVIKQTNFQAQSGIGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
           +++ PI FK KH + LYPT F  WS+ GLL  V TH  VVE  +FNGA+LM+AGTV PFD
Sbjct: 60  ADNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
           S L  GT+C +A+K APDV +AVG+V+L+LP Y  VLGKTGVAV+++H+  D L   FK 
Sbjct: 120 SRLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKV 179

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240
             E P S++   +EE   +   E  A+Q S         +   DDIAEVLDE  +EDVD 
Sbjct: 180 NAEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLEDVDQ 239

Query: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYXX 300
           F+ RALY+T+  D  L LP+ AS F+SNHI  NLP VDH+KVN+K++SWKKTAKFLK   
Sbjct: 240 FLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNFE 299

Query: 301 XXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQ--GXXXXXX 358
                          I+G+NK K EL+NF PY+I   +    + S +   +         
Sbjct: 300 KEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRCE 359

Query: 359 NLYKPINLGQKFIKESNISGGP-MYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFA 417
            LYKPINL + FI++++++    +YT+ E++N +NDYI   NL D K+KKMV+LDDLL+ 
Sbjct: 360 TLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYH 419

Query: 418 MVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTE 477
           +VN+K ++   PR++ RA I+EPL+AN+F  +FQ+YKGD  PLFKNP +G  P I+IVTE
Sbjct: 420 LVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNIEIVTE 478

Query: 478 MKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHGQLI 535
           MKIGRKV+TRVS FE F I  +ELAA LR+LCSGSTTI E  T  K  EV VQGPHG LI
Sbjct: 479 MKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLI 538

Query: 536 IDHFNKSGIPSKFIQFEN 553
           IDH N  GIP+K+I+F+N
Sbjct: 539 IDHLNSLGIPTKWIKFDN 556

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/574 (49%), Positives = 381/574 (66%), Gaps = 29/574 (5%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTT--AAGTIY 58
           MFKKEP IKALS LKNSDRKKL+Q++K Q   +       + I QTNF +T   + GTI+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 59  TDSNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPP 118
           T+ ++IPI FK+KH+D LYPT F  W+N+ +L T+ +H  V++  +FNGA+LMI+GT+PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 119 FDSTLTIGTICAVATKEAPD-VAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFST 177
           FDS L  GT+C +A+ + P  +  A+G+VK+N+P + +V+G+TGVAVE++HHFED LF  
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 178 FKAKLEIPASVKSILQEETTADVAKESD-AEQESQSVTEPPSGSEGPDDIAEVLDELTVE 236
           FK     P      ++E+   +  +++D A++++    E    S  PD   EVLD    E
Sbjct: 181 FKCNDLKP---DEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPD--FEVLDHFKTE 235

Query: 237 DVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFL 296
           DVDYFI R+LY+T+ QD  + LP+ AS F+S HI +NLPD+ H +VNIK+TSWKKTAKFL
Sbjct: 236 DVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFL 295

Query: 297 KYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKS-----DSTQTQ 351
           K+                 +VGMNK KDELKNFVPYKIG +   + S S     D + T+
Sbjct: 296 KHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTK 355

Query: 352 GXXXXXXNLYKPINLGQKFIKE-SNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410
           G        YKPIN  +  +K    I   P+YT  EIR+ +  YI  KNL+D K+KKM++
Sbjct: 356 GMMYSET-FYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMIL 414

Query: 411 LDDLLFAMVN-RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDN---------TPL 460
           LDDLLF MV+ R+ +    PR + R  ILEP++ANNF E++Q+Y+  N          PL
Sbjct: 415 LDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPL 474

Query: 461 FKNPIKGQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--T 518
           FK+P +G  P+IDI+TEMKIGRKV+T+VSNFE F IS + LAADLRKLCSGSTTI E  T
Sbjct: 475 FKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMT 534

