Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B054608.270ON61061031570.0
Skud_4.3788.270ON6525308591e-106
Smik_4.3628.270ON6485228441e-104
Suva_2.2778.270ON6495188421e-103
YDR118W (APC4)8.270ON6525258012e-97
KNAG0H031908.270ON6225137843e-95
TDEL0F039708.270ON6194837199e-86
Kpol_392.18.270ON4244216891e-83
ZYRO0C01474g8.270ON5994856532e-76
NCAS0B037908.270ON6125326403e-74
NDAI0J012708.270ON7356145903e-66
TPHA0J007908.270ON6854375402e-59
TBLA0C045708.270ON6084885081e-55
CAGL0B01859g8.270ON6224895046e-55
KLTH0G13508g8.270ON6454783646e-36
Kwal_56.237668.270ON7404153666e-36
SAKL0H16852g8.270ON6444253522e-34
AGR078C8.270ON7154361619e-11
Ecym_43008.270ON7153481611e-10
KLLA0F19316g8.270ON6712151047e-04
TDEL0E031205.315ON206167751.1
KNAG0I012501.406ON1748102761.6
Smik_4.7285.567ON34671741.9
KNAG0K006103.78ON49698751.9
AGR104W8.247ON83372742.3
Kpol_2001.151.200ON500256732.8
NCAS0I022903.127ON49623707.0
YIL149C (MLP2)5.702ON167997707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05460
         (610 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...  1220   0.0  
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   335   e-106
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   329   e-104
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   328   e-103
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   313   2e-97
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   306   3e-95
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   281   9e-86
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   270   1e-83
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   256   2e-76
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   251   3e-74
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   231   3e-66
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   212   2e-59
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   200   1e-55
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   198   6e-55
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   144   6e-36
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   145   6e-36
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   140   2e-34
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    67   9e-11
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    67   1e-10
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    45   7e-04
TDEL0E03120 Chr5 (588819..589439) [621 bp, 206 aa] {ON} Anc_5.31...    33   1.1  
KNAG0I01250 Chr9 complement(236482..241728) [5247 bp, 1748 aa] {...    34   1.6  
Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {...    33   1.9  
KNAG0K00610 Chr11 complement(108809..110299) [1491 bp, 496 aa] {...    33   1.9  
AGR104W Chr7 (932766..935267) [2502 bp, 833 aa] {ON} Syntenic ho...    33   2.3  
Kpol_2001.15 s2001 complement(41752..43254) [1503 bp, 500 aa] {O...    33   2.8  
NCAS0I02290 Chr9 (424524..426014) [1491 bp, 496 aa] {ON} Anc_3.127     32   7.0  
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    32   7.8  

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score = 1220 bits (3157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/610 (97%), Positives = 593/610 (97%)

Query: 1   MNELNPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKIS 60
           MNELNPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKIS
Sbjct: 1   MNELNPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKIS 60

Query: 61  GKYLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVD 120
           GKYLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVD
Sbjct: 61  GKYLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVD 120

Query: 121 LMPSLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGD 180
           LMPSLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGD
Sbjct: 121 LMPSLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGD 180

Query: 181 YYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECIL 240
           YYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECIL
Sbjct: 181 YYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECIL 240

Query: 241 SLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQD 300
           SLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQD
Sbjct: 241 SLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQD 300

Query: 301 WLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGA 360
           WLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGA
Sbjct: 301 WLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGA 360

Query: 361 DDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQL 420
           DDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQL
Sbjct: 361 DDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQL 420

Query: 421 SITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILE 480
           SITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILE
Sbjct: 421 SITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILE 480

Query: 481 NKIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPTPINEVRVGTANI 540
           NKIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPTPINEVRVGTANI
Sbjct: 481 NKIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPTPINEVRVGTANI 540

Query: 541 DGTSTNEKILPLSVVQMSNDIAVXXXXXXXXXXXXXXXXXCSGAKEMITVYKTTLHIRDG 600
           DGTSTNEKILPLSVVQMSNDIAV                 CSGAKEMITVYKTTLHIRDG
Sbjct: 541 DGTSTNEKILPLSVVQMSNDIAVIKIIEEPSKKSKEYEIICSGAKEMITVYKTTLHIRDG 600

Query: 601 RIEMALGPSN 610
           RIEMALGPSN
Sbjct: 601 RIEMALGPSN 610

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  335 bits (859), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 173/530 (32%), Positives = 303/530 (57%), Gaps = 11/530 (2%)

Query: 4   LNPKERSYCV-YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGK 62
           ++P    Y + YN + P++  +  KGL ++R SD+  IA   ++   LVA   WD+ SGK
Sbjct: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60

Query: 63  YLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLM 122
           +LSIFF+DG++RI D+FKDG+LV+FLR     +    WDRI  +   + + F  N++D++
Sbjct: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120

Query: 123 PSLIQFVSSANKLSLIPYTPSNANWRELDAK-WKKNRVIDMHCLHQSETDSFLMVLNGDY 181
           P LI+FV  + ++S++PYTP N  WR  D    +   ++D+H +     D   +  NGDY
Sbjct: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180

Query: 182 YLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241
             T+  P  D+  +    S++K  +  Y C Y DGS R ++    L SK  +DLL  I+ 
Sbjct: 181 --TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMV 238

Query: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDW 301
           +K++  Y   H++L+ R +I PYLDF+++ICD A+G  KL +EL+  FLLG +S +L+DW
Sbjct: 239 IKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDW 298

Query: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361
           L  SVG+KN+ +W+ L  +AYQ+TT++ T+  +  CER+I+  E+  G + AF  ++ ++
Sbjct: 299 LCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSN 358

Query: 362 DNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLS 421
           + S L  +  L+ N Q++L + + +         + + F  W NDR+HE LD+DYK +  
Sbjct: 359 NTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFE 418

Query: 422 ITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPI 478
              +    Y L   F+ +L     +S  ++N  + +   + +  +E +I++ N   +   
Sbjct: 419 FEDDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNN---VSQH 475

