Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B054508.272ON62562530330.0
Kpol_543.448.272ON643991342e-07
Kwal_26.6669singletonON590941332e-07
NCAS0B037808.272ON589841199e-06
TDEL0F039908.272ON631941162e-05
TBLA0F030408.272ON9064401154e-05
AGR076C8.272ON686841092e-04
TPHA0A017508.272ON636701020.001
NDAI0J012808.272ON694221020.001
Suva_2.2798.272ON775117970.004
Smik_4.3638.272ON76534970.005
ZYRO0C01430g8.272ON590554960.006
Skud_4.3798.272ON75994960.006
YDR119W (VBA4)8.272ON768301940.010
Kwal_56.237548.272ON58982930.013
KLTH0G13464g8.272ON59382890.035
Ecym_42988.272ON67884830.18
KNAG0I022502.136ON1061143820.26
SAKL0H16808g8.272ON65733810.38
Smik_11.3585.702ON187856771.2
Ecym_34873.339ON141174742.9
KLLA0A04631g8.272ON57996715.9
NOTE: 1 genes in the same pillar as KAFR0B05450 were not hit in these BLAST results
LIST: KNAG0H03180

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05450
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...  1172   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    56   2e-07
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    56   2e-07
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    50   9e-06
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    49   2e-05
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    49   4e-05
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    47   2e-04
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    44   0.001
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    44   0.001
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...    42   0.004
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...    42   0.005
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    42   0.006
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...    42   0.006
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...    41   0.010
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    40   0.013
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    39   0.035
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    37   0.18 
KNAG0I02250 Chr9 complement(439845..443030) [3186 bp, 1061 aa] {...    36   0.26 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    36   0.38 
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    34   1.2  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    33   2.9  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    32   5.9  

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
           {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/625 (94%), Positives = 592/625 (94%)

Query: 1   MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP 60
           MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP
Sbjct: 1   MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP 60

Query: 61  DHELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLELGS 120
           DHELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLELGS
Sbjct: 61  DHELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLELGS 120

Query: 121 EYGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSPSI 180
           EYGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSPSI
Sbjct: 121 EYGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSPSI 180

Query: 181 SSEFDHLADFFIIFGIYLLAIPIAFYVTSLTIKKYFXXXXXXXXXXXXXXXXXCTYFKGL 240
           SSEFDHLADFFIIFGIYLLAIPIAFYVTSLTIKKYF                 CTYFKGL
Sbjct: 181 SSEFDHLADFFIIFGIYLLAIPIAFYVTSLTIKKYFISSTILSNLLALISSLSCTYFKGL 240

Query: 241 NMLVLSRILFGAACGSCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGTIIPALLLNRNI 300
           NMLVLSRILFGAACGSCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGTIIPALLLNRNI
Sbjct: 241 NMLVLSRILFGAACGSCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGTIIPALLLNRNI 300

Query: 301 LTEWSSMETTITVIFAPLIVSFWLALPKTDKNTFEYSLHGMKMRHYLILLLTLFTTSALY 360
           LTEWSSMETTITVIFAPLIVSFWLALPKTDKNTFEYSLHGMKMRHYLILLLTLFTTSALY
Sbjct: 301 LTEWSSMETTITVIFAPLIVSFWLALPKTDKNTFEYSLHGMKMRHYLILLLTLFTTSALY 360

Query: 361 IIACSSFDFPITYSSLSLWFTYLAVVFYAAKESRNKGIYDAEISCWFLTGAYVSTTSFIF 420
           IIACSSFDFPITYSSLSLWFTYLAVVFYAAKESRNKGIYDAEISCWFLTGAYVSTTSFIF
Sbjct: 361 IIACSSFDFPITYSSLSLWFTYLAVVFYAAKESRNKGIYDAEISCWFLTGAYVSTTSFIF 420