Query: 519 PKKVSEVQVQGPHGQLIIDHFNKS-GIPSKFIQF 551
             K  EVQVQGPHGQ+IIDH NK  G+P+K+I +
Sbjct: 535 SPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/569 (50%), Positives = 379/569 (66%), Gaps = 27/569 (4%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP IKALS LKNS+RKKL +  + Q  S+E+ S   ++I QTNF   T  GTIYTD
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQ-TSNEEYSFGSNTIKQTNFKGITTIGTIYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
             + PI FK KH + LYPT    W    L+  V THS+V+E++IFNGA+LMI+GT+PPFD
Sbjct: 60  EGNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
             LT+GT+C +A K  P++ +AVGIV++NLP + +V+G+TGVAV+I+HH ED LF  FK 
Sbjct: 120 ERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKV 179

Query: 181 KLEIPASVKSILQEE--------TTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDE 232
           K E PA    +LQ +          AD+  E + + ES S TE    +   DD+AEVLDE
Sbjct: 180 KEEPPA---ELLQTQSSSSEELELEADI-HEDETKVESNSDTEKEKSN--LDDMAEVLDE 233

Query: 233 LTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLP-DVDHKKVNIKRTSWKK 291
           L +ED+DYFI RALY+T+ QD  L  P  AS F+SNHI  NLP   +  +VNIK++SWKK
Sbjct: 234 LRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKK 293

Query: 292 TAKFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYK-IGNTAKKAASKSDSTQT 350
           TAKFLK+                 IV +NKDKDE+K F+PY  IGN      S+  + +T
Sbjct: 294 TAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT 353

Query: 351 QGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410
                    LYKPINL + FI  + +    +Y   EI+  IN YI  K+LVD+KDKK V+
Sbjct: 354 ---TIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVL 410

Query: 411 LDDLLFAMVNRKIQNPIF-PRIIPRANILEPLIANNFNEYFQLYK---GDNTPLFKNPIK 466
           +DD+L  M+ +K ++     R+IPRANIL+P++ NNFN+ + L++    + TPL K P+K
Sbjct: 411 VDDMLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLK 470

Query: 467 GQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISET---PKKVS 523
           G+ PKI+IVTEMKIGRKV+T+VSNFE F+I PEE AAD+RK CSGSTTI ET    KK +
Sbjct: 471 GEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTA 530

Query: 524 EVQVQGPHGQLIIDHFNKSGIPSKFIQFE 552
           EVQVQGPHGQLI+ + N  GIP+K+I FE
Sbjct: 531 EVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 277/579 (47%), Positives = 382/579 (65%), Gaps = 29/579 (5%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK P +KA S LKNS+RKKL+QS K Q ++  D +     I Q N+   T+AGT+YTD
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQ-RNSSDYNFPSSIIKQANYKGQTSAGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
             ++PI FK KHSD L+P+ +  W N  LL  + T+S V+E  I NGA+LMI+GT+ PFD
Sbjct: 60  EQNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
             L  G +C +A+ + P+V +A+GIV+L+L  Y +V+G+TGVAV +LH+  D L  +FK 
Sbjct: 120 ERLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKM 179

Query: 181 KLEIPASVKSILQEETTADVAKESDA--EQESQSVTEPPSGSE---GP-----DDIAEVL 230
            LE P         ET A+V + ++    Q+ Q V    + S     P     DD+AEVL
Sbjct: 180 NLEPP---------ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVL 230

Query: 231 DELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWK 290
           + L V+ +D FI ++LY+++  D  L  P+ AS F+SN+IM NLP VD+  VN+K++SWK
Sbjct: 231 ETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWK 290

Query: 291 KTAKFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKI--GNTAKKAASKSDST 348
           KTAKFL++                +I G NK+K ELK+FVPY+   GN+ K    K++ T
Sbjct: 291 KTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDT 350

Query: 349 QTQGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKM 408
              G      + YKPI+LG+  I+ES      +YT+ E+R+ I +YI KKNLVD K+KKM
Sbjct: 351 SDNGDMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKM 410

