Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B053708.286ON32932915690.0
TDEL0F041308.286ON3283297622e-99
Skud_4.3878.286ON3363357571e-98
NCAS0B035908.286ON3293297517e-98
YDR126W (SWF1)8.286ON3363317101e-91
TBLA0D040408.286ON3293317065e-91
ZYRO0D06600g8.286ON3303216918e-89
TPHA0C010708.286ON3333136841e-87
Suva_2.2898.286ON3353156796e-87
NDAI0J010008.286ON3393226736e-86
Smik_4.3728.286ON3353146702e-85
KLLA0F19690g8.286ON3243256282e-79
Kpol_1033.168.286ON3213076282e-79
CAGL0B01991g8.286ON3303095943e-74
KNAG0H031108.286ON3313365753e-71
Ecym_42828.286ON3403425598e-69
KLTH0G13112g8.286ON3493495599e-69
SAKL0H16434g8.286ON5552875741e-68
AGR065W8.286ON3263215464e-67
Kwal_56.236978.286ON3383155362e-65
NCAS0C029208.389ON3741242142e-18
KAFR0H019808.389ON361542052e-17
ZYRO0C04092g8.389ON3661322034e-17
NDAI0G022508.389ON389532018e-17
YLR246W (ERF2)8.389ON3591952001e-16
Kwal_23.33028.389ON3531301982e-16
Skud_12.3218.389ON3561911972e-16
KNAG0A027108.389ON3541111954e-16
CAGL0G08217g8.389ON326541945e-16
TDEL0F051308.389ON359971955e-16
TPHA0C023608.389ON4041271956e-16
Suva_10.3428.389ON3561951946e-16
SAKL0H13860g8.389ON352991937e-16
Ecym_41788.389ON368661931e-15
Smik_12.3068.389ON359541921e-15
KLTH0F08668g8.389ON358541921e-15
Skud_15.1596.28ON3791991912e-15
Smik_15.1676.28ON3781471903e-15
TBLA0H009208.389ON3601151875e-15
KLLA0D18370g8.389ON355691876e-15
Ecym_20143.12ON3391221867e-15
NCAS0D021406.28ON3761071841e-14
Kwal_56.224596.28ON3831491814e-14
KAFR0A051306.28ON3961251814e-14
TPHA0P015603.12ON3311201794e-14
YOL003C (PFA4)6.28ON3781641805e-14
AGL125C8.389ON367541787e-14
KLLA0C06204g6.28ON3771561762e-13
TDEL0G044106.28ON3811431752e-13
NDAI0C026506.28ON3891251752e-13
NDAI0G013403.12ON3351311733e-13
KNAG0F029306.28ON386691743e-13
TPHA0J003906.28ON380711733e-13
SAKL0E01518g6.28ON3791431724e-13
CAGL0E02497g6.28ON3761451709e-13
Suva_15.1726.28ON398661691e-12
KLTH0F19580g3.12ON3421261672e-12
Kpol_1037.236.28ON378701672e-12
TDEL0A003103.12ON329601663e-12
TBLA0H001503.12ON345531653e-12
ZYRO0C07546g6.28ON377661663e-12
Smik_14.63.12ON3341631628e-12
Kwal_55.221263.12ON3601241629e-12
ACL003C6.28ON3751951602e-11
YNL326C (PFA3)3.12ON3361051592e-11
KLLA0E02069g3.12ON3251271582e-11
NCAS0E013003.12ON3271361573e-11
Suva_14.153.12ON3301391565e-11
Skud_14.153.12ON3361051565e-11
KAFR0A085903.12ON331481556e-11
Kpol_1014.293.12ON326601556e-11
KNAG0K025703.12ON3281371547e-11
KLTH0C10978g6.28ON3771771541e-10
ADL197C3.12ON3901301541e-10
SAKL0C13596g3.12ON333601522e-10
Ecym_30326.28ON3771411478e-10
CAGL0D02508g3.12ON332641432e-09
ZYRO0C03410g3.12ON327521423e-09
TBLA0B004806.28ON377891343e-08
Ecym_41145.579ON3721781263e-07
KAFR0I011105.579ON3701431238e-07
Skud_4.7345.579ON3801201122e-05
CAGL0M08712g5.626ON7631551122e-05
KNAG0C028305.579ON354601112e-05
NCAS0F013905.579ON3741231103e-05
Kpol_1004.575.579ON3621621094e-05
CAGL0K06347g5.579ON352671077e-05
TDEL0A044405.579ON3651051032e-04
YDR459C (PFA5)5.579ON3741271032e-04
Smik_4.5155.626ON7641941043e-04
TBLA0E028305.579ON386641024e-04
Suva_2.6345.579ON388831005e-04
ZYRO0C11132g5.626ON759161990.001
KAFR0H005705.626ON75756980.001
KLTH0G04972g5.579ON36775970.001
Smik_4.7375.579ON378149960.002
ZYRO0D13860g5.579ON36596950.002
Kpol_526.325.626ON77755950.003
NDAI0H018905.579ON40667930.004
SAKL0G06160g5.579ON36452920.005
Kwal_47.183665.579ON35652920.006
ABR203W5.579ON35954910.007
KLLA0D06149g5.579ON34976910.008
NDAI0H008505.626ON78655920.008
Skud_4.5275.626ON76455910.010
YDR264C (AKR1)5.626ON76455900.012
TPHA0C003705.626ON75959900.013
SAKL0G07326g5.626ON73755900.013
Suva_2.4325.626ON76355880.023
KNAG0B031405.626ON682151870.024
YOR034C (AKR2)5.626ON74956860.037
TBLA0J008305.626ON739146860.038
KNAG0C062305.626ON75259860.039
Suva_8.875.626ON73053850.045
KLTH0E02420g5.626ON73451820.10
KLLA0E16721g5.626ON75255820.12
TDEL0A049205.626ON75050820.13
Smik_15.2135.626ON74456800.19
NCAS0C052805.626ON75760790.26
Ecym_13305.626ON73955760.70
AER388C5.626ON72448741.1
Skud_15.1995.626ON74148722.0
SAKL0C05918g1.199ON87544722.2
KAFR0C059605.626ON72751676.9
Kpol_1004.695.309ON443122677.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B05370
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   608   0.0  
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   298   2e-99
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   296   1e-98
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     293   7e-98
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   278   1e-91
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   276   5e-91
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   270   8e-89
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   268   1e-87
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   266   6e-87
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   263   6e-86
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   262   2e-85
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   246   2e-79
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   246   2e-79
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   233   3e-74
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   226   3e-71
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   219   8e-69
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   219   9e-69
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   225   1e-68
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   214   4e-67
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   211   2e-65
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     87   2e-18
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    84   2e-17
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    83   4e-17
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     82   8e-17
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    82   1e-16
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    81   2e-16
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    80   2e-16
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    80   4e-16
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    79   5e-16
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    80   5e-16
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    80   6e-16
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    79   6e-16
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    79   7e-16
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    79   1e-15
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    79   1e-15
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    79   1e-15
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    78   2e-15
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    78   3e-15
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    77   5e-15
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    77   6e-15
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    76   7e-15
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    75   1e-14
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    74   4e-14
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    74   4e-14
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    74   4e-14
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    74   5e-14
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    73   7e-14
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    72   2e-13
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    72   2e-13
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      72   2e-13
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      71   3e-13
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    72   3e-13
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    71   3e-13
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    71   4e-13
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    70   9e-13
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    70   1e-12
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    69   2e-12
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    69   2e-12
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    69   3e-12
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    68   3e-12
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    69   3e-12
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    67   8e-12
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    67   9e-12
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    66   2e-11
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    66   2e-11
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    65   2e-11
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    65   3e-11
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    65   5e-11
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    65   5e-11
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    64   6e-11
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    64   6e-11
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    64   7e-11
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    64   1e-10
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    64   1e-10
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    63   2e-10
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    61   8e-10
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    60   2e-09
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    59   3e-09
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    56   3e-08
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    53   3e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    52   8e-07
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    48   2e-05
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    48   2e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    47   2e-05
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    47   3e-05
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    47   4e-05
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    46   7e-05
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    44   2e-04
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    44   2e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    45   3e-04
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    44   4e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    43   5e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    43   0.001
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    42   0.001
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    42   0.001
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    42   0.002
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    41   0.002
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    41   0.003
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    40   0.004
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    40   0.005
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    40   0.006
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.007
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    40   0.008
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    40   0.008
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    40   0.010
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    39   0.012
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    39   0.013
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    39   0.013
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    39   0.023
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    38   0.024
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    38   0.037
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    38   0.038
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    38   0.039
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    37   0.045
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    36   0.10 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    36   0.12 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    36   0.13 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    35   0.19 
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    35   0.26 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    34   0.70 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    33   1.1  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    32   2.0  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    32   2.2  
KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa] ...    30   6.9  
Kpol_1004.69 s1004 complement(148244..149575) [1332 bp, 443 aa] ...    30   7.7  