Query: 479 LENKIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPT 528
           ++ ++ I+ +   +   Y P   V + D +K+    Y++Y+++++ +  T
Sbjct: 476 IQQQLLINIRKDVYSQMY-PSSQVRLLDAIKLPNQSYIVYLIEVTKLMNT 524

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/522 (32%), Positives = 303/522 (58%), Gaps = 11/522 (2%)

Query: 6   PKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLS 65
           P    +  YN + P++  +  KGL + R SD+  +A   I+   LVA   WD ++GK+LS
Sbjct: 4   PGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLS 63

Query: 66  IFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSL 125
           IFF+DG+IRI D+FKDG+LV+FLR     +    WDRI  ++ +       NI+D +P L
Sbjct: 64  IFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKL 123

Query: 126 IQFVSSANKLSLIPYTPSNANWRELDA-KWKKNRVIDMHCLHQSETDSFLMVLNGDYYLT 184
           I++V  + +++++PYTP N+ WR  D  + + N  +D+H +     D   +  NGDY + 
Sbjct: 124 IRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIF 183

Query: 185 LKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKD 244
           +     D +E+    S++K  +  Y C Y DG+ R ++    L S+  +++L+ I+++K+
Sbjct: 184 VPV-GADENERF-VKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKE 241

Query: 245 MSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHY 304
           +  Y  NH++ + R ++ PYL+F+ ++CD A+G +KLI+EL+  FLLG +S +L+DWL  
Sbjct: 242 LIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCN 301

Query: 305 SVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNS 364
           SVG+KN  +W+ L  +AYQ+TT++ T+  + ACER+I+  E+  G++ AF  ++  +D+S
Sbjct: 302 SVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSS 361

Query: 365 RLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQ 424
            L  ++ L+ N Q++L   + +  +      + + F  WLNDR+HE LD+DYK ++    
Sbjct: 362 DLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFED 421

Query: 425 NSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPILEN 481
           +    Y L   F  +   G + S  +LN  + +   +++  +E  I+  N   +   ++ 
Sbjct: 422 DPYFGYDLLTYFHNISNRGAETSP-VLNMKLYRDLINSMSDMEKEIAESN---VNSHIQQ 477

Query: 482 KIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLS 523
            I ++++   +   Y P   + V D VK+ +  Y+LY++Q++
Sbjct: 478 HILVESRTDVYSKEY-PSSQIYVFDAVKLPKHNYILYLIQVT 518

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  328 bits (842), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 168/518 (32%), Positives = 294/518 (56%), Gaps = 18/518 (3%)

Query: 14  YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGSI 73
           YN + P++  +  KGL ++R SD+  +A   ++   LVA   WD  +GK+LSIFF+DG+I
Sbjct: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67

Query: 74  RIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQFVSSAN 133
           RI D+FKDG+LV+FLR     +    WDRI  +  +  + F  N++D++P LI+FV  + 
Sbjct: 68  RIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFVKDSK 127

Query: 134 KLSLIPYTPSNANWRELDAKWKKN-RVIDMHCLHQSETDSFLMVLNGDYYLTLKTPETDL 192
           ++++ PYTP N+ WR  D    +N   +D+H +     D   +  NGDY + L  P +D+
Sbjct: 128 RVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL--PVSDI 185

Query: 193 SEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNH 252
             +    S++K  N  Y C Y DG+    +    L S+  +DLL  ++ +K++  Y   H
Sbjct: 186 ENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLAH 245

Query: 253 LDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGDKNVT 312
           ++ + R +  PY+DF+++ICD A+G  KL +ELK  FLLG +  +L DWL  +VG+KN  
Sbjct: 246 IEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGEKNFK 305

Query: 313 QWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNSRLHELNEL 372
           +W+ L  +AYQ+T ++FT+A +  CER+I+  ++  G++ AF  +        L  +  L
Sbjct: 306 RWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLTAVELL 365

Query: 373 MSNLQDML----KSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQNSNT 428
           +   Q++L    KSII   ++      + + FL W NDR+HE LD+DYKP+     +   
Sbjct: 366 LKQSQELLNITLKSIIDLGKDET----LFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYF 421

Query: 429 CYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPILENKIAI 485
            Y L   FE  L +   +S  +++  + +   +++  +E +I++ N   + P ++ ++ +
Sbjct: 422 GYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNN---VNPHIQRQVLV 478

Query: 486 DTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLS 523
            ++   F   Y P   + + D +K+S+  Y++Y++Q++
Sbjct: 479 QSRADVFSQRY-PSSKINLLDAIKLSKQNYIVYLIQVT 515

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  313 bits (801), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/525 (32%), Positives = 292/525 (55%), Gaps = 14/525 (2%)

Query: 5   NPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYL 64
           +P    +  YN   P++  +  KGL +YR SD+  +A   I+   LVA   WD  +GK+L
Sbjct: 3   SPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFL 62

Query: 65  SIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPS 124
           SIFF+DG+IRI D+FKDG+LV+FLR     +    WDRI  +     + F  NI+D +P 
Sbjct: 63  SIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPK 122

Query: 125 LIQFVSSANKLSLIPYTPSNANWRELDAK-WKKNRVIDMHCLHQSETDSFLMVLNGDY-- 181
           LI+FV  + +++++PYT  N+ WR  D      N  +D+H +     D   +  NGDY  
Sbjct: 123 LIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAV 182

Query: 182 YLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241
           +L++   E + S K    S+IK  +  YQC Y+DG+ + ++    L SKS ++LL  I+ 
Sbjct: 183 FLSVDNIENENSLK----SIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMV 238

Query: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDW 301
           +K++  Y   HL+ + R +  PYLDF++++CD A+G  KL +EL+  FLLG IS +L+DW
Sbjct: 239 IKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDW 298

Query: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361
           L  SVG+KN  +W+ L  +AYQ+T ++ T+  + ACER+I+  E+   ++ AF  ++   
Sbjct: 299 LCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLS 358

Query: 362 DNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLS 421
             S L  +  L+ + Q +L   + +         + + F  W NDR+HE LD+DYK +  
Sbjct: 359 YTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQ 418

Query: 422 ITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPI 478
              +    Y L   F+ +L +   +   I++  + +   +++  +E +I++ N   +   
Sbjct: 419 FEDDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSN---VNSH 475

