Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B054408.273ON66663472e-44
CAGL0B01875g8.273ON7453972e-06
Kpol_YGOB_YDR119W-A8.273ON7537800.001
NDAI0J012908.273ON7535790.001
Ecym_42978.273ON7449750.006
Kwal_YGOB_YDR119W-A8.273ON7466720.013
Suva_2.2808.273ON6637690.035
YDR119W-A (COX26)8.273ON6637670.060
SAKL0H16786g8.273ON7431680.064
Smik_4.3648.273ON6537660.095
TBLA0F030308.273ON7532630.28
TPHA0A017408.273ON7939640.29
KLTH0G13442g8.273ON7466630.34
Skud_4.3808.273ON6637620.36
KNAG0H031708.273ON7136620.47
KLLA0F19371g8.273ON8042610.71
TDEL0F040008.273ON6226581.5
NOTE: 3 genes in the same pillar as KAFR0B05440 were not hit in these BLAST results
LIST: ZYRO0D06908g NCAS0B03770 KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05440
         (66 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...   138   2e-44
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    42   2e-06
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    35   0.001
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    35   0.001
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    33   0.006
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    32   0.013
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    31   0.035
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    30   0.060
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    31   0.064
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    30   0.095
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    29   0.28 
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    29   0.29 
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    29   0.34 
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    28   0.36 
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    28   0.47 
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    28   0.71 
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    27   1.5  

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score =  138 bits (347), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MPNKQLFRTLNFARFYAATSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVI 60
          MPNKQLFRTLNFARFYAATSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVI
Sbjct: 1  MPNKQLFRTLNFARFYAATSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVI 60

Query: 61 YYSRRR 66
          YYSRRR
Sbjct: 61 YYSRRR 66

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 42.0 bits (97), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 11 NFARFYAATSKTHAQ-HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
          +  R  ++T++T AQ  IGP +   + K+   T+  W +FL V LGWP  IY+
Sbjct: 17 SMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYF 69

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
          HIG  +   +AK+   TI  WGT L   L WP +IY+
Sbjct: 33 HIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYH 69

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 35.0 bits (79), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 28 GPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
          G P++  + ++   TI  W TFL+V LGWP+  YY
Sbjct: 33 GLPWVSSEIQRVAPTILRWSTFLVVVLGWPAPFYY 67

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 11 NFARFYAATSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSV 59
          N     AATSK    HIG P++  + K+ V TI  WG  +   L WP +
Sbjct: 20 NIGARRAATSK----HIGEPWMVTETKRLVPTILIWGGTMTGILLWPII 64

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 32.3 bits (72), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 1  MPNKQLFRTLNFARFYAATSKTHA---------QHIGPPYLYLKAKQDVKTIAAWGTFLL 51
          M + Q+ R++   +  AATS + A               +  ++AK+ V T+A W T + 
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 52 VALGWP 57
          + LGWP
Sbjct: 61 IMLGWP 66

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 31.2 bits (69), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 8/37 (21%), Positives = 20/37 (54%)

Query: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
           +G  ++  ++++ +  +  WG  +   LGWP  +Y+
Sbjct: 23 RVGEAWMITESRRLIPEVFQWGAVICTCLGWPGAVYF 59

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 30.4 bits (67), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
           IG  ++  + ++ +  I  W   L V LGWP  +Y+
Sbjct: 23 RIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYF 59

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 30.8 bits (68), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 27 IGPPYLYLKAKQDVKTIAAWGTFLLVALGWP 57
          +G P+   +AK+ V TI  WG  +   LGWP
Sbjct: 35 LGEPWAITEAKRLVPTIFLWGASMAAVLGWP 65

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 30.0 bits (66), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 9/37 (24%), Positives = 20/37 (54%)

Query: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
           +G  ++  + ++ +  +  W   L + LGWPS +Y+
Sbjct: 23 RVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYF 59

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 28.9 bits (63), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 35 KAKQDVKTIAAWGTFLLVALGWP-SVIYYSRR 65
          + K+ V  IA W T L V+LGWP   ++Y  R
Sbjct: 35 EVKRIVPNIAFWATLLSVSLGWPFCFVWYQDR 66

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 29.3 bits (64), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 24 AQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
          + H+G  ++  +AK+    +  WG+ +   L WPS I Y
Sbjct: 31 SSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKY 69

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 28.9 bits (63), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 9/66 (13%)

Query: 1  MPNKQLFRTLNFARFYAAT--SKTHAQHI--GPP-----YLYLKAKQDVKTIAAWGTFLL 51
          M + Q+ +++   +  AA+  S++ ++ +  GP      +  ++AK+ V  I  WG F+ 
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60

Query: 52 VALGWP 57
            LGWP
Sbjct: 61 AVLGWP 66

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 28.5 bits (62), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 8/37 (21%), Positives = 19/37 (51%)

Query: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62
           +G  ++  + ++ +  +  W   L + LGWP  +Y+
Sbjct: 23 RVGESWVITEGRRLIPEVLQWSAALSICLGWPGAVYF 59

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 28.5 bits (62), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 10/36 (27%), Positives = 19/36 (52%)

Query: 22 THAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWP 57
          +    +GP +   + K+ +  +A WG+ L + L WP
Sbjct: 23 SSGGRVGPGFYRTEIKRRIPQVALWGSGLFLVLEWP 58

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 28.1 bits (61), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 19 TSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVI 60
          T+    + +G  +   +A++   TI  +GTF++  LGWP ++
Sbjct: 25 TAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGWPFLV 66

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 26.9 bits (58), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 35 KAKQDVKTIAAWGTFLLVALGWPSVI 60
          +AK+    I  WG FL   LGWP  I
Sbjct: 30 EAKRLTPAILGWGGFLAGCLGWPFAI 55

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.137    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,204,596
Number of extensions: 176909
Number of successful extensions: 426
Number of sequences better than 10.0: 17
Number of HSP's gapped: 426
Number of HSP's successfully gapped: 17
Length of query: 66
Length of database: 53,481,399
Length adjustment: 39
Effective length of query: 27
Effective length of database: 49,009,425
Effective search space: 1323254475
Effective search space used: 1323254475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)