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/329 (90%), Positives = 299/329 (90%)

Query: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXX 60
           MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPI   
Sbjct: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYV 60

Query: 61  XXXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSP 120
                       KLNPIIKSQLTILERWV               TMRIRPESSLGFNSSP
Sbjct: 61  TLYTYMVLLYFTKLNPIIKSQLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSP 120

Query: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180
           YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF
Sbjct: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180

Query: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240
           YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD
Sbjct: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240

Query: 241 GMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVN 300
           GMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVN
Sbjct: 241 GMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVN 300

Query: 301 FRPITHHDEIPNIYDKGSFLKNLKELCKY 329
           FRPITHHDEIPNIYDKGSFLKNLKELCKY
Sbjct: 301 FRPITHHDEIPNIYDKGSFLKNLKELCKY 329

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  298 bits (762), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 144/329 (43%), Positives = 204/329 (62%), Gaps = 7/329 (2%)

Query: 2   MFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXX 61
           +F +LL + V +QII LLLSP  K  W FS+YY RIF P L++D++++WK+++VP     
Sbjct: 3   LFSVLLFLVVAAQIIVLLLSPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLS 62

Query: 62  XXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPY 121
                       + P+I ++L  +E+                 +M ++ ++S G      
Sbjct: 63  LYCYIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSA 122

Query: 122 QDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFY 181
           Q++++D +++YPN  C TC +EKPARS+HCN+C  CVL++DHHC+W NNCIG GNYQ+FY
Sbjct: 123 QEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFY 182

Query: 182 TFLVSNTLLLGYAFLRIILLTAYSD---IGFPNIVLTFLILSGAFFAILLVFTYLQFALV 238
            FLV N + L Y FLR++ ++   D   + +P  +L F IL G F  I  VFTYLQ  LV
Sbjct: 183 AFLVVNVISLSYGFLRVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLV 242

Query: 239 YDGMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCP 298
            DGMTT EKDKW+TIQ+ MREG L+RT +GQ+ I   + P     +FYSTNAYD  +Y P
Sbjct: 243 NDGMTTGEKDKWYTIQQIMREGNLVRTLDGQFFIQDQQNP----NQFYSTNAYDSKLYVP 298

Query: 299 VNFRPITHHDEIPNIYDKGSFLKNLKELC 327
            N+  +    +I NIYD+GSF   L+ LC
Sbjct: 299 QNYSIVNDPKDITNIYDQGSFWYKLERLC 327

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  296 bits (757), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 203/335 (60%), Gaps = 10/335 (2%)

Query: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXX 60
           M++ +L  + ++S ++ +L SP  K  W FS  Y+R+F PF+ DD+KY+WK+HLVP+   
Sbjct: 1   MLWNVLF-VLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYT 59

Query: 61  XXXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSP 120
                       K+ P+IK+ L +LER +                M  + E S       
Sbjct: 60  SIYLYLVYTYHAKVEPLIKNDLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGS 119

Query: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180
            + + +D LI+YP+  CSTCR+ KPARS+HC+ICNRC+L++DHHCIW NNCIG GNY  F
Sbjct: 120 TEKYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQF 179

Query: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240
           Y FL+SN + + YAFLR+  ++  S    P  VLT  IL G F  I  +FTYLQ A+V +
Sbjct: 180 YLFLISNIVSMSYAFLRLCSISLKSSTALPRAVLTLSILCGCFTIICAIFTYLQLAIVRE 239