Query: 479 LENKIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLS 523
           ++  I +D K   F   Y P   + + D +K+ +  Y++Y++Q++
Sbjct: 476 IQQHILVDLKTDVFAQKY-PSSQINLLDAIKLPKHNYIVYLIQVT 519

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  306 bits (784), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 166/513 (32%), Positives = 287/513 (55%), Gaps = 9/513 (1%)

Query: 11  YCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRD 70
           Y   N  LPLY  +G K L+V R +D++ IA T I+    V    WD I G+ +S+ F+D
Sbjct: 12  YTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQD 71

Query: 71  GSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIV-DLMPSLIQFV 129
           GSIRI DV  D KLVA LRTQ   +DC  WDRI   +  +  +++ +I+   +P L++F+
Sbjct: 72  GSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFM 131

Query: 130 SSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKTP- 188
            S    S+ PY P+N +WR          ++D+H LHQ   D+ + +LNG+Y L L  P 
Sbjct: 132 GSDASPSMSPYLPTNHSWR-FPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPH 190

Query: 189 ETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKY 248
           + D SE     +   S   +Y C YK G  R++D + F+  K  I LLE  L  +D   Y
Sbjct: 191 QEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGY 250

Query: 249 TRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGD 308
              HL+ ++   ++PY +F+E++C+ AFG+EKL   L   FL+G++ +EL+DWL YS+G+
Sbjct: 251 FLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGE 310

Query: 309 KNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESG-ADDNSRLH 367
           +N+ +W++L + AY++T+++  + L+   ER+I+L E+   L++  Q   G   D+  + 
Sbjct: 311 RNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEIS 370

Query: 368 ELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQNSN 427
           E  +L+ N Q++L+ ++ T ++ A   + +K+FL WL + +   ++ DY P  ++++   
Sbjct: 371 EFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECGK 430

Query: 428 TCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILENKIAIDT 487
             +         L+  KK    +  FD  +  + +    + +++  Y+  +L +K+ +  
Sbjct: 431 FGFLFTSGLALTLEPAKK---TVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKVIVGD 487

Query: 488 KIPFFKANYSPELTVTVRDIVKISQIP-YVLYV 519
            IP   + Y  E  VT+ DI +++  P Y++Y+
Sbjct: 488 PIPLLNSYYI-EHFVTLLDIAQVAAHPAYLIYL 519

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  281 bits (719), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 160/483 (33%), Positives = 265/483 (54%), Gaps = 14/483 (2%)

Query: 8   ERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIF 67
           E  Y  YN    LY +K  KGL + R +DN  IA   ++   ++A   WD I+GK +++F
Sbjct: 5   ELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVF 64

Query: 68  FRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQ 127
           ++DG+ RI D F+ GKL+A LR     VD   WDRIE        +F+  +++ MP +I+
Sbjct: 65  YKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIR 124

Query: 128 FVSSANKLSLIPYTPSNANWR----ELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYL 183
           F     ++ ++PY P N  WR    E D   ++  ++D+H +HQ E +  +++L+GD+ L
Sbjct: 125 FARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQ-EDNGLVLMLDGDFIL 183

Query: 184 TLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLK 243
            L    +  + K     ++ +   LY C Y+D +   +     +   + I L++  +++K
Sbjct: 184 RLAAGPSGPALK----DIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIK 239

Query: 244 DMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLH 303
            ++ Y ++HLDL++R ++ PY +FL KICD AFG E L  EL+   L G +S EL++W  
Sbjct: 240 QLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFC 299

Query: 304 YSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQF-ESGADD 362
           Y+VG+KN  +W+ +  + YQ+T ++ T++ + ACER+ILLSERC   + A Q  ES    
Sbjct: 300 YTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTT 359

Query: 363 NSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSI 422
           +S   E   L S  Q  L+S + T +  + +  + + FL W +DR+HE LD+DYK +LSI
Sbjct: 360 DSS--EFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSI 417

Query: 423 TQNSNTCYKLGKSFEYLLQEGKKDSED--ILNFDIIKHTLEKIEANISRMNTKYIEPILE 480
             N    Y++    +  +   K+   D   L     +  L+ +  N+  +  + IEP + 
Sbjct: 418 DSNCKIGYQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVL 477

Query: 481 NKI 483
            KI
Sbjct: 478 QKI 480

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  270 bits (689), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 142/421 (33%), Positives = 246/421 (58%), Gaps = 19/421 (4%)

Query: 11  YCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRD 70
           Y  YN    LY  +  +GL VYR  D++ +AH  IK ++ VAG  WD  SG+++S+F  D
Sbjct: 11  YSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTD 70

Query: 71  GSIRIIDVFKDGKLVAFLRTQF-KNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQFV 129
           G+IRI D+FK+G+LV+++R+   KNVD   WDR E    ++++ F+ NI++ +P+LI+FV
Sbjct: 71  GTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFV 130

Query: 130 SSANKLSLIPYTPSNANWRELDAKWKKN-------RVIDMHCLHQSETDSFLMVLNGDYY 182
             +  +++I Y P N +WR +D + +          ++D+H  H    D+F ++LNG Y 
Sbjct: 131 KDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYE 190

Query: 183 LT-LKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241
           +  +  P+   SE      L+K  N  Y   YK+G  RKI+ ++ LS      LL  IL 
Sbjct: 191 INGIVMPDISKSE---VYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247

Query: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAF--GREKLINELKITFLLGTISDELQ 299
           ++++++Y  +HLDL++R +I PY DF++KIC  A+  G  KL +EL+   L G I++E +
Sbjct: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307

Query: 300 DWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESG 359
           DWL   +GD+N  +WR L  D +++  ++ T+A++ +CER ++  ER  G +  +     
Sbjct: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYM---- 363

Query: 360 ADDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQ 419
              ++  +++  L      ++++ I       N+ +  +IF  W+ND+++E  D+DYK +
Sbjct: 364 -KTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNR 422

Query: 420 L 420
           +
Sbjct: 423 V 423

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  256 bits (653), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 272/485 (56%), Gaps = 29/485 (5%)