Query: 409 VMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLY-KGDN---TPLFKNP 464
           +++DDL++++V +K +N   PR+I RA+++EP+  NNFNE+FQ+Y KGDN    PLFK P
Sbjct: 411 ILMDDLMYSLVYKK-KNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKP 469

Query: 465 IKGQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKV 522
           I+G  PK++IVTEMKIGRKV+TRVSNFE F I  E LAADLRKLC+G+TTI E  T  K 
Sbjct: 470 IRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKT 529

Query: 523 SEVQVQGPHGQLIIDHFNKSGIPSKFIQFENKVKRQKKK 561
           +EVQVQGPH Q+II H N   IP+K+I F+N VK ++KK
Sbjct: 530 AEVQVQGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  498 bits (1282), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 261/564 (46%), Positives = 354/564 (62%), Gaps = 14/564 (2%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP+IKALS LKNS+RK +    K Q  S E  +     I QT F +    GT++TD
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSE-YAFPSQVIKQTTFKTPFTTGTVFTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
             ++PI FK K SD LYPT F  WSN+ LL  V  H  VVE  +  GA+LM+ GTVPPFD
Sbjct: 60  QKNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
                  + +VA+  APDV  A+GIV++NLP+Y +V+G++GVAVEI+H F D L   FK 
Sbjct: 120 ERCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKV 179

Query: 181 KLEIPASVKSIL--QEETTADVAKESDAEQESQSVTEPPSGSE------GPDDIAEVLDE 232
           KL+ P    +IL  + E  AD+  ++      +S+  P S  +        +DI+E L E
Sbjct: 180 KLQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTE 239

Query: 233 LTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKT 292
           L VEDVD+F  R+LY+++  D  L  P+ AS F+SNHI+RNLP +DH +VN+K+TSWKKT
Sbjct: 240 LRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKT 299

Query: 293 AKFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTA---KKAASKSDSTQ 349
           AKFLKY                 I+G+++ K ELKNF PY+IG  A   +K AS   + +
Sbjct: 300 AKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEK 359

Query: 350 TQGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMV 409
            Q       +LY+PI+  + F+  +++    M+T  +I++ ++ YI  KNLV   +K  V
Sbjct: 360 EQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAV 419

Query: 410 MLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQT 469
            LDDLL+ +VNR  +     R I RA I+ P++  NF+E+F + K D TPLFK+P+KG  
Sbjct: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479

Query: 470 PKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQV 527
           P++ IVTEMKIGRKVVT+VSNFE F++  +ELA  LRK CSGSTTI E  T  K  EV V
Sbjct: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539

Query: 528 QGPHGQLIIDHFNKSGIPSKFIQF 551
           QGPHG  +I+  N+SGIP+K+I F
Sbjct: 540 QGPHGPAVIELLNESGIPTKWINF 563

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  497 bits (1279), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 268/560 (47%), Positives = 368/560 (65%), Gaps = 17/560 (3%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK+P IKALS LKNS+RKKL+ S++ Q +   D       + QT F   T+AGT+YTD
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQ-REVSDYQFPTQVVKQTTFKGQTSAGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
             ++PI FK KH   ++PT F  WSN  +L  V+TH  VVE  +  GADLM+ G VPPF 
Sbjct: 60  EQNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFS 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
           S  + G++  VA+  +P V  A+GIV+L+LP Y +V+G+TGVAV I+H F+D L   FK 
Sbjct: 120 SKCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKM 179

Query: 181 KLEIPASV-----KSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTV 235
           KLE P ++     K+  QEE   D A E+ A       T   +     +D +E L+EL+ 
Sbjct: 180 KLEPPEAIEDTSSKTEEQEEEHVDSADEAKA-----IATTTQARMVNTEDASEQLNELSA 234

Query: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKF 295
           ED+D+F+ R+LY+T+ QD+ L LPV AS F+SNHI+ NLP VDH ++N+K++SWKK+AKF
Sbjct: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKF 294

Query: 296 LKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGXXX 355
           LK+                ++VG+NKDKDELK FVPY+IG+  +   +K+ + Q      
Sbjct: 295 LKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA-QENSNMM 353