Query: 241 GMTTNEKDKWFTIQEFMREGRLIRT---DNGQWLIAHPE-----EP-AGQATRFYSTNAY 291
           GMTTNE+DKW+TIQE+MREG+L+R+   D   W +   E     EP   Q   FYSTNAY
Sbjct: 240 GMTTNEQDKWYTIQEYMREGKLVRSLNDDPQSWFLKLTEKGDAAEPLQDQQGTFYSTNAY 299

Query: 292 DHTIYCPVNFRPITHHDEIPNIYDKGSFLKNLKEL 326
           DH  Y  +++  I    EI N+YDKG+FL N  +L
Sbjct: 300 DHKRYILMHYITIKDASEITNVYDKGTFLANFTDL 334

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  293 bits (751), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 203/329 (61%), Gaps = 2/329 (0%)

Query: 2   MFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXX 61
           M   +  + ++SQ+I LL+SP  +  W FS YY+++F P ++D++K+K K++++PI    
Sbjct: 1   MIEYICLLLIVSQVILLLISPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFV 60

Query: 62  XXXXXXXXXXXKLNPIIKSQLTILERWV-XXXXXXXXXXXXXXXTMRIRPESSLGFNSSP 120
                      K+ P I +QL   E+++                TM  +P  +  ++   
Sbjct: 61  LYLYLIYCYYSKVAPFINNQLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEI 120

Query: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180
             ++ FD+LIFYP   C TC+  KPARSKHC+IC+RCVL++DHHCIW NNC+G GNY YF
Sbjct: 121 DNEYAFDNLIFYPQILCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYF 180

Query: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240
           Y FL++NT  L YAF+R++ +   +++  P   LT  IL G F  I  +FT+LQ  L  +
Sbjct: 181 YMFLITNTFSLTYAFIRLLTIFYTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQE 240

Query: 241 GMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEP-AGQATRFYSTNAYDHTIYCPV 299
           GMTTNEKDKWFT+ EFMR+G+L+RT +G+W  A P +    + + FYSTN YDHT Y   
Sbjct: 241 GMTTNEKDKWFTVHEFMRDGKLVRTQSGRWYFADPHDSDISEDSVFYSTNGYDHTEYTLR 300

Query: 300 NFRPITHHDEIPNIYDKGSFLKNLKELCK 328
           NF  I     I NIYD+G FL NL++LCK
Sbjct: 301 NFEIIEDPSRITNIYDRGDFLANLRDLCK 329

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  278 bits (710), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 198/331 (59%), Gaps = 10/331 (3%)

Query: 6   LLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXX 65
           LL + +I  ++ +LLSP  K  W FS +Y+ +F PFL DD+KY+WK HLVP+        
Sbjct: 5   LLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLY 64

Query: 66  XXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFE 125
                  ++   IK++L +LER +                M  R E S    S   +++ 
Sbjct: 65  LVYTYHMRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYP 124

Query: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           +D L++YP   CSTCR+ KPARSKHC+ICNRCVL++DHHCIW NNCIG GNY  FY FL+
Sbjct: 125 YDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184

Query: 186 SNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTN 245
           SN   + YAFLR+  ++  S    P  VLT  IL G F  I  +FTYLQ A+V +GMTTN
Sbjct: 185 SNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTN 244

Query: 246 EKDKWFTIQEFMREGRLIRT---DNGQWLIAHPE------EP-AGQATRFYSTNAYDHTI 295
           E+DKW+TIQE+MREG+L+R+   D   W     E      EP   Q   FYSTNAYDH  
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKH 304

Query: 296 YCPVNFRPITHHDEIPNIYDKGSFLKNLKEL 326
           Y   ++  I    EIPNIYDKG+FL NL +L
Sbjct: 305 YNLTHYITIKDASEIPNIYDKGTFLANLTDL 335

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  276 bits (706), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 199/331 (60%), Gaps = 5/331 (1%)

Query: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXX 60
           M F   L + VI QI+ L +SP  K     S YY+  + P ++D++KY+WK+H+VPI   
Sbjct: 1   MGFGTFLVVLVILQILILFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYI 60

Query: 61  XXXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSP 120
                       K+ P+I  +LT  ER+                TM I P+++L +++  
Sbjct: 61  TLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDS 120

Query: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180
            + + +D ++++P+T C TC++EKPARSKHC +C++C+L++DHHC+W NNCIG GN+ YF
Sbjct: 121 IKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYF 180

Query: 181 YTFLVSNTLLLGYAFLRIILLT---AYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFAL 237
           Y FL  NTL + YA +R++ +T     +    P  V+T  IL G F  I   F+Y+Q  +
Sbjct: 181 YLFLFDNTLFMSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLI 240

Query: 238 VYDGMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYC 297
           V DGMTTNEKDKW+TIQ  M + +L+++ +  W I+   +     T FYSTNAYDH  Y 
Sbjct: 241 VKDGMTTNEKDKWYTIQCLMEDKKLVKSSDNNWYISFVNDQG--ETEFYSTNAYDHKKYQ 298

Query: 298 PVNFRPITHHDEIPNIYDKGSFLKNLKELCK 328
              ++ I + ++IPNIYDKGS  KN K+ C+
Sbjct: 299 LTEYKVIDNVEDIPNIYDKGSLWKNFKDFCE 329

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  270 bits (691), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 137/321 (42%), Positives = 190/321 (59%), Gaps = 5/321 (1%)

Query: 11  VISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXX 70
           +I QI  LL+SP  K  W FS YY+ +F+P  +D+ +++WK++LVP+             
Sbjct: 9   LILQIAVLLISPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSIYLGVVHLA 68

Query: 71  XXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDSLI 130
              + P +   L   + W                   I PE++          F +D+L+
Sbjct: 69  IKNVIPQLSPGLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNIDKFRYDNLL 128

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLL 190
           FYPN  C TC+L KPARSKHCN+CN+CVL  DHHCIW NNC+GLGNY YFY FLV N+L 
Sbjct: 129 FYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLS 188

Query: 191 LGYAFLRIILLTAYS-DIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDK 249
           + YAF+R + +     +I +P  +L F +L+G F  I +VFTYLQ  +V +GMTTNEKDK
Sbjct: 189 MSYAFIRSMSIVGLKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVREGMTTNEKDK 248