Query: 8   ERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIF 67
           ++ Y  YN   PLY ++  +G  V+R +D+  IA  I++    VAG  WD I+GK+LSIF
Sbjct: 2   DQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIF 61

Query: 68  FRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNE-MKQF--NKNIVDLMPS 124
           ++DG++RI D F+ G+LV+ LR          WDRIE   + E +K +  + ++ ++MP 
Sbjct: 62  YKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPK 121

Query: 125 LIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLT 184
           +++F   + +L ++PYT  +  WR   A    N ++D H +     DS  ++ +G++ ++
Sbjct: 122 MVKFARDSRQLCVVPYTLPSDVWRPQAAD-DTNALLDAHVIRCH--DSLSVMFDGEFTIS 178

Query: 185 LKTPETDLSEKVPACSLIK--SANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSL 242
           ++         +P+  L+K  SA   Y   Y+DGS  + D ++ +     + LL+ ++++
Sbjct: 179 IQL------AAIPS-PLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITM 231

Query: 243 KDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLL-GTISDELQDW 301
           + + +Y ++H++L++R +++PY +FLE+ C GAFG   L+ E  I  +L G ++ EL+DW
Sbjct: 232 RQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDW 291

Query: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361
           L  S+G+KN+ +WR L  DAY +T ++ T+A + ACER+I L +RC G +++ Q      
Sbjct: 292 LVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLTLQL- 350

Query: 362 DNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLS 421
                  L   +  LQ  LK+++      +++  +L  FL W +DRV E +D+DYK + +
Sbjct: 351 ------PLLPPIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFN 404

Query: 422 ITQNSNTCYKLGK-SFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILE 480
           +  NS+    LG  +  YL    +  S +  +   + H+L      +S +++  I+  L 
Sbjct: 405 LHDNSS----LGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDA-LT 459

Query: 481 NKIAI 485
           +KI I
Sbjct: 460 SKINI 464

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  251 bits (640), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 271/532 (50%), Gaps = 13/532 (2%)

Query: 14  YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGSI 73
           YN   P    K   G  V R  D+T I   +I+  + V    W+     YL++ F DGS 
Sbjct: 11  YNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSA 70

Query: 74  RIIDVFKDGKLVAFLRTQ---FKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQFVS 130
           RI D+F++GKL+  LR Q    K +D   W ++E +      +F+++I  LMPS I+FV+
Sbjct: 71  RIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIKFVN 130

Query: 131 SANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKTPET 190
           +A +L ++PY  +   WR +D   + N +ID+H  H S TD +L+++NG Y LT++   T
Sbjct: 131 NAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPNST 190

Query: 191 DLSEKVPACSLIK-SANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYT 249
           D +       +I     +++ C YKD     ID ++ + S   + LL  +  +K + +Y 
Sbjct: 191 DENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYI 250

Query: 250 RNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGDK 309
            +HLD+++  + KP  DFLE         + L   LK   L G ++  L  WL   VG+K
Sbjct: 251 VDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGEK 308

Query: 310 NVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNSRLHEL 369
           N+ +W+ L    YQ+  ++ ++A++ A E++ LLS RC  L++A    +       L   
Sbjct: 309 NLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASG-HMQELEYF 367

Query: 370 NELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQNSNTC 429
           + L      +    +   ++++ + +   +F+ W+ D + E +D+DY P+L+I ++ +  
Sbjct: 368 DSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNICEDGSVV 427

Query: 430 YKLGKSFEYLLQEGKKD-SEDILNFDIIKHTLEKIEANISRMNTKYIEPILENKIAIDTK 488
             L +  +   Q+  K+ S D    D+ K+ L+ I   +  +++ Y+  +L   + I   
Sbjct: 428 PTLMEIIDQFFQDTTKEKSTD--GTDLSKNLLKSISDTLENIDSSYVRNMLLKTMKIRGT 485

Query: 489 IPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPTPINEVR-VGTAN 539
              F  N+  +  VT+ DI   ++ P+++Y+V+  S T      V+ +GTAN
Sbjct: 486 ARSFTENFDED--VTILDIFYCAKYPFLVYLVEKRSNTQDVKASVKYIGTAN 535

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  231 bits (590), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 174/614 (28%), Positives = 301/614 (49%), Gaps = 99/614 (16%)

Query: 15  NKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGSIR 74
           N   PLY  K    ++  R  D   I++ II+  + V  I WD  +GKYL+I F DG+ R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 75  IIDVFKDGKLVAFLRTQFK--------NVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLI 126
           I D+F+DGKL+  +R Q           VD   WDR+    + +  +FN +I  LMP+LI
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 127 QFVSSANKLSLIPYTPSNAN--WRE-------------LDA--------KWKKNRVIDMH 163
           +FV  +  + ++PY+ +     WRE             +DA          K  R +D+H
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 164 CLHQSETDSFLMVLNGDYYLTLKTPETDLSEKVPACSLIKS-ANSLYQCIYKDGSARKID 222
            +H  + D F + +NG Y + L     + + +     ++KS  + +Y C +++GS R + 
Sbjct: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267

Query: 223 TSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFL-----EKICDGAFG 277
            S F SS   ++LLE  + + +M KY + HLDL+ + ++K + DFL     E+  +G  G
Sbjct: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG--G 325

Query: 278 REKLINELKITFLLGTISDELQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCAC 337
              ++ +LK++ L G +S+EL +WL  S+G+KN+ +W+ L  + Y ++ ++F++AL+ AC
Sbjct: 326 GNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPAC 385

Query: 338 ERMILLSERCFGLIMAFQFESGA-----------------DDNSR----LHELN----EL 372
           E  +LLS++C  ++ A + E  A                 + NSR    L E +    EL
Sbjct: 386 ELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLEL 445

Query: 373 MSNLQDM-------LKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQN 425
           +  LQ         L+ I Y  ++S+       +FL WL + +   LD+D+ P+L    N
Sbjct: 446 IEILQKFGSRCLQNLRKISYIEKQSS-------LFLKWLQEMIFHALDEDHVPKLDTYSN 498

Query: 426 SNTCYKLGKSFEYLL--------QEGKKDSEDILNFDIIKH---TLEKIEANISRMN--- 471
              C  L      L+        ++ ++D   ++N D       ++E+    + R+N   
Sbjct: 499 PIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLS 558