Query: 356 XXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLL 415
              +LYKPI+  ++F K  ++    ++T+ E++  ++ YI+KKNLV++ DKKMV+LDD L
Sbjct: 354 QAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTL 413

Query: 416 FAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIV 475
           F M+NR  +     R I RA I+ P +ANNF E+FQ+ KGD  PLFK  +KG  P+I IV
Sbjct: 414 FPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIV 472

Query: 476 TEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISET---PKKVSEVQVQGPHG 532
           TEMKIGRKVVT+VSNFE F++  E LAA+LRK CSGSTTI ET   PK + EV VQGPHG
Sbjct: 473 TEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTL-EVTVQGPHG 531

Query: 533 QLIIDHFNKSGIPSKFIQFE 552
            ++I   N+ GIP+K+I F+
Sbjct: 532 AIVIGMLNEYGIPTKWINFQ 551

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  490 bits (1262), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 352/561 (62%), Gaps = 16/561 (2%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP+IKALS LKNS+RKKL    + Q++   D S     I QT F +    GT+YTD
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPS-DYSFPSQVIKQTTFKTPFTTGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
             +IPI FK K SD LYPT F  WSN  L+  V  H  VVE  +  GA+LM+ GTVPPFD
Sbjct: 60  DKNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
                  +  VA+  +PDV  A+GIV+LNLP+Y +V+G++GVAVEI+H F+D L   FK 
Sbjct: 120 ERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKV 179

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEP-PSGS-EGP----DDIAEVLDELT 234
           KL+ P     I +    +D  + SDAE       EP PS   + P    DD AE L +L+
Sbjct: 180 KLQPPEGADGIAE----SDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLS 235

Query: 235 VEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAK 294
           VEDVD+F  RALY+T+ QD+ L +P  AS F+SNHI+RNLP +DH +VN+K+TSWKKTAK
Sbjct: 236 VEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAK 295

Query: 295 FLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGXX 354
           FLK+                 IVG++K KDELK+FVPY+   T   +   + S   Q   
Sbjct: 296 FLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYR---TGGNSGGSTGSESEQNSM 352

Query: 355 XXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDL 414
                +YKP++  + F+  +++S   M++  E++  ++ YI  K LV + +K  V LDDL
Sbjct: 353 MKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDL 412

Query: 415 LFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDI 474
           LF++VNR  +     R I RA I+ P++  NF E+F + K D TPLFK+P+KG  P+I I
Sbjct: 413 LFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQI 472

Query: 475 VTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHG 532
           VTEMKIGRKVVT+VSNFE F++  +ELA  LRK CSGSTTI E  T  K +EV VQGPHG
Sbjct: 473 VTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHG 532

Query: 533 QLIIDHFNKSGIPSKFIQFEN 553
             +I+  N+  IP+K+I F N
Sbjct: 533 PAVIELLNQLAIPTKWINFVN 553

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  474 bits (1220), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 269/570 (47%), Positives = 366/570 (64%), Gaps = 18/570 (3%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK P IK+LS LKNS+RKKL+QS KAQ  S  D +     I QTNF + T+ G IYTD
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGS-TDYNFPTSVIKQTNFNAQTSVGVIYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
               P+ FK KHS+ L+PT +  W +  LL  V TH +V+  +IFNGA+LMI+GT+PPFD
Sbjct: 60  EEGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
           S L   TIC +AT+  P+  +AVG+V+L++P Y  V+GKTGVAV +LH++ D +   FK 
Sbjct: 120 SRLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKM 179

Query: 181 KLEIPA-------SVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDEL 233
           K +IP        SV +   +++   + +E   E +S     P   S    ++A+    L
Sbjct: 180 KRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSI----PEISSNDVSELAQEESAL 235

Query: 234 TVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTA 293
           TVED+D+FI R+LY+T+  D  L  P+ +S+F+SNHIMRNLP VDH  VNIK+TSWKK++
Sbjct: 236 TVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSS 295