Query: 421 MLMEIQDXXXXXXXXXXXXXXXXGAVVAKKFLEDHIYINMVIQLILLVLQGKVIDVHSFV 480
           MLMEIQD                GAVVAKKFLEDHIYINMVIQLILLVLQGKVIDVHSFV
Sbjct: 421 MLMEIQDLNTKSLYLSLTLSTFLGAVVAKKFLEDHIYINMVIQLILLVLQGKVIDVHSFV 480

Query: 481 TSKTIYLTALTSTLMFSFGVALGSYFSKLNKEKNIITILGEGTTSALFAIIVSGVPFKGI 540
           TSKTIYLTALTSTLMFSFGVALGSYFSKLNKEKNIITILGEGTTSALFAIIVSGVPFKGI
Sbjct: 481 TSKTIYLTALTSTLMFSFGVALGSYFSKLNKEKNIITILGEGTTSALFAIIVSGVPFKGI 540

Query: 541 VQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVF 600
           VQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVF
Sbjct: 541 VQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVF 600

Query: 601 IFNLFCTCIGISFFHLARTHKQSSI 625
           IFNLFCTCIGISFFHLARTHKQSSI
Sbjct: 601 IFNLFCTCIGISFFHLARTHKQSSI 625

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582
           +T     + + G  F+  +   LK ++ ++   +HS DEL   I KA  S EW++  SP 
Sbjct: 532 STGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPS 591

Query: 583 LISTSIFSCYLDSIRYVFIFNLFCTCIGISFFHLARTHK 621
            I  ++  CY  + + VFIF L CT        + + H+
Sbjct: 592 FIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHR 630

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 76/354 (21%), Positives = 123/354 (34%), Gaps = 71/354 (20%)

Query: 1   MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP 60
           MGKKDKQRK+LR F + K  Q   D                            P     P
Sbjct: 1   MGKKDKQRKKLRNFTKAKVKQVQEDQE--------------------------PMVPDPP 34

Query: 61  DHELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLEL-- 118
           + +      GTES  F   L  ++ L + D   S    I D+       L +  S EL  
Sbjct: 35  EFD------GTES--FVQTLAETSQLTKEDDENSVLLPIRDE-------LLQDPSTELPG 79

Query: 119 --GSEYGSIDFENSVAKDGNFNVCQAHQI-----KISATRLHFIIACICISMLSLGADFS 171
              +E    + E    + G++   ++ +I     ++S  RL  I+  + + +     D +
Sbjct: 80  FIAAEIEEGEQEYEETRSGHYGAIESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNT 139

Query: 172 FTLVSSPSISSEFDHLADFFIIFGIYLLAIPIAFYVTSLTIKKYFXXXXXXXXXXXXXXX 231
                   I+SEF+ L     +   YLL        +S T +  +               
Sbjct: 140 IVSTLLAHIASEFNELPRISWVATAYLL--------SSATFQPIYGKISDIFGRKVVLIF 191

Query: 232 XXCTYFKG---------LNMLVLSRILFGAACGSCCYIDLTLCEKLVPTNTKNKYSNIAL 282
              T+F G            LV  R + G   G    +       +VP   +  Y  I  
Sbjct: 192 CNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRNRALYQGICN 251

Query: 283 AHFGLGT----IIPALLLNRNILTEWSSMETTITVIFAPLIVSFWLALPKTDKN 332
            +FGLGT    ++     +R++    S +       F+ +++  +L LPK  K 
Sbjct: 252 FYFGLGTALGGVVGGWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKG 305

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582
           TT  +    ++G  F+  +++N+   + ++L  +HS  EL   I+KAL S +W+   SP+
Sbjct: 485 TTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKALRSSDWVNNGSPE 544

Query: 583 LISTSIFSCYLDSIRYVFIFNLFC---TCIGISF 613
            +  ++  CY ++    F F L C   T I  SF
Sbjct: 545 FVHEALLKCYENACGQTFRFCLLCFLLTVISCSF 578