Query: 472 ----TKYIEPILENKIAIDTKIPFF-KANYSPELTVTVRDIVKISQIPYVLYVVQLSSVT 526
                K I+P L+  + +   I F  +  + P   +TV+D+VK+     +LY++Q+ S+ 
Sbjct: 559 RSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQVKSLD 618

Query: 527 PTPINEVRVGTANI 540
              +    VGT N+
Sbjct: 619 SRDL--FYVGTINV 630

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  212 bits (540), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 126/437 (28%), Positives = 232/437 (53%), Gaps = 29/437 (6%)

Query: 1   MNELNPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKIS 60
           M E +  +  Y   N    LYT K  KGL +   SD++ +A   IK + LV   +WD I+
Sbjct: 1   MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60

Query: 61  GKYLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDR--IEEQTTNEMKQFNKNI 118
           GK+L   F DGSIR+ D+FK G+LV+F R+  K + C YWDR  I E    ++K F+ ++
Sbjct: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDL 120

Query: 119 VDLMPSLIQFVSSANKLSLIPYTPSNANWRELDA-----------KWKKNRVIDMHCLH- 166
            + MP+L++FV     L L+P   +   WR++D            +   + V+D+H L+ 
Sbjct: 121 TNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYT 180

Query: 167 QSETDSFLMVLNGDYYLTLKTPETDLSEKVP--ACSLIKSANSLYQCIYKDGSARKIDTS 224
           +S  D+F +++NG Y L+    +  +  + P     L+K++   Y   Y++ S R ID +
Sbjct: 181 ESGMDNFAVLVNGVYDLS----DIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVT 236

Query: 225 SFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAF-GREKLIN 283
            F S+   ++LL   + L++     +  ++++++ +I P+  F+  +C  A+ G + L  
Sbjct: 237 PFSSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYR 296

Query: 284 ELKITFLLGTISDELQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILL 343
            +    L G IS+E +DWL  ++G++N+ +W+ L  +   +  ++ ++  +   E+ I+ 
Sbjct: 297 SMTNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIIT 356

Query: 344 SERCFGLIMAFQFESGADDNSRL----HELNELMSNLQDMLKSIIYTAEESANKFEMLKI 399
           +ER    I A +      DNS++     E+N+L+ NL ++LK+ I       N     +I
Sbjct: 357 AERIQNYITAMRLS----DNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEI 412

Query: 400 FLSWLNDRVHEELDDDY 416
           F+ W+ + ++  +D++Y
Sbjct: 413 FIDWIRNTIYLIIDENY 429

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  200 bits (508), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 137/488 (28%), Positives = 235/488 (48%), Gaps = 19/488 (3%)

Query: 5   NPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYL 64
           NPK       N  LPL   K   GL V R +D + I +  I+    +    W+   G Y+
Sbjct: 9   NPKS------NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYV 62

Query: 65  SIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPS 124
           +IFF+ G++ I D  K  +L+A L     NVD   WDR      NE   F+ +I   MP+
Sbjct: 63  AIFFQRGTVMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPT 122

Query: 125 LIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLT 184
           LIQ +    K+    Y P ++ WR    +  KN  +D+H LH S  DSF  +LNG+    
Sbjct: 123 LIQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGE---- 178

Query: 185 LKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKD 244
           LK P    S    A  +IK  N+ + C Y+D + R ID    L  K    L++  + +  
Sbjct: 179 LKLPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINH 238

Query: 245 MSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHY 304
           + KY + H+  ++  +  P+ +FL  +  G   +E ++  L    + G IS EL++W+  
Sbjct: 239 LLKYLKEHIMFIKDNMSTPFNEFLTSV-KGEATQEMMMENLITMLVSGYISTELEEWIRN 297

Query: 305 SVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNS 364
           ++G KN+T+W TL    Y++  ++ T+ ++ ACER ++L  R  GLI  +       DN 
Sbjct: 298 TIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI-EYVIVRNRCDNR 356

Query: 365 RLHELNELMSNLQDMLKSIIYTA----EESANKFEMLKIFLSWLNDRVHEELDDDYKPQL 420
            ++  +  + N++   K  +  A    E+   + ++ + FL W ++ V   + D+     
Sbjct: 357 GVNLNSSYIENVKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDEAVSGN 416

Query: 421 SITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILE 480
            + +N N C  + +  E+ +  G     ++  F+     LE ++ N++ +N  ++EP L 
Sbjct: 417 ILVKNVNNCRDIVEYLEWSMGGGPNRVTELTQFE---KELEVVQENLNLLNQDFVEPALS 473

Query: 481 NKIAIDTK 488
             I+I  +
Sbjct: 474 VAISIGDR 481

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  198 bits (504), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 132/489 (26%), Positives = 248/489 (50%), Gaps = 38/489 (7%)

Query: 14  YNKKLPLY-TEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGS 72
           YN K  L+   +    L++ R SDN  I    ++   L+   +WD I GKYL++F +DGS
Sbjct: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72

Query: 73  IRIIDVFKDGKLVAFLR-------TQFKNVDCTYWDR--IEEQTTNEMKQFNKNIVDLMP 123
           +RI D+F  GKL++FLR       +   ++DC  WDR  I +  ++E++  N ++ + MP
Sbjct: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132

Query: 124 SLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYL 183
           +L++FV  A ++ +IP       WR +    KK  V+D+H  +   +    +++NG+Y +
Sbjct: 133 TLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKK--VVDVHLGYSCSSAQVTILINGEYLI 190

Query: 184 TLKTPETDLSEKVPACSLIKS--ANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241
                + +  +K    SL K     ++Y+  + D S  +ID +  L +   +DL+E  + 
Sbjct: 191 EKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQIK 250

Query: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDW 301
           + +     ++H +L+E+ ++ PY +FLE I     G    ++ L+  FL+G +  +L +W
Sbjct: 251 MTNHFDLIKDHFNLIEKSVLAPYYEFLESI-----GGINDLDVLERLFLIGELDTKLGNW 305