Query: 294 KFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGX 353
           KFLK+                 IVG NK+K+ELK F PY+I N++  +  K +S + +  
Sbjct: 296 KFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESE 355

Query: 354 XXXXX-NLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLD 412
                   Y P    ++F+  + +     YT++E++N + +YI KK LVD+K+ KM  LD
Sbjct: 356 NMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLD 415

Query: 413 DLLFAMV-NRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPK 471
           D L+ M   +K  NP  PR I RA ++E    NNF E +QL+K D+TPL KNP++G  P+
Sbjct: 416 DRLYDMCYTKKSTNP--PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPR 473

Query: 472 IDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK--KVSEVQVQG 529
           I IVTEMKIGRK+VTRVSNFE+F I  + LA DLR+LCSGSTTI ET    K +EVQVQG
Sbjct: 474 IKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQG 533

Query: 530 PHGQLIIDHFNKSGIPSKFIQFENKVKRQK 559
           PH ++IIDH N   IP+K+I FENK+K +K
Sbjct: 534 PHSKIIIDHLNSLSIPTKWIDFENKLKPKK 563

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  434 bits (1116), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/565 (43%), Positives = 346/565 (61%), Gaps = 25/565 (4%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK P IK LS LKNS+++KL Q ++ Q   DE +  +G+++ QTNF STT+ GTIY +
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFV-FSGNTVKQTNFQSTTSVGTIYLN 59

Query: 61  SNSIPI--MFKTKH-SDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVP 117
              IP+   FK KH S  L+P+ +  WS+ GLL  + THSVV+E+++FNGA+LMI+GT+P
Sbjct: 60  DEKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMP 119

Query: 118 PFD-STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEIL--HHFEDAL 174
           PFD + L  G  C +A  ++PDV IAVG +K++L  +          V +   HHF D L
Sbjct: 120 PFDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGL 179

Query: 175 FSTFKAKLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELT 234
              F+ KL+IP      L+  TT +VA+E   E +    T P +     DD+AEVL+ L+
Sbjct: 180 ADAFRLKLDIPDK----LESATTQEVAEEPPVEAKP---TSPVTNPVAVDDLAEVLETLS 232

Query: 235 VEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLP-DVDHKKVNIKRTSWKKTA 293
           VEDVDYF+ RALY+T+ Q+  L LP+ AS FMS H+M+ LP  +D  +VN+K++SWKKTA
Sbjct: 233 VEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTA 292

Query: 294 KFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDE--LKNFVPYKIGNTAKKAASKSDSTQTQ 351
           K+LK+                ++VG    K    LK+FVPY +GN+  ++  KS +T   
Sbjct: 293 KYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTN-- 350

Query: 352 GXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVML 411
           G        ++P +  Q  +    + G   ++  EIR  +N+YI    L    + KMV+L
Sbjct: 351 GPVMFAVTSFQPDSTAQTALP---LGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLL 407

Query: 412 DDLLFAMVNR-KIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTP 470
           +D LF MV +   +     RI+ R  ILE ++  +F   +QL+K  +TPL K+P KG+ P
Sbjct: 408 NDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPP 467

Query: 471 KIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKK--VSEVQVQ 528
           K+ I+TEMKIGRKVVTRV NF++  I   E AADLRKLCS STTI +T     VSE+QVQ
Sbjct: 468 KVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQ 527

Query: 529 GPHGQLIIDHFNKSGIPSKFIQFEN 553
           G HG LIIDH  + G+PS ++ FEN
Sbjct: 528 GAHGPLIIDHLRELGVPSSWVVFEN 552

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  431 bits (1109), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/565 (43%), Positives = 340/565 (60%), Gaps = 17/565 (3%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MF KEP IK LS LKNSDRKKL  ++K Q+  + ++  A   I QT+F     AG+IYTD
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINEEYNLPTA--VIKQTSFQVANVAGSIYTD 58