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa]
          {ON} Anc_8.272 YDR119W
          Length = 589

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 22/84 (26%)

Query: 1  MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP 60
          MG+KDKQRK+LR+F +LKE QRL                     LE K++   P   ++P
Sbjct: 1  MGRKDKQRKKLREFAKLKEKQRL---------------------LENKIHHATPNGTQKP 39

Query: 61 DHELQRIKKGTESCLFSPKLTTSN 84
            EL  +++  E    +P L TSN
Sbjct: 40 TSELNTVQQ-LEPEESTPLLKTSN 62

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%)

Query: 528 FAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLISTS 587
             + + G  F+  + +   R + +Y+  +H  +EL   I KA  S EW+   +PD I  +
Sbjct: 521 LGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSAPDFIRQT 580

Query: 588 IFSCYLDSIRYVFIFNLFCTCIGISFFHLARTHK 621
           +  CY  + +  F+F   C+ + +  F + +  K
Sbjct: 581 LLECYHKACKNTFLFCFICSILTLVSFSIIKEKK 614

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 103/293 (35%), Gaps = 49/293 (16%)

Query: 1   MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEP 60
           MGKKDKQR +LR+F + K+ Q+          K  +L    P+         +  +  EP
Sbjct: 1   MGKKDKQRNKLREFTRQKQLQQ--------AKKNDMLEETRPL---------VAPSSAEP 43

Query: 61  DHELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLELGS 120
                      E+ L  P          TDL     E I  +              E+ +
Sbjct: 44  ----------IEASLLLPIKPEILQDPSTDLPGFVAEEIGQQE-------------EVAN 80

Query: 121 EYGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSPSI 180
            YGSI   +         V  A +I  S  RL  I+  + + +     D +    +S  +
Sbjct: 81  GYGSITDPHDGDNKSERPVSTAEEI--SGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHV 138

Query: 181 SSEFDHLADFFIIFGIYLLA----IPIAFYVTSLTIKKYFXXXXXXXXXXXXXXXXXCTY 236
           +SEF+ L+    I   YLL+     P+   V+ +  +K                   C  
Sbjct: 139 ASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLM---CGL 195

Query: 237 FKGLNMLVLSRILFGAACGSCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGT 289
            K    LV++R + G   G    +       LVP   +  Y  I    +GLGT
Sbjct: 196 SKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGT 248

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 95/440 (21%), Positives = 166/440 (37%), Gaps = 102/440 (23%)

Query: 234 CTYFKGLNMLVLSRILFGAACGSCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGT---- 289
           C     LNMLV  R + G   G    +       +VP  ++  Y  I    FGLGT    
Sbjct: 479 CGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGG 538

Query: 290 IIPALLLNRNI---LTEWSSMETTITVIFAPLIVSFWLALPKTDKNTFEYSLHGMKMRH- 345
           +I  + ++      +  WS  +  ++ +   LI SF L +P+  KN +E SL    MR  
Sbjct: 539 VIGGIFVDHQYGWRMVFWS--QVPVSGLSTLLICSF-LVVPRI-KN-YEVSLGRKLMRVD 593

Query: 346 -----YLILLLT---LFTTSALYI---IACSSFDFPITYSSLSLWFTYLAVVFYAAKES- 393
                 +IL LT   L TT    I   I    F + I +SS+S     L  +F A+    
Sbjct: 594 WLGSISMILWLTSFLLITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVL 653

Query: 394 -----RNKGIYDAEISCWFLTGAYVSTTSFIFM----LMEIQDXXXXXXXXXXXXXXXXG 444
                 N+ +  A +  +F    +++   ++ +    +++I                  G
Sbjct: 654 PLRFLSNRSVLGASLGNFFCVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALG 713