Query: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361
              ++ +KN+ +W  L ++ Y    ++  I  +  CER+++L+ R  G+I     +   +
Sbjct: 306 FKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQESQE 365

Query: 362 DNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLS 421
             + L +++EL S L  +LK +   AE + ++    + FL WL D+V+E ++++YK    
Sbjct: 366 --TSLLDISELQSFLNLVLKLL---AELNEDETYFKQDFLPWLTDKVYESINNEYKSVFF 420

Query: 422 ITQNSN-------------TCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANIS 468
             +  N             T  ++  S    L + K ++E I+N    K +   ++  +S
Sbjct: 421 KAEYGNNKRILNIIKYFEATVIEIDYSLRTHLNKLKDENEKIINL-FQKFSKSSLKTCLS 479

Query: 469 RMNTKYIEP 477
              TK  EP
Sbjct: 480 EFETKLFEP 488

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  144 bits (364), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 124/478 (25%), Positives = 213/478 (44%), Gaps = 56/478 (11%)

Query: 6   PKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLS 65
           PK R   V+N +L LY   G K + V R  D   IA   ++    + G  W+   GK  +
Sbjct: 14  PKHRG-VVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFA 72

Query: 66  IFFRDGSIRIIDVFKDGKLVAFL------RTQFKNVDCTYWDRIE-EQTTNEMKQFNKNI 118
           +FF +G++RI D    G L   +      ++    VD   W   +  Q   E K  N  I
Sbjct: 73  LFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEI 132

Query: 119 VDLMPSLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLN 178
              +P +++ V  A +LS++P       W    A   K+  I +   H  ++  +LM ++
Sbjct: 133 TKQLPGMVRLVRDAKQLSVVPLETGKLRWL---ADPGKDAAIFLG--HDEKSGDYLMTVD 187

Query: 179 GDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLEC 238
           G   L+++ P      K     L +  +  +  +  DG+ + +    FL+S    +L+  
Sbjct: 188 G--LLSVRVPS---GIKKMHKILRQGEDGTFVGVGADGTVQWV-VLRFLNSALMRELIRY 241

Query: 239 ILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDEL 298
              ++ +  Y   ++++ +  +I+PY  FL +I D   G E L +  +   L G I ++L
Sbjct: 242 SGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGE-LASRFRDIILSGYIPEDL 300

Query: 299 QDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERC----------- 347
           +DWL  S+GDKN  +W+ L    Y     +  +A++ ACER+IL +E+            
Sbjct: 301 EDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQE 360

Query: 348 FGLIMAFQFESGADDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDR 407
           FGL    +FES         E+ EL++  Q +L + +    +      +  IF  W  D 
Sbjct: 361 FGLASPQEFESA--------EVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDV 412

Query: 408 VHEELDDDYK-PQ-------------LSITQNSNTCY---KLGKSFEYLLQEGKKDSE 448
           V E +D+DYK PQ             L++ Q  + C+   ++   FE LL +   D++
Sbjct: 413 VMETVDEDYKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADAD 470

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  145 bits (366), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 107/415 (25%), Positives = 192/415 (46%), Gaps = 22/415 (5%)

Query: 13  VYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGS 72
           V+N +L LY     K + V R  D   IA   ++    + GI W+K   K  ++F  +G 
Sbjct: 20  VWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGV 79

Query: 73  IRIIDVFKDGKLVAFL------RTQFKNVDCTYWDRIE-EQTTNEMKQFNKNIVDLMPSL 125
           +RI D    G L   +      +     VD   W  +E  +     +  + +I  LMP +
Sbjct: 80  VRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGM 139

Query: 126 IQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTL 185
           ++ V  + +LSL P      +W  LD K+    +      H  E+  +++ ++G   L  
Sbjct: 140 VRLVRDSKQLSLAPLDLGKLSW--LDGKYGDAAIF---LAHDCESTEYMVAIDGQLSLRF 194

Query: 186 KTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDM 245
            +   ++ + +P     +  +  +  + KDG+ + + T  FL      +L++    ++ +
Sbjct: 195 PSGIRNVHKILP-----QGGSGSFLAVGKDGTLQWV-TLKFLECALMRELVKSSGQIRFL 248

Query: 246 SKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYS 305
            +Y   ++ L    +I+PY  FL ++  GA+  + L   L+   L G I D+L++WL  S
Sbjct: 249 CRYLAENVSLCHTELIEPYRVFLTRLM-GAYEGDDLATRLRDILLTGYIPDDLEEWLCNS 307

Query: 306 VGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNS- 364
           VGDKN  +W+ L    Y     + T+A++ ACER+IL +ER  G+  + + +    D + 
Sbjct: 308 VGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAG 367

Query: 365 --RLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYK 417
                EL  L+S  Q +L+  +    E      + ++F  W  D V E +D+DYK
Sbjct: 368 ELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYK 422

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  140 bits (352), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 107/425 (25%), Positives = 199/425 (46%), Gaps = 24/425 (5%)

Query: 13  VYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGS 72
           V+N  L L+     KG+ V R  D   IA   +K    +    W++  G+  ++   +G 
Sbjct: 19  VWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGI 78

Query: 73  IRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMK---QFNKNIVDLMPSLIQFV 129
           IR+ D    GK V  +     + D   +   ++  T   K    F+  I  LMP L++FV
Sbjct: 79  IRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKFV 138

Query: 130 SSANKLSLIPYTPSNA--NWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKT 187
             + +L+++P    +    W +LD     N+   +   + S+    LM ++G + L+   
Sbjct: 139 KDSRQLTMLPTDVGDGVPRWSKLDG----NKSF-IFLGYDSKRQKILMAIDGAFKLSFSV 193

Query: 188 P-------ETDLSEKVP--ACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLEC 238
                     D  + VP     ++K  N  Y  I  D   +KI    FL+     +++ C
Sbjct: 194 AALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTREMISC 252

Query: 239 ILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDEL 298
              ++ + K     + L++  +++PY  F+E++  GA+  + LI +L      G++  EL
Sbjct: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVL-GAYEGD-LIGDLTELLFTGSVPPEL 310