Query: 250 WFTIQEFMREGRLIRTDNGQW---LIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITH 306
           WFTI E+MRE RL+++ +G+W   L    + P  Q   F+STN YD  +Y   ++  I  
Sbjct: 249 WFTIHEYMREKRLVKSSSGKWYYDLTDRLDLPTDQH-EFFSTNPYDGRLYRLQSYTLIED 307

Query: 307 HDEIPNIYDKGSFLKNLKELC 327
            + I NIYD+GSF+ NL+ LC
Sbjct: 308 AERINNIYDEGSFMANLRTLC 328

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  268 bits (684), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 185/313 (59%), Gaps = 6/313 (1%)

Query: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPIIKS 80
           SP LK  W FS YY+R++VP+LKD   YKWKYH+VP                K+  +I +
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 81  QLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPY----QDFEFDSLIFYPNTF 136
            L + ER +               TM  +P +  G   S +      F FD++I++    
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNV 138

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           CSTC +EKPARSKHCNIC  C+LL DHHCIW NNCIGLGNY+YF+ FL+ NT+ L YAFL
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 197 RIILLT-AYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQE 255
           R++ +T +  D+     +L   IL+G+F  I  VF YLQ   V +GMTTNE DKW+ +QE
Sbjct: 199 RLLHITLSKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYAVQE 258

Query: 256 FMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVN-FRPITHHDEIPNIY 314
            MREG+LI++++  W     E+     ++ YSTN YD+  Y   N +  +    EIPN+Y
Sbjct: 259 LMREGKLIKSEDNNWFALSTEDAPDSPSQVYSTNFYDNKTYKISNDYHIVKDASEIPNVY 318

Query: 315 DKGSFLKNLKELC 327
           D+G+FL NLK  C
Sbjct: 319 DRGTFLDNLKGFC 331

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  266 bits (679), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 186/315 (59%), Gaps = 9/315 (2%)

Query: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPIIKS 80
           SP  K  W FS +Y+R+F PF+ DD KY+WK+HLVP+               ++ P+IK+
Sbjct: 20  SPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKN 79

Query: 81  QLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTC 140
           +L +LER +                M  + E S        + + +D L++YP   CSTC
Sbjct: 80  ELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTC 139

Query: 141 RLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIIL 200
           R  K ARSKHC+ICNRCVL++DHHCIW NNCIG GNY  FY FL SN   + YAFLR+  
Sbjct: 140 RTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF 199

Query: 201 LTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREG 260
           ++  S    P  VLT  IL G F  I  +FTYLQ A+V +GMTTNE+DKW+TIQE+MREG
Sbjct: 200 ISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259

Query: 261 RLIRT---DNGQWLIAHPEEP------AGQATRFYSTNAYDHTIYCPVNFRPITHHDEIP 311
           +L+R+   D+  W +   E+         Q   FYSTNAYDH  Y   ++  I    EI 
Sbjct: 260 KLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEIT 319

Query: 312 NIYDKGSFLKNLKEL 326
           NIYDKG+FL NL +L
Sbjct: 320 NIYDKGTFLANLVDL 334

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  263 bits (673), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 185/322 (57%), Gaps = 15/322 (4%)

Query: 18  LLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPI 77
           LLLSP  K    FS YY+ +F P ++D  +Y+WKYHLVP                K+ P+
Sbjct: 18  LLLSPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEPL 77

Query: 78  IKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQD-----FEFDSLIFY 132
           I SQL  +E W+               TM   P +    N+   Q+     + +D +++Y
Sbjct: 78  IASQLYFIEVWIWIPFMIFSPVIFGILTMVTIPNT---VNNRRNQEKVLYRYPYDEIMYY 134

Query: 133 PNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLG 192
           PN  C TC + KPARSKHC ICN C+LL DHHC+W NNCIG GNY YFY+FL+ N + + 
Sbjct: 135 PNIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMT 194

Query: 193 YAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFT 252
           Y+F+R+ L+           +LT LIL G+F  I   FT+LQ  LV DGMTTNE+DKWFT
Sbjct: 195 YSFIRLFLMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFT 254

Query: 253 IQEFMREGRLIRT-DNGQWLIAHPEEPA----GQATRFYSTNAYDHTIY--CPVNFRPIT 305
           +QE+MR+G+LIRT D  +W IA+P + A       T FYSTNAYDH  Y      +  + 
Sbjct: 255 LQEYMRDGKLIRTKDENKWFIANPNDDATITINADTIFYSTNAYDHEGYHLSSDEYTIVE 314

Query: 306 HHDEIPNIYDKGSFLKNLKELC 327
              +I N+YD G F  NLK+ C
Sbjct: 315 DPRQITNLYDSGDFFTNLKDFC 336

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  262 bits (670), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 188/314 (59%), Gaps = 8/314 (2%)

Query: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPIIKS 80
           SP  K  W FS +Y+ +F PF+ DD+KY+WK+HLVPI               ++  +++S
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTLIYLYLVYTYHTRVEWLVRS 79

Query: 81  QLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTC 140
           +L + ER +                M  + E S        + + +D L++YP   CSTC
Sbjct: 80  ELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGSTEKYPYDYLLYYPVVKCSTC 139

Query: 141 RLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIIL 200
            + KPARSKHC+ICNRC+L++DHHCIW NNCIG GNY  FY FL+SN   L YAFLR+  
Sbjct: 140 HIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFLRLWC 199

Query: 201 LTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREG 260
           ++  S    P  VLT  IL G F  I ++FTYLQ  +V +GMTTNE+DKW+TIQE+MREG
Sbjct: 200 ISLNSKTALPRAVLTLTILCGCFTIICIIFTYLQLTIVREGMTTNEQDKWYTIQEYMREG 259

Query: 261 RLIRT--DNGQ-WLIAHPEEPAGQATR-----FYSTNAYDHTIYCPVNFRPITHHDEIPN 312
           +L+R+  DN Q W +   E+   + T+     FYSTNAYDH  Y   ++  I    EI N
Sbjct: 260 KLVRSLNDNCQSWFLKLTEDDTTKLTQDQHATFYSTNAYDHKQYNLAHYITIKDASEISN 319

Query: 313 IYDKGSFLKNLKEL 326
           IYDKG+FL N  +L
Sbjct: 320 IYDKGTFLANFTDL 333

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  246 bits (628), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 184/325 (56%), Gaps = 8/325 (2%)