Query: 445 AVVAKKFLED------------------HIYINMV-------IQLILLVLQGK------V 473
           ++ A  +++                   H Y+ ++       +Q +L+VL G       V
Sbjct: 714 SLGAGVYMKQTGKYYWFVVLFALVSTLGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIV 773

Query: 474 IDVHSFVTSKTIYLTALTSTLMFSF-------GVALGSYFSKLNKEKNIITILGEGTTSA 526
           + + + + +      A T+++ ++F       GVALGS                      
Sbjct: 774 VALLAMIAAVPHKHQAATTSISYAFRSTGGTLGVALGSSV-------------------- 813

Query: 527 LFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLIST 586
                     F   + + L  ++ +Y+  +H   EL   IKKA  S EW+   +P  I  
Sbjct: 814 ----------FHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEWVHRKAPTFIRD 863

Query: 587 SIFSCYLDSIRYVFIFNLFC 606
           ++ +CY  +   VF+F   C
Sbjct: 864 TLITCYDVACHDVFVFCTAC 883

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%)

Query: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582
           +T +   + + G  F+  +   L  +L      +H   EL   I+KA  S EW+ +++P+
Sbjct: 545 STGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPE 604

Query: 583 LISTSIFSCYLDSIRYVFIFNLFC 606
                +  CY  + RY F F L C
Sbjct: 605 FARHILIDCYHYAGRYTFHFCLAC 628

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/338 (21%), Positives = 129/338 (38%), Gaps = 35/338 (10%)

Query: 2   GKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEPD 61
           G K KQR RLR+F + KE QR          +  +  +A P + + +     P A ++  
Sbjct: 7   GLKTKQRDRLREFAKRKERQRALAGQN----QAGVGQDAQPARRQHR-----PRAGEQSG 57

Query: 62  HELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLELGSE 121
             L    +GT   L S   +  + L  ++L +   + +     A + +   S S    ++
Sbjct: 58  --LLEASRGT---LVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATSGSGSSYGSTQ 112

Query: 122 YGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSPSIS 181
             +  +  + A +      +     + ATR   ++A +C+ +     D +        I+
Sbjct: 113 KPTEVYLTATAVE----AAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIA 168

Query: 182 SEFDHLADFFIIFGIYLLA----IPIAFYVTSLTIKKYFXXXXXXXXXXXXXXXXXCTYF 237
           SEF+ L     I   YLL+     P+   ++ +  ++                   C   
Sbjct: 169 SEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRR---PLLVFSNLVFCLGALICGMS 225

Query: 238 KGLNMLVLSRILFGAACG---SCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGTI---- 290
           K L +LVL R + G   G   S C I  T    +VP  ++  Y  I    FGLGT     
Sbjct: 226 KNLWVLVLGRFVAGIGGGGLTSMCSITTT---DIVPLRSRALYQGICNVFFGLGTACGGL 282

Query: 291 IPALLLNRNILTEWSSMETTITVIFAPLIVSFWLALPK 328
           +  L  +R +    + +      + +   +  +L LPK
Sbjct: 283 VGGLFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%)

Query: 555 GDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVFIFNLFCTCIGISFF 614
           G++S  EL   I  A  S++W+  ++P     +I  CY  + + VF+F L C+ + +   
Sbjct: 547 GNYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLSI 606

Query: 615 HLARTHKQSS 624
            + + HK  S
Sbjct: 607 SMIKEHKLHS 616

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON}
          Anc_8.272
          Length = 694

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%)

Query: 1  MGKKDKQRKRLRKFVQLKEAQR 22
          MG+KDKQRKRLR F +LKE QR
Sbjct: 1  MGRKDKQRKRLRDFAKLKEKQR 22

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 49/117 (41%), Gaps = 17/117 (14%)

Query: 1   MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKL-----------ETKL 49
           MGKKD+QRK+LR+F +LK  Q+        + KE    +  P  L           E   
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFGNLKREEASE 60