Query: 299 QDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFES 358
           +DWL  ++GDKN+ +W+ L    Y+   ++  + ++  CER+IL  ER  G+I   +   
Sbjct: 311 EDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKLIG 370

Query: 359 --GADDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDY 416
               +DN  + E  +L+   Q+ L++II + ++      + + F+ W +D V E +D+DY
Sbjct: 371 LKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDY 430

Query: 417 KPQLS 421
           K + S
Sbjct: 431 KRKTS 435

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 86/436 (19%), Positives = 178/436 (40%), Gaps = 50/436 (11%)

Query: 14  YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIK--KWELVAGIYWDKISGKYLSIFFRDG 71
           +N +L L+     + L ++R  D   +    ++  + E +    W+   G+  ++  R G
Sbjct: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSG 79

Query: 72  SIRIIDVFKD------------------GKLVAFLRTQFKNVDCTYWDRIEEQTTNEM-K 112
           S++I     D                  G+  AF   QF       W+RI+ +       
Sbjct: 80  SVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQF------VWNRIKWRVREPFCG 133

Query: 113 QFNKNIVDLMPSLIQF-VSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETD 171
           +F+  +V  +P L +  +S+  KL   P       W    A  + N    M     + T 
Sbjct: 134 EFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESN----MFLTFDNNTR 189

Query: 172 SFLMVLNGDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKS 231
             ++ ++G +       ++    KV   S++    + Y  I  +    ++    F     
Sbjct: 190 KVVLSIDGTFNFRYGE-KSKFPTKV--TSILPGNENHYVFINDEDWQLQVIRLEFTEYHQ 246

Query: 232 CIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGRE---KLINELKIT 288
             +L++C   ++ + KY R++  L+   +++P+  F   +    F  E   K +  LK  
Sbjct: 247 VHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSL----FPEEQFTKFMKGLKDV 302

Query: 289 FLLGTISDE-LQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERC 347
           F LG   D+ +++W    +G      W+   H  +  +  +    ++ ACER+I+ ++R 
Sbjct: 303 FYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRL 362

Query: 348 FGLIMAFQFES-GADDNSRLH--ELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSW- 403
            GL+ + +    G DD++ L   E+ +L+     +LK ++   E+      + K  L+W 
Sbjct: 363 LGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLAWI 422

Query: 404 ---LNDRVHEELDDDY 416
              ++  +H E +D +
Sbjct: 423 EYMMDSLLHNEDEDAH 438

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/348 (20%), Positives = 153/348 (43%), Gaps = 28/348 (8%)

Query: 61  GKYLSIFFRDGSIRIIDVFKD-------------GKLVAFLRTQFKNVDCTYWDRIEEQT 107
           G   ++  R GS+++    +D             G +V   R ++ N++   W+RI+ ++
Sbjct: 69  GDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIV-LGRGEWFNMEQFVWNRIKWKS 127

Query: 108 TNEMK-QFNKNIVDLMPSLIQF-VSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCL 165
               K  F+  +   +P L +  VS   KL+  P       W   +A   +N   +M   
Sbjct: 128 RGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEW---NASLSENES-NMFLT 183

Query: 166 HQSETDSFLMVLNGDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSS 225
           + + T   ++ ++G +    +  E +         L  +AN+ Y  +  +    +I    
Sbjct: 184 YDNATRKVMVSIDGTF--NFRYGEKNKFPTKVTNILSGNANN-YVFLNDEDWQLQIIKLE 240

Query: 226 FLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINEL 285
           F  S    +L++C   ++ + KY R++  ++   +++P+  F+  +        +L+  L
Sbjct: 241 FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQA-SRLLKGL 299

Query: 286 KITFLLGTISDE-LQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLS 344
           K  F LG  +++ +++W    +G   ++ W+   H  +  +  +    ++ ACER+I+  
Sbjct: 300 KDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAV 359

Query: 345 ERCFGLIMAFQFE-SGADDNSRL--HELNELMSNLQDMLKSIIYTAEE 389
           +R  GLI + +    G DD+  L   E++EL+    D L  I+   E+
Sbjct: 360 KRLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEK 407

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 96/215 (44%), Gaps = 24/215 (11%)

Query: 150 LDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKTPETDLSEKVPA--CSLIKSANS 207
           L+++  K + ID+     S+T+  ++ + G   L +K  E     K+P     +IK ++ 
Sbjct: 147 LNSELGKKKPIDIFMAIDSKTNKLILSIEGT--LNIKVGE---KLKLPKDIKRIIKVSSG 201

Query: 208 LYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDF 267
            Y C+ KD S + +D  +FL   +   L++       + +Y +     L   + +PY +F
Sbjct: 202 KYMCLGKDWSYQVLDL-TFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEF 260

Query: 268 LEKICDGAFGREKLINELKITFLLGTISDELQDWLH-YSVGDKNVTQWRTLCHDAYQQTT 326
           +E +      +E+  N L+  F +G    E+ + LH   +    + +W  L +D      
Sbjct: 261 VETLL-----KEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSN-- 313

Query: 327 ELFTIALMCAC-----ERMILLSERCFGLIMAFQF 356
              +I LM AC     ERMI+L+     L  A  +
Sbjct: 314 ---SIGLMVACTIPLLERMIVLAASIEALCEAITW 345

>TDEL0E03120 Chr5 (588819..589439) [621 bp, 206 aa] {ON} Anc_5.315
           YDR298C
          Length = 206

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 66/167 (39%), Gaps = 32/167 (19%)

Query: 174 LMVLNGDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCI 233
           L  L+G Y   L T  +  S  V A S  KS NSL Q I KD   ++I  +  LS++   
Sbjct: 24  LFGLDGTYATALFTAASK-SSSVEAAS--KSLNSLSQTIEKDPKLKEILANPALSAQDRK 80

Query: 234 DLLECILSLKDMSKYT---------RNHLDLLERV------IIKPYLDFLE--------- 269
            + E +  L +M              N LD+  +V      +   Y   ++         
Sbjct: 81  LVAESLAGLPNMDSSVVNLLKVLAENNRLDIFTKVNSQFTTLTDAYNGLIKGTVISAQPL 140