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWS-NNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPF 119
            ++ PI FKTK  D LYPT F LW+    LL  + TH  V+E +I  GA LM+ GTVPPF
Sbjct: 59  ESNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPF 118

Query: 120 DSTLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFK 179
            S +  G+I  +A+ + P +  A+GI +++L     V+G  G+AV ++H+ +D LF  FK
Sbjct: 119 PSNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFK 178

Query: 180 AKLEIPASVKSILQEETTA---DVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVE 236
            +LE PA V +    ETTA     +K  +   E  +  E  S     ++IA+ L+E+++E
Sbjct: 179 LELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238

Query: 237 DVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFL 296
           DVD+ + RA+ +++  D+ +TLP+VAS F+SNH+M+NLPDVD   VNIK++SWKK  K L
Sbjct: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298

Query: 297 KYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQG---X 353
           KY                 ++ +NK+  +L N   YK   T  K +S   + Q+      
Sbjct: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358

Query: 354 XXXXXNLYKPINLGQKFIKESNISGG---PMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410
                NLYKP++  Q+FI  + I+       YT  E++  ++ Y+   NL+D ++K +V 
Sbjct: 359 AYSGENLYKPMSACQRFI--TGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVK 416

Query: 411 LDDLLFAMVNRKIQNPIFPRIIPRANILEP-LIANNFNEYFQLYKGDNTPLFKNPIKGQT 469
            DD L+ M NR  QN    +I  R  I+ P  ++ NFN Y Q+YK +  PL K P KG  
Sbjct: 417 YDDTLYQMSNRAPQNGGIQKI-ARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPI 475

Query: 470 PKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQ 528
           P ++IVTE KIGRKV+TRV+NFE F+I  EELAA LRK CSGSTTI E+   K +EVQVQ
Sbjct: 476 PTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQ 535

Query: 529 GPHGQLIIDHFNKSGIPSKFIQFEN 553
           GPHG ++I   N  GIP+K+I FEN
Sbjct: 536 GPHGSIVISILNDYGIPTKWISFEN 560

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 236/575 (41%), Positives = 340/575 (59%), Gaps = 27/575 (4%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK   I  LS LKNS+ + + Q+ +  L S+ +    G  + QT F ST A G IYTD
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDAL-SNNEYEFPGSQVKQTTFESTVANGVIYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
           SN++PI FK K+S+T+ PT +  W     +  +RTH  ++E  IFNGA+LMI GTV P D
Sbjct: 60  SNNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHD 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
             L  G IC +A+ + P   +A+G+   ++      LGKTGVAVE+LH + D L + FK 
Sbjct: 120 ERLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKI 179

Query: 181 KLEIPA--------SVKSILQEETTADVAKESDAEQESQSVTEPP---SGSEGPDDIAEV 229
           KL  P         +++S+ QE  T ++     +E ES+   + P   + +   DD+AE 
Sbjct: 180 KLNPPTIMNTSNLKTLESMTQESMTQEI-----SEAESEVKPDAPFNDTFTSNADDLAET 234

Query: 230 LDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSW 289
           L++L VED+D F+ ++LY+T+ Q+ +L LP+++S F+S ++M+NLP+VDH +VNIK++SW
Sbjct: 235 LEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSW 294

Query: 290 KKTAKFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQ 349
           KKTAKFLK+                 I G NK+K +LK FVPY+IG  A    SK    Q
Sbjct: 295 KKTAKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDK--Q 352

Query: 350 TQGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMV 409
                     LY P            ++    +TS EI + I  YI KKNL + KDK  +
Sbjct: 353 DNKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKI 412

Query: 410 MLDDLLFAMV---NRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIK 466
            +DD+LF +V   N+   N    R I R+ ++EP++ NNF  Y QL+  DN  L K+P K
Sbjct: 413 SMDDVLFDLVITNNKANAN----RNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKK 468

Query: 467 GQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKKVSEVQ 526
           G  P + +VTE     KV+TRVSNFE F I  ++++ +L+ LCSGST+I E P   SEVQ
Sbjct: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPNG-SEVQ 527