Query: 50  NATLPTAKKEPDHELQRIKKGTESCLFSPKLTTSNP-LRETDLSLSTNERIIDKSVA 105
           N+ L  A  EP     R   G ++   +   T S P L E   S+ T    I+  +A
Sbjct: 61  NSPLLPAPSEP-----REGSGPKTLNINANDTRSLPELPENSTSVETESDDIEGKLA 112

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 555 GDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVFIFN--LFCTCIGIS 612
           G H  D LK  I+ A  S +W+ E +P  I  ++  CYL + R VF  +  LF   +   
Sbjct: 710 GYHEKDLLKI-IEHATQSSDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMTM 768

Query: 613 FF 614
           FF
Sbjct: 769 FF 770

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
          (REAL)
          Length = 765

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 1  MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKE 34
          MGKKD+QRK+LR+F +LK  QR   +    + KE
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQRNLKESVQNLKKE 34

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 533 SGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCY 592
           +G  F   +   +  E+ ++    +   +L   IK A  S  W+ + +P  I  ++  CY
Sbjct: 677 AGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECY 736

Query: 593 LDSIRYVFIFN-LFCTCIGISFFHLARTH 620
           L + R VF  + LF T   ++ F   R H
Sbjct: 737 LQACRNVFKLSALFFTITVVTLFFFNRIH 765

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%)

Query: 150 TRLHFIIACICISMLSLGADFSFTLVSSPSISSEFDHLADFFIIFGIYLLAIPIA 204
           TR     +C+C  +  +  D S  LV +  I+SEF  L    ++  +YLL   I 
Sbjct: 252 TRKRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAIG 306

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 110/554 (19%), Positives = 206/554 (37%), Gaps = 103/554 (18%)

Query: 119 GSEYGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSP 178
           G++YGSID E+  ++DG           +   +L  I   + + +    AD +       
Sbjct: 52  GTDYGSIDNEDD-SRDG------VASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMA 104

Query: 179 SISSEFDHLADFFIIFGIYLLAI----PIAFYVTSLTIKKYFXXXXXXXXXXXXXXXXXC 234
            I+SEF+ L     I   YLL+     P+   ++ +  +K                    
Sbjct: 105 HIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

Query: 235 TYFKGLNMLVLSRILFGAACG---SCCYIDLTLCEKLVPTNTKNKYSNIALAHFGLGTII 291
             F GL   V +R + G   G   S C I ++    +VP   +  Y  +    FGLGT  
Sbjct: 165 PSFWGL---VGARFISGIGGGGVTSMCSITIS---DIVPLRDRALYQGMCNFFFGLGTAC 218

Query: 292 PALLLNRNILTEWSS-----------METTITVIFAPLIVSFWLALPKTDKNTFEYSLHG 340
                   ++  W S           ++  ++ + + LI  F    P++ +     S+  
Sbjct: 219 ------GGVVGGWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKN 272

Query: 341 MKMR------HYLILLLTLFTTSALYI---IACSSFDFP--ITYSSLSLWFTYLAVVFYA 389
             +         L++ L+LF  +A      IA +S  F      SSL+  F ++ V  Y 
Sbjct: 273 KLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAF-FIGVELYG 331

Query: 390 AKES-------RNKGIYDAEISCWFLTGAYVSTTSFIFM----LMEIQDXXXXXXXXXXX 438
           AK+        RN+ +  +  S WF   A ++T+ ++ +    ++ +             
Sbjct: 332 AKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNF 391

Query: 439 XXXXXGAVVAKKFLE------------------DHIYINMV-------IQLILLVLQGKV 473
                G++ A  +++                   H+ IN++        Q ILLV+ G  
Sbjct: 392 FSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPG-- 449

Query: 474 IDVHSFVTSKTIYLTALTSTLMFSFGVALGSYFSKLNKEKNIITILGEGTTSALFAIIVS 533
                +    T+ L A+ + +  +   A  S                  +T +   + + 
Sbjct: 450 ---FGYSVLITVALLAMIAAVPHNHHAATTSISYAFR------------STGSTLGVSIG 494