Query: 270 -----KICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGDKNV 311
                K  + A G+ KL+ + K   L  ++  E+Q  L   + DK V
Sbjct: 141 DSKSFKRIEKALGQSKLVGQGKTLKLENSVKPEIQGGLIVEIADKTV 187

>KNAG0I01250 Chr9 complement(236482..241728) [5247 bp, 1748 aa] {ON}
           Anc_1.406 YCL014W
          Length = 1748

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 16/102 (15%)

Query: 100 WDRIEEQTTNEMKQFNK----NIVDLMPSLIQFVSSANKLSLIPYTPSN-------ANWR 148
           W + E+ TT E ++  K    NI+D++ S  +     N  S   +TPS          W 
Sbjct: 410 WQKKEKWTTEENERTAKKSFDNIIDVIDSFGKLEKPTNSYSTRVFTPSGKLLTELAKGWP 469

Query: 149 -ELDAKWKKNRVIDMHCL---HQSETDSFLMVLNGDYYLTLK 186
            EL  KW K RV+ ++ +    Q ET   L++   DY + LK
Sbjct: 470 VELQYKWLKRRVVGVYDIIDTSQMETRKILVIF-SDYLVILK 510

>Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {ON}
           YDR451C (REAL)
          Length = 346

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 146 NWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTL-KTPETDLSEKVPACSLIKS 204
           N R+   K K N     HC   S  DS  M+   D  L +  TP +  SEK  A  L+K+
Sbjct: 214 NKRQAAKKHKNNNGNTSHCKLHSSNDSISMISYSDAALEINSTPAS--SEKAIAAELLKN 271

Query: 205 ANSLYQCIYKD 215
           + S    IY+D
Sbjct: 272 SPSDTSSIYED 282

>KNAG0K00610 Chr11 complement(108809..110299) [1491 bp, 496 aa] {ON}
           Anc_3.78 YNL283C
          Length = 496

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 99  YWDRIEE-QTTNEMKQFNKNIVDLMPSLIQFVSSANKLSLIPYTPSNANWRELDAKWKKN 157
           +W R     +TNE ++F +N     P    F  +    ++IP  P++A W+    K  +N
Sbjct: 347 FWRRRHTGSSTNEYEEFQEN-KQHQP--YSFGETEGGATVIPPVPTSAGWKGASRKASRN 403

Query: 158 RVIDMHCLHQSETDSFLMV-LNGDYYLTLKTPETDLSE 194
            +     L+ SE D  +M    GD   T   P T   E
Sbjct: 404 SI-----LNGSELDDTMMSPRTGDIAQTYSQPSTVFEE 436

>AGR104W Chr7 (932766..935267) [2502 bp, 833 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR103W (STE5)
          Length = 833

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 158 RVIDMHCLHQSETDSFLMVLNGDYYLTLKTP--ETDLSEKVPACSLIKSANSLYQCIYKD 215
           R+I + C H    D  L+ L  +     K P  E D+    PAC   + ++ + +CI KD
Sbjct: 160 RIITLECDHSCHEDCLLVFLEENSSDASKKPNEEDDIYAVFPACKACEYSSGVNKCIPKD 219

Query: 216 GSARKIDTSSFL 227
            + R    S +L
Sbjct: 220 DTLRDKLISQYL 231

>Kpol_2001.15 s2001 complement(41752..43254) [1503 bp, 500 aa] {ON}
           complement(41752..43254) [1503 nt, 501 aa]
          Length = 500

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 53/256 (20%), Positives = 110/256 (42%), Gaps = 43/256 (16%)

Query: 209 YQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFL 268
           Y  I++  S+  I +S+F       ++ E   S+K+ +K ++NH +L  + I+  +L+ L
Sbjct: 201 YSWIWESESSNVITSSNF-------NVSEMNKSIKNTNK-SKNHSELSPQEIVTKFLNKL 252

Query: 269 EKICDGAFGREKLI-------NELKITFLLGTISD---ELQDW-LHYSVGDKNVTQ---- 313
           +KI      ++K +       N L +   L  ++    EL  W +  S G+++ T     
Sbjct: 253 KKIWRNTENKQKFVETFIENCNTLMMKLYLSKLNGFDIELMKWVIEASKGERHETNKIIK 312

Query: 314 -----WRTLCHDAYQQTTELFTIALMC----ACERMI---------LLSERCFGLIMAFQ 355
                W T+      ++  LF I  +     + E+++         ++S+R    I  + 
Sbjct: 313 GKYSNWETMELKLLDKSIRLFNIRSILNDWDSWEKLLEENQSYVTLVVSQRLLKSIQKYN 372

Query: 356 FESGADDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDD 415
            ESG     +      L  ++++ L S +   E+  NK +M  + L      V  +++++
Sbjct: 373 EESGMRKKRKRKRSENLEQDIENNLASQVKNLEQLYNKNDMKLLDLKLQEKHVVHQVEEN 432

Query: 416 --YKPQLSITQNSNTC 429
              K Q    +N+N+ 
Sbjct: 433 KVAKSQTKAVENNNSM 448

>NCAS0I02290 Chr9 (424524..426014) [1491 bp, 496 aa] {ON} Anc_3.127
          Length = 496

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 224 SSFLSSKSCIDLLECILSLKDMS 246
           S+F+SS SCI L EC LSL D++
Sbjct: 14  STFISSISCISLHECFLSLPDLN 36

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 360  ADDNSRLHELNE---LMSNLQDMLK--SIIYTAEESANKFEMLKIFLSWLNDRVHEELDD 414
            ++D SR HE +    LM  ++ + K   I  TA  S++ FE LK+ +    DR+ +E   
Sbjct: 1346 SEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTK 1405

Query: 415  DYKPQLSITQNSNTCYKL--GKSFEYLLQEGKKDSED 449
            +++ +L  T N +T  +    K  E L +E  K+ ED
Sbjct: 1406 EFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYED 1442

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,601,408
Number of extensions: 2987337
Number of successful extensions: 9889
Number of sequences better than 10.0: 74
Number of HSP's gapped: 10233
Number of HSP's successfully gapped: 74
Length of query: 610
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 494
Effective length of database: 40,180,143
Effective search space: 19848990642
Effective search space used: 19848990642
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)