Query: 2   MFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXX 61
           MF + L +FV+SQ+  L+ SP  K+  LF +YYQ I+ P   D  +Y+WKY LVP     
Sbjct: 1   MFLLFL-LFVVSQVGLLVFSPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYAC 59

Query: 62  XXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPY 121
                      KLN  +   L  LE+                 ++ ++P   LG  + P 
Sbjct: 60  ILIFCVHLFYNKLNDTVNPYLYSLEK-AFIPITIAFTSLTGVASVFVKP---LGLQAGP- 114

Query: 122 QDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFY 181
             F+ D +IF+P+  C TC+  K  RSKHC IC RC+ L DHHCIW NNC+G GNY+YFY
Sbjct: 115 -QFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173

Query: 182 TFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDG 241
           +FL+SN LLL YA LR++ L   +        L+  +L+ AF  I +VFTY Q  LV DG
Sbjct: 174 SFLLSNCLLLTYASLRLLTLFRITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDG 233

Query: 242 MTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATR-FYSTNAYDHTIYCPVN 300
           MT NE+DKW+ +QE+MR G L++  +G          A  A   FYSTN YDH+ Y  +N
Sbjct: 234 MTNNEQDKWYLVQEYMRNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLIN 293

Query: 301 FRPITHHDEIPNIYDKGSFLKNLKE 325
              I  H+EI N+YD+GSFL NLKE
Sbjct: 294 PAKILSHEEIINLYDRGSFLDNLKE 318

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  246 bits (628), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 171/307 (55%), Gaps = 6/307 (1%)

Query: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPIIKS 80
           SP  K  W  S YY + + PF  D  +Y+WKY+LVP                ++N ++  
Sbjct: 19  SPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNP 78

Query: 81  QLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTC 140
            L   E+ +               TM  +PE+S+    +    + FD ++++PN  C TC
Sbjct: 79  HLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTC 138

Query: 141 RLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIIL 200
           R  KPARSKHC+IC++C+LL DHHCIW NNCIG+GNY++FY F+  N+L + Y F R++ 
Sbjct: 139 RKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLLF 198

Query: 201 LTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREG 260
           ++    +     +LT  IL G+F  I  VFTYLQ  LV  G+TTNE DKW+TI E+ R+G
Sbjct: 199 ISIKYKVTSSRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYCRDG 258

Query: 261 RLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPNIYDKGSFL 320
           +L R+ +G W +            FYSTN YDHT Y P  +  I    +I NIYDKGS  
Sbjct: 259 KLARSKSGNWFLIDSNN------TFYSTNIYDHTRYSPTQYTIINDPTDIQNIYDKGSCW 312

Query: 321 KNLKELC 327
            N  ++C
Sbjct: 313 LNFIDIC 319

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  233 bits (594), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 178/309 (57%), Gaps = 7/309 (2%)

Query: 22  PTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPIIKSQ 81
           P  ++ ++F +YY  ++ P + D+ +Y+ K+++VP+               +   II   
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 82  LTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTCR 141
           LT +E +V               +M I+P+SS        + + +D+L+++P   C TC+
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 142 LEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIILL 201
             KPARSKHC +CN C+ L+DHHC+W NNC+G+GNY YFY+FL SN LLL Y+F+R+I +
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 202 ----TAYSDIGFPNIVLTFL-ILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEF 256
               +AY+        L  L IL G+F  IL V+ Y  F LV  GMTTNEKDKW  + ++
Sbjct: 201 QFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHDY 260

Query: 257 MREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPNIYDK 316
           +  G L+R   G++ I +  +  G    FYST++YD T Y  V++  +    EI NIYDK
Sbjct: 261 INTGDLVRDPEGKYFIKY--QNGGNNYEFYSTDSYDGTQYTIVDYFTVKSPAEITNIYDK 318

Query: 317 GSFLKNLKE 325
           G+F+ NL+E
Sbjct: 319 GNFINNLRE 327

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  226 bits (575), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 131/336 (38%), Positives = 191/336 (56%), Gaps = 14/336 (4%)

Query: 2   MFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXX 61
           M+  LL I  + Q+  LLLSP  +  W  S+YY++++ PFL D  +Y+ KY++VP+    
Sbjct: 1   MWTQLLLILAVLQVFLLLLSPLARLQWPLSWYYEKVYRPFLADPTRYRVKYYIVPVFYFS 60

Query: 62  XXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNS--S 119
                      +L P+I  +L  +E +                TM  RPE   G +   +
Sbjct: 61  LYCYMLNLYRSELLPVIWGRLYFIELYFFQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVA 120

Query: 120 PYQ-DFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQ 178
           P +  + +D +++YPNT C +C   K ARSKHC+IC RC+ L+DHHCIW N CIG GN+ 
Sbjct: 121 PSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFF 180

Query: 179 YFYTFLVSNTLLLGYAFLRIILLTAYSDIGFPNI-VLTFLILSGAFFAILL-VFTYLQFA 236
           YFY FL  + L+L YAF R+      +D    +      L++    FA+L+ +FTY Q  
Sbjct: 181 YFYVFLACHCLILTYAFARLFFFVVVADNKLTSTRSTLTLLMLTGTFALLVDLFTYWQMM 240

Query: 237 LVYDGMTTNEKDKWFTIQEFMREGRLIRTD-NG---QWLIAHPEEPAGQATRFYSTNAYD 292
           LV +GMTTNE+DKWF I E+MR+G+ +    NG   +W +   E+      +FYSTNAYD
Sbjct: 241 LVKEGMTTNEQDKWFLIHEYMRDGKCVNVSCNGSTKKWFLESDED-----GKFYSTNAYD 295

Query: 293 HTIYCPVNFRPITHHDEIPNIYDKGSFLKNLKELCK 328
           HT Y   N+  + +  EI N+YDKGSF +N K++C+
Sbjct: 296 HTAYTLTNYHIVKNASEIINMYDKGSFWENFKDMCR 331

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  219 bits (559), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 180/342 (52%), Gaps = 19/342 (5%)

Query: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXX 60
           M   ++L +  + QI+ +L+SP  K +  F +YY  +F P  + + +YKWKY LVP    
Sbjct: 1   MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT 60