Query: 534 GVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYL 593
           G  F+  +   L R++ ++    H   EL   I+KA  S EW+ + +P+ I  ++  CY 
Sbjct: 495 GAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYH 553

Query: 594 DSIRYVFIFNLFCT 607
            + +  F+F   C+
Sbjct: 554 FACKDTFLFCTLCS 567

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 522 GTTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSP 581
           G       I + G  F   + ++L  E+ ++    +   +L   IK A  S +W+ E +P
Sbjct: 660 GAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAP 719

Query: 582 DLISTSIFSCYLDSIRYVFIFN-LFCTCIGISFF 614
             I  ++  CYL + R VF  + +F T + IS F
Sbjct: 720 KFIFKTLIECYLQACRNVFKLSAVFFTIMVISMF 753

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 25/97 (25%)

Query: 1  MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETIL-----ANAIPIKLETKLNATLPT 55
          MGKKD+QRK+LR+F +LK  Q+   +    +  E         N  PI +E         
Sbjct: 1  MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIEN-------- 52

Query: 56 AKKEPDHELQRIKKGTESCLFSPKLTTSNPLRETDLS 92
                       K  E+   +P L TS+  RE D S
Sbjct: 53 ------------DKSEENKENTPLLLTSSERREDDGS 77

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 150 TRLHFIIACICISMLSLGADFSFTLVSSPSISSEFDHLADFFIIFGIYLLAIPIA 204
           TR     +C+C  +  +  D S  LV    I+SEF  L    +I  +YLL+  I 
Sbjct: 246 TRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG 300

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 104/301 (34%), Gaps = 98/301 (32%)

Query: 1   MGKKDKQRKRLRKFVQLKEAQR---------------------------LFDDPTTPIAK 33
           MGKKD+QRK+LR+F +LK  QR                           L +D    I +
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60

Query: 34  ETILANAIPIKLETKLNATL-------------PTAKKEPDHELQRIK-----KGTESCL 75
            + L +A   + E  +   +             P     P  E+  IK     K  E  L
Sbjct: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120

Query: 76  FSP---------------------------KLTTSN-PLRETDLSLSTN---ERIIDKSV 104
             P                            +T+ N P+ E +L +S++   ER  D  V
Sbjct: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180

Query: 105 A----ITTSLRESHSLELGSE------------YGSI-----DFENSVAKDGNFNVCQAH 143
                 T+S +  H +    E            YGSI     D EN +      N   + 
Sbjct: 181 VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENT-SSD 239

Query: 144 QIKISATRLHFIIACICISMLSLGADFSFTLVSSPSISSEFDHLADFFIIFGIYLLAIPI 203
           ++    TR     +C+C  +  +  D S  LV +  I+SEF  L    ++   YLL+  I
Sbjct: 240 ELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAI 299

Query: 204 A 204
            
Sbjct: 300 G 300

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 566 IKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVF-IFNLFCTCIGISFFHLARTHKQS 623
           IK A  S +W+ E +P  +  ++  CYL + R VF +  LF T   ++ F   R H +S
Sbjct: 703 IKHATESSDWVHESAPKFVFQTLIECYLQACRNVFKLSTLFFTITVVAIFIFNRIHCRS 761

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 39/82 (47%)

Query: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582
           +T A   + +    F+  +   L+ ++ Q+   +H  +EL   I  A  S  W+ +++P+
Sbjct: 482 STGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVHKEAPE 541

Query: 583 LISTSIFSCYLDSIRYVFIFNL 604
            +  ++  CY  + +  F F L
Sbjct: 542 FVRATLVECYHYASKSTFKFCL 563

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 36/82 (43%)

Query: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582
           +T A   + V    F+  +   L  ++ ++    HS  EL+  I  A  S +W+   +P 
Sbjct: 486 STGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPP 545