Query: 527 VQGPHGQLIIDHFNKSGIPSKFIQFENKVKRQKKK 561
           VQGPHG +++++F K GIP K+  + NKVK +K++
Sbjct: 528 VQGPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  410 bits (1055), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/575 (38%), Positives = 352/575 (61%), Gaps = 26/575 (4%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKK+P IK+ S LKNS+RKKL+ +++AQ  ++++   +   + Q  F + TA GTI+TD
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQC-ANQEFQFSTTIVKQATFKTPTATGTIFTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            ++ PI FK KHS+ L PT    W   GLL  V TH  V++N + NGADLM+ GT+PPF 
Sbjct: 60  EDNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFS 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
              T G +  VA+ E P V  A+G+ +LNL    +V+G+TGVAV++LH   D L+  FK 
Sbjct: 120 DNCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKM 179

Query: 181 KLEIPAS----------VKSILQEETTADVAKESD---AEQESQSVTEPPSGSEGPDDIA 227
            +E P+           ++++ Q +    + ++ D   A+  S  + EP S SE    +A
Sbjct: 180 SVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSE----VA 235

Query: 228 EVLDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRT 287
           E L+EL++E VD+F+ +A+Y+T+  DNTL LP+ AS F++NH+M+NLP +   +V++KR+
Sbjct: 236 EQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRS 295

Query: 288 SWKKTAKFLKYXXXXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDS 347
           SW + +KFLKY                 +V +NKDK E+K+F PY+   T +K+ S S S
Sbjct: 296 SWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR---TIQKSVSTS-S 351

Query: 348 TQTQGXXXXXXNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKK 407
                        Y+P+N  +  +     +   M  + +I+  +N Y+ +K LV+  D++
Sbjct: 352 KNNDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDER 411

Query: 408 MVMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKG 467
           +++LDD LF++  +K  +    +++ RA + + +++ +F E F ++K D  PL   P+K 
Sbjct: 412 IILLDDTLFSLAYKKSASDSTRKVL-RAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKS 469

Query: 468 QTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEV 525
           +   + ++TEMKI RK+VTR+SNFE + + PEEL+ +LRK CSGS+T+ E  T +  +EV
Sbjct: 470 KNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEV 529

Query: 526 QVQGPHGQLIIDHFNKSGIPSKFIQFENKVKRQKK 560
           QVQGPHG   I+  N+ GIPSK+I F+NK+ ++KK
Sbjct: 530 QVQGPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  388 bits (996), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/562 (40%), Positives = 316/562 (56%), Gaps = 21/562 (3%)

Query: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60
           MFKKEP +   S  KNS+RK+L  S++ Q +  E    +   I    F + +  GT+YTD
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEY-ESYQFSSTEIKHGTFKTQSTVGTVYTD 59

Query: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120
            N+IP+ F+ KH  T  PT +  W +  LL  V TH  VVE+ +  GADLM+ GTVPPF 
Sbjct: 60  PNNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFS 119

Query: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180
           S    G +  +A+  AP V  AVGI +++L     V   TGVAV +LH + D L   FK 
Sbjct: 120 SGTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKV 179

Query: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240
           + E P        E + A  A     E E+    EPP  + G + +AE L+ LT+EDVD+
Sbjct: 180 QREAP--------EASEAKGASPEAREPEA----EPPKTAPG-EGLAEELERLTMEDVDH 226

Query: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYXX 300
            + RA+Y+T+  D  L LPV AS F++ H+++NLP +D  +V +KR+SW K AK LK+  
Sbjct: 227 LLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFE 286

Query: 301 XXXXXXXXXXXXXXIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGXXXXXXNL 360
                          +V +N   + LK+F PY+  +      SK+ ST TQ         
Sbjct: 287 AQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSST-TQSLEIVYH-- 343

Query: 361 YKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMVN 420
           Y P       +    ISGG   ++ +IR+ +  Y+  +  VD  DK M+ LDD L  +++
Sbjct: 344 YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH 403