Query: 61  XXXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSP 120
                        +   I+S L  LE                  T+   P  ++ +    
Sbjct: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEA-RCLPVVLALPLLSGYYTIVTSPHDTITYVGP- 118

Query: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180
             +  FD +IF+ N  C +CRL+K ARSKHC+IC RC+L++DHHC+W NNCIGLGNYQYF
Sbjct: 119 --EIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYF 176

Query: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240
           Y FL+SN  +L YA +R+  +            L+ +IL   F  I + FTY+QFALV D
Sbjct: 177 YLFLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRD 236

Query: 241 GMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQAT-------------RFYS 287
           GMTTNEKDKW+TI + MR  +L++ +N        +     ++              +YS
Sbjct: 237 GMTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYS 296

Query: 288 TNAYDHTIY--CPVNFRPITHHDEIPNIYDKGSFLKNLKELC 327
           TN YD   Y     ++  +  + +IPNIYD+ SF +NLK+ C
Sbjct: 297 TNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  219 bits (559), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 126/349 (36%), Positives = 183/349 (52%), Gaps = 33/349 (9%)

Query: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXX 60
           M   + + I +I Q++  L SP  +   +F +YY R+F P  +D  +++WK+  +P    
Sbjct: 1   MKMGLFIWILIIPQLVLSLFSPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYL 60

Query: 61  XXXXXXXXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSP 120
                        +  +I+S+L  +ER +               T+ I+P+S+    +SP
Sbjct: 61  SIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTIWIKPKSTY---ASP 117

Query: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180
             D  +D LIF+    C TC+L K AR+KHC IC++CV L+DHHC+WANNCIG GNYQYF
Sbjct: 118 MLD-AYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYF 176

Query: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240
           Y FLVSN  L  Y FLR++ L  +        +L   IL G F  IL VF+Y QF LV D
Sbjct: 177 YLFLVSNVFLTNYGFLRLLFLQRFVH---SRQLLILSILLGCFGVILAVFSYFQFVLVRD 233

Query: 241 GMTTNEKDKWFTIQEFMREGRLIRTDNGQW---LIAHPEEPAGQATR------------- 284
           GMTTNE++KW  I + +R  +++  D G++   L+A  +E + ++               
Sbjct: 234 GMTTNEENKWLVIHDMIRARQMVTDDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFH 293

Query: 285 ----------FYSTNAYDHTIYCPVNFRPITHHDEIPNIYDKGSFLKNL 323
                     +YSTN YD+  Y   N + I     I NIYD+G F KNL
Sbjct: 294 LNDSSPDIYVYYSTNPYDNATYDVKNPKEILSTAAITNIYDEGGFWKNL 342

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  225 bits (574), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/287 (42%), Positives = 163/287 (56%), Gaps = 9/287 (3%)

Query: 9   IFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXX 68
           +FV+ QI+ LL SP  K    F +YY  IF P  KD  +Y+WKY++VP+           
Sbjct: 7   LFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVL 66

Query: 69  XXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDS 128
                L   +   L  LER++                M I P+S+            FD 
Sbjct: 67  MFYKDLYRDLSPYLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTKSLADCR---VPFDE 123

Query: 129 LIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNT 188
           +IF+P T C TC   KPARSKHC+ICN+C+L+ DHHCIW NNCIG GNY+YFY FL+SN 
Sbjct: 124 IIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNV 183

Query: 189 LLLGYAFLR---IILLTAYSDIGF-PNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTT 244
            LL Y+FLR   I L++   +I   P +VLT  IL+G F  I+ VF Y QF LV+DGMTT
Sbjct: 184 TLLSYSFLRLTSIQLMSQTENIKTKPMLVLT--ILTGCFDIIVAVFGYTQFNLVHDGMTT 241

Query: 245 NEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAY 291
           NE+DKWFT+QEFMR+G L+R   G +     +E +    +    ++Y
Sbjct: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSY 288

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 253 IQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPN 312
           +    RE  L + D G     H      +  RFYSTN YD   Y   ++  I    ++ N
Sbjct: 480 VNALGRELDLAK-DIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNN 538

Query: 313 IYDKGSFLKNL 323
           IYDKG+F  NL
Sbjct: 539 IYDKGNFWANL 549

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  214 bits (546), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 118/321 (36%), Positives = 166/321 (51%), Gaps = 17/321 (5%)

Query: 7   LNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXX 66
           L    ++Q   +L +P L+ +W FS+YY  +F   L+D ++++WKY   P          
Sbjct: 5   LCALAVTQAGLILAAPALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYC 64

Query: 67  XXXXXXKLNPIIKSQLTILERWVXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEF 126
                 ++   I   L + ERWV                            ++   D  +
Sbjct: 65  VWLFYGEVYAEIAKALWVPERWVLPAAVVAPAAAGVAAAA---------TPAAVPADAAY 115

Query: 127 DSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS 186
           D L+F+    C TCR+ KPARS+HC +C RCV L+DHHC+W NNC+G GNY  FY  L +
Sbjct: 116 DGLLFHDGVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGA 175

Query: 187 NTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNE 246
           +  LL Y  +R+ L        +P  +L   +L  +F  + + FT  Q ALV DGMTTNE
Sbjct: 176 HCALLTYGAVRLPLAAPAGR--WPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNE 233

Query: 247 KDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVN--FRPI 304
           +DKW+ +QE MREG L+R         H  E  G    FYSTNAYDH  Y   N  +  +
Sbjct: 234 QDKWYAVQESMREGTLVRLRG---RFYHRVE-GGDGVEFYSTNAYDHRTYALHNEPYAVV 289

Query: 305 THHDEIPNIYDKGSFLKNLKE 325
           T H+EIPN+YD GSF +NL++
Sbjct: 290 TSHEEIPNVYDTGSFCENLRQ 310

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  211 bits (536), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 167/315 (53%), Gaps = 25/315 (7%)

Query: 29  LFSFYYQRIFVPFLKDDRKYKWKYHLVPIXXXXXXXXXXXXXXXKLNPIIKSQLTILERW 88
           +F +YY+ +F P  +D  K+++K+H+VPI                +  +I S+L  +ERW
Sbjct: 27  VFKWYYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSRLYAIERW 86