Query: 583 LISTSIFSCYLDSIRYVFIFNL 604
            +  ++  CY  + R  F F L
Sbjct: 546 FVRATLLECYHFASRATFKFCL 567

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%)

Query: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582
           +T A+    + G  F+  ++  L   +       H   +L + I KA  S +W+  +SP+
Sbjct: 556 STGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPE 615

Query: 583 LISTSIFSCYLDSIRYVFIFNLFC 606
                + SCY    + +F F++ C
Sbjct: 616 YAIPILISCYHYVCKRIFTFSVVC 639

>KNAG0I02250 Chr9 complement(439845..443030) [3186 bp, 1061 aa] {ON}
           Anc_2.136 YNL132W
          Length = 1061

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 65/143 (45%), Gaps = 25/143 (17%)

Query: 448 AKKFLEDHIYINMVIQLILLVLQGKVIDVHSFVTSKTIYLTALTSTLMFSFGVALGSYFS 507
           +   L+ H+ ++M+  +  L   GK+          +I+L+++ S ++ + G+       
Sbjct: 848 SNNLLDYHVIVDMLPMIAFLYFGGKM--------GTSIHLSSVQSAILLAIGL------- 892

Query: 508 KLNKEKNIITILGE-----GTTSALFAIIVSGVP--FKGIVQENLKRELSQYLPGDHSVD 560
              + K++  I GE       T A+FA ++  +   FK +++E++ + L    P D +V 
Sbjct: 893 ---QHKSVDKITGELGLPSNQTIAMFAKVMRKISVYFKNLIREHVGQSLPSEAPKDETVA 949

Query: 561 ELKYAIKKALSSVEWIREDSPDL 583
           E+     K L + E   +   DL
Sbjct: 950 EMNGEEVKVLDAAETFDQMEEDL 972

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
          {ON} weakly similar to uniprot|Q04602 Saccharomyces
          cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 2/33 (6%)

Query: 4  KDKQRKRLRKFVQLKEAQR--LFDDPTTPIAKE 34
          K+KQRK+L+ FV+LKE QR  L D+P   I + 
Sbjct: 8  KNKQRKKLQAFVKLKERQRQLLNDEPKVVIQQN 40

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 34.3 bits (77), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 15   VQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTA-KKEPDHELQRIKK 69
            ++++E Q+  +D      KE   +N+I I    +L A + T  +KE D+ELQ IKK
Sbjct: 1578 IRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKK 1633

>Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON}
            similar to Ashbya gossypii ADL316C
          Length = 1411

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 506  FSKLNKEKNIITILGEGTTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYA 565
            FSK  +E N+I I G  ++ A    I   +  + +   + K++ S +LP D  +DEL++ 
Sbjct: 1240 FSK-KQENNVIIIGGSKSSYASVWDISKSICREVLFPADAKQDPSDFLPVDKGLDELEFQ 1298

Query: 566  IKKALSSVEWIRED 579
                L++V +I  D
Sbjct: 1299 SSSFLTTVSFIHVD 1312

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 14/96 (14%)

Query: 519 LGEGTTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIRE 578
           LG    +ALF   +SG  F  +    +K E  +Y     S + L   IK+A  S E++  
Sbjct: 478 LGVSVGAALFRNKLSGSLFDSV----MKFESDKY-----SKEYLLSIIKQASESSEYVHA 528

Query: 579 DSPDLISTSIFSCYLDSIRYVFIFNLFCTCIGISFF 614
           ++P  I  ++  CY  + +  F F     C  IS F
Sbjct: 529 NAPKFIQATLIQCYEQACKSTFAF-----CFLISIF 559

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,533,043
Number of extensions: 2394317
Number of successful extensions: 9467
Number of sequences better than 10.0: 35
Number of HSP's gapped: 9765
Number of HSP's successfully gapped: 56
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)