Query: 421 RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMKI 480
           + + N   PR +PR   L  L++ +F+EYF + +GD  PL K P KG+ P I +  E KI
Sbjct: 404 KNV-NADTPRSLPRPEALAALLSRSFSEYFVVMRGD-APLSK-PQKGRAPPIKVTNERKI 460

Query: 481 GRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQGPHGQLIIDHF 539
            +KVVT+VSNFE + + PEELAA+LR  CSGSTTI++ P  K  EVQVQGPH   I+   
Sbjct: 461 YKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVSIL 520

Query: 540 NKSGIPSKFIQFENKVKRQKKK 561
           NK GIPSK+I  + KV+ +KKK
Sbjct: 521 NKHGIPSKYITLDCKVQPKKKK 542

>KAFR0C05950 Chr3 complement(1185133..1187292) [2160 bp, 719 aa]
           {ON} Anc_5.625 YDR263C
          Length = 719

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 12/111 (10%)

Query: 151 PEYQQVLG-----KTGVAVEILHHFEDALFSTFKAKLEIPASVKSILQEETTADVAKESD 205
           PE +Q LG     + G   E+     D+ FST     +IP+S + +L+   TA      D
Sbjct: 467 PEVRQELGNSKLKECGSESEVETEIPDSCFST-----QIPSSFQELLRRTPTATAEDGGD 521

Query: 206 AEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDYFIRRALYFTMVQDNTL 256
              E+       S  E  +DI+EV+ E +V  ++ F  ++L+  +++ N+L
Sbjct: 522 GTDETDEKDVVTSEDEDTEDISEVISEPSVAKINKFDAKSLF--IMKKNSL 570

>NCAS0A15060 Chr1 (2966614..2970774) [4161 bp, 1386 aa] {ON}
           Anc_7.519 YPR164W
          Length = 1386

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 35/87 (40%), Gaps = 4/87 (4%)

Query: 3   KKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTDSN 62
           KK PRIK  +       + L    +  L  D  I VAGDS   +N I  T    I    +
Sbjct: 179 KKHPRIKKPTTFSTDLSQDLKPEQEYMLIGDNTIQVAGDSKCISNHIRITDCKPIRNSYH 238

Query: 63  SIPIMFKTKHSD-TLY---PTSFLLWS 85
               +  T HSD TLY   P     W+
Sbjct: 239 EGTTIILTVHSDGTLYSILPIGRQFWN 265

>KNAG0L00820 Chr12 complement(144786..145320,145422..145513) [627
           bp, 208 aa] {ON} Anc_7.152 YER007C-A
          Length = 208

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 21/187 (11%)

Query: 1   MFKKEPR--IKALSKLKNSDRKKLVQSLKAQLKS-----DEDISVAGDSIMQTNFISTTA 53
           MF+K  +  I + SK+K+S ++ L   L AQ        DE I   G    Q   I    
Sbjct: 28  MFRKFSKEDIHSRSKVKSSIQRTLKSKLVAQYPLLEQVIDELIPKKG----QVELIKCED 83

Query: 54  AGTIYTDSNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIA 113
              +YT    +  +F  K  D L P+  L+        TV+     ++ ++ +GA++M  
Sbjct: 84  KIQLYTVDGEV--LFFQKF-DELIPSLKLVHRFPEAYPTVQVDRGAIK-FVLSGANIMCP 139

Query: 114 GTVPPF----DSTLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHH 169
           G   P     +S         V   E  D A+A+G + ++  +  ++    G  VE++HH
Sbjct: 140 GLTSPGAKLPESPGFEKDTVVVINAENKDSALAIGKLMMSTNDIAEI--NKGHGVELIHH 197

Query: 170 FEDALFS 176
             D L++
Sbjct: 198 LGDPLWN 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,505,088
Number of extensions: 2567988
Number of successful extensions: 9988
Number of sequences better than 10.0: 50
Number of HSP's gapped: 10185
Number of HSP's successfully gapped: 50
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)