Query: 89  VXXXXXXXXXXXXXXXTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTCRLEKPARS 148
                           TM ++PES+     +P  D +FD ++F+    C TC++ K ARS
Sbjct: 87  FIIPVALMTPISCGLLTMLVKPESTY---IAPPVD-QFDGILFHAGVECRTCKMPKYARS 142

Query: 149 KHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIILLTAYSDIG 208
           KHC IC RC  L+DHHC+WANNCIG GNY+YFY FL SN  L  Y F R++ L       
Sbjct: 143 KHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLLYLQPTVK-- 200

Query: 209 FPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREGRLIRTDNG 268
               +LT  +L G+F  IL++F+Y Q  L+ DGMTTNE+ KW  + + MR  +L+  + G
Sbjct: 201 -SRTLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLVVDNAG 259

Query: 269 QWLIAHPEEPAGQATR------------------FYSTNAYDHTIYCPVNFRPITHHDEI 310
           ++    PE     +                    FYSTN YD+  Y     R I  ++EI
Sbjct: 260 KFYYRIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKYPREIVDYEEI 319

Query: 311 PNIYDKGSFLKNLKE 325
            NIYDKGSF  NLK+
Sbjct: 320 TNIYDKGSFCNNLKD 334

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 8/124 (6%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C TCR+ +P RS HC+IC  CVL+ DHHC+W NNC+G  NY+YF TFL S+TL   +  
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

Query: 196 LRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQE 255
           +   +  A +       V   LI+ G      L   Y    L+Y    T  +    T +E
Sbjct: 243 VNAAIDVARTPDVTDTPVAVLLIVYG-----FLTIWYPMILLMYHVFMTGTQQ---TTRE 294

Query: 256 FMRE 259
           ++++
Sbjct: 295 YLKQ 298

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (75%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           +C TCR+ +P R+ HC+IC  CV+  DHHCIW NNC+G  NY+YF TFL+S TL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTL 230

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 82.8 bits (203), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 68/132 (51%), Gaps = 21/132 (15%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C++CR+ +P R+ HC+ C  C+L  DHHCIW NNCIG  NY+YF  FL S       A 
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLAS-------AI 232

Query: 196 LRIILLTA------YSDIGFPNIV-LTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKD 248
           L  I L A      Y     P+ V +T L+L     AI+    Y    L+Y  + T  + 
Sbjct: 233 LSSIFLIANCSIHIYHHRNLPSKVPVTILLLIYGGLAII----YPMLLLIYHILMTGRQQ 288

Query: 249 KWFTIQEFMREG 260
              T +EF+RE 
Sbjct: 289 ---TTREFLREA 297

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 82.0 bits (201), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNT 188
           +C+TCR+ +P RS HC+IC  C++  DHHCIW NNCIG  NY++F TFL+S T
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGT 268

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 83/195 (42%), Gaps = 51/195 (26%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C +CR+ +P RS HC+ CN CV++ DHHCIW NNCIG  NY++F  F      LLG   
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIF------LLGAIL 227

Query: 196 LRIILLTAYSDIGFPNIVLTFLILSGA----FFAILLVFTYLQFALVYDGMTTNEKDKWF 251
             +ILLT        N  +     SG       AILL        L Y G+T       F
Sbjct: 228 SSVILLT--------NCAIHIARESGGPRDCPVAILL--------LCYAGLTLWYPAILF 271

Query: 252 TIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIP 311
           T   FM   +                   Q TR +           PV  R +       
Sbjct: 272 TYHIFMAGNQ-------------------QTTREFLKGIGSKK--NPVFHRVVKEE---- 306

Query: 312 NIYDKGSFLKNLKEL 326
           NIY+KGSFLKN+  L
Sbjct: 307 NIYNKGSFLKNMGHL 321

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 70/130 (53%), Gaps = 16/130 (12%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSN----TLLL 191
           +C TCR+ +P R+ HC++C  C+L  DHHC W NNCIG  NY+YF TFLVS+     + +
Sbjct: 172 YCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVICI 231

Query: 192 GYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWF 251
               +RI   T    +    ++L +  L   +  +LL++           +T+ ++    
Sbjct: 232 VSCAIRIAHATRLVKVAVAILLLIYCALCSCYPFLLLLYHVF--------LTSTQQ---- 279

Query: 252 TIQEFMREGR 261
           T +E+++ GR
Sbjct: 280 TTREYLKGGR 289

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 80.5 bits (197), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 79/191 (41%), Gaps = 43/191 (22%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C +CR+ +P R+ HC+ CN CV++ DHHC+W NNC+G  NY++F  FL+S      +  
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

Query: 196 LRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQE 255
               +  A    G  N  +  L+                  L+Y G+T       FT   
Sbjct: 234 TNCAIHIARESDGPRNYPVALLL------------------LIYAGLTIWYPAILFTYHI 275

Query: 256 FMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPNIYD 315
           FM   +                   Q TR +           PV  R +       NIYD
Sbjct: 276 FMAGTQ-------------------QTTREFLKGIGSKK--NPVFHRVVKEQ----NIYD 310

Query: 316 KGSFLKNLKEL 326
           +GSFLKNL  L
Sbjct: 311 RGSFLKNLGHL 321

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 79.7 bits (195), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C+ C++ +P R+ HC IC  CV   DHHC W NNC+G  NY+YF TFL +        F
Sbjct: 185 YCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLF 244

Query: 196 LRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNE 246
           +   +  ++     P +++ +  ++  +  +LLV+      +   G TT E
Sbjct: 245 VSSAIHLSHETRAVPIVLVAYSGIALWYPLVLLVY---HVCMTATGQTTRE 292

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           +C TC++ +P R+ HC++C  CVL  DHHCIW NNC+G  NY+YF  FL+S+TL
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTL 212

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 2/97 (2%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL--LLGY 193
           +C++CR+ +P R+ HC+ C  CV+  DHHCIW NNC+G  NY+YF  FL+   L  L   
Sbjct: 180 YCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLI 239

Query: 194 AFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVF 230
           A   I +    S +    ++L +  LS  + AILL +
Sbjct: 240 ANCSIHIARRSSQVPVTILLLVYACLSILYPAILLGY 276

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (52%), Gaps = 10/127 (7%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYA 194
           T+C TCR+ +P RS HC+IC+ CV+  DHHC+W NNC+G  NY+YF  FL S  + + + 
Sbjct: 194 TYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFL 253

Query: 195 FLRI---ILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWF 251
            +     I    +      NI +T L+      +I      L + LV  G  TN+     
Sbjct: 254 LINTGIHIGKNRHEKKPASNIPVTILLTVYGSLSISYPIILLAYHLVLTG--TNQ----- 306

Query: 252 TIQEFMR 258
           T +EF++
Sbjct: 307 TTREFLK 313

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 79.3 bits (194), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 85/195 (43%), Gaps = 51/195 (26%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C++CR+ +P RS HC+ CN CV++ DHHCIW NNCIG  NY++F  FL+S        F
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAI------F 227

Query: 196 LRIILLTAYSDIGFPNIVLTFLILSGA----FFAILLVFTYLQFALVYDGMTTNEKDKWF 251
             I+LL         N  +     SG       AILLV         Y G+T       F
Sbjct: 228 SSILLLV--------NCAVHIARESGGPRDYPVAILLV--------CYVGLTVWYPAILF 271

Query: 252 TIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIP 311
           T   FM               A  ++   +  R   +         PV  R +       
Sbjct: 272 TYHIFM---------------AGTQQTTREFLRGIGSKKN------PVFHRVVKEK---- 306

Query: 312 NIYDKGSFLKNLKEL 326
           N++DKGSFLKNL  L
Sbjct: 307 NVFDKGSFLKNLGHL 321

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 79.0 bits (193), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 55/99 (55%), Gaps = 4/99 (4%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS----NTLLL 191
           +C+TCR+ +P R+ HC+ C  C++  DHHC W NNCIG  NY YF+TFLVS       ++
Sbjct: 171 YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFII 230

Query: 192 GYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVF 230
               +R+       D     ++L +  L   +  ILLV+
Sbjct: 231 ANCAIRVSRSVHAKDAPVAILLLIYCGLVVCYPFILLVY 269

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 7/66 (10%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C+TCR+ +P R+ HC+ CN C++  DHHCIW NNC+G  NY+YF TF+ S       A 
Sbjct: 188 YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYS-------AV 240

Query: 196 LRIILL 201
           L IILL
Sbjct: 241 LTIILL 246

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 40/54 (74%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           +C +CR+ +P RS HC+ CN CV++ DHHCIW NNCIG  NY++F  FL+S  +
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVI 227

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           +C+TCR+ +P R+ HC+ C  CVL  DHHC W NNCIG  NY+YF TFL S  L
Sbjct: 177 YCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCL 230

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 88/199 (44%), Gaps = 22/199 (11%)

Query: 128 SLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL--- 184
           S + +PN FC  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY +F  FL   
Sbjct: 72  SPLIWPN-FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWV 130

Query: 185 -VSNTLLLGYAFLRIILLTAYSDIG---FPNIVLTFL-ILSGAFFAILLVFTYLQFAL-- 237
            V+ ++L      RI  +     +    F    L FL ILS   F +LL    L      
Sbjct: 131 IVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS 190

Query: 238 --VYDGMTTNEKDKWFTIQEFMREGRLI-RTDNGQWLIAHPEEPAGQATRFYST------ 288
             + +G +  E      ++     G+LI +  +  W I +PE  + Q  R          
Sbjct: 191 NQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRI-YPEARSSQHERDADKLLTQRG 249

Query: 289 -NAYDHTIYCPVNFRPITH 306
              +D  +  P NF P T+
Sbjct: 250 RARFDELVSFPYNFNPCTN 268

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 73/147 (49%), Gaps = 17/147 (11%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSN 187
           +PN FC  C+  KP RS HC  CN+CVL+ DHHC W  NC+G GNY +F  FL    ++ 
Sbjct: 76  WPN-FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITT 134

Query: 188 TLLLGYAFLRIILLTAYSDIGFPNIV-----LTFL-ILSGAFFAILLVFTYL----QFAL 237
           ++L      RI  +  +    FP  +     LTFL ILS   F +LL  T L     F  
Sbjct: 135 SILFCIQVKRICFI--WQRRNFPGYLFKKSELTFLTILSPLNFFVLLTITVLFLRCLFNQ 192

Query: 238 VYDGMTTNEKDKWFTIQEFMREGRLIR 264
           + +G +  E      ++      RLI+
Sbjct: 193 IVNGRSQIESWDMDRLESLFDSRRLIQ 219

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 76.6 bits (187), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 63/115 (54%), Gaps = 7/115 (6%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV----SNTLLL 191
           +CSTC + +P R+ HC+IC  C+ + DHHCIW NNC+G  NY+YF  FLV    S+  ++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 192 GYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNE 246
               + +  +   S+     +++ +  L+  +  ILL +     AL   G TT E
Sbjct: 249 INCSIHVARIRRASNAPVAILLIVYGCLTIIYPGILLGY---HIALTGTGQTTRE 300

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 4/69 (5%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C TCR+ +P RS HC++C+ CVL  DHHC W NNCIG  NY++F  FL+++T+    + 
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTI----SC 228

Query: 196 LRIILLTAY 204
           + +ILL+++
Sbjct: 229 ILLILLSSF 237

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 76.3 bits (186), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 68/122 (55%), Gaps = 15/122 (12%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL----LL 191
           +C+TC + KP RS HC+ CN+C L  DHHC W ++CIG  N ++F  FL+ +TL    + 
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 192 GYAFLRII-------LLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTT 244
             A L+I+         T Y DI   N+++ +L+ +GA  + L  FT     L+    TT
Sbjct: 169 IAATLQIVSWFRNQNYTTQYIDI---NLLVVWLLSTGASVS-LFCFTGFSIYLLTKNQTT 224

Query: 245 NE 246
           NE
Sbjct: 225 NE 226

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLLL 191
           FC  C+L KP R+ HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL    V+   LL
Sbjct: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138

Query: 192 GYAFLRIILLTAYSDIG---FPNIVLTFLILSGAFFAILLVFTYLQF 235
                R I L    D+    F    +TFLI+       +L+   L F
Sbjct: 139 YQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLF 185

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 68/149 (45%), Gaps = 11/149 (7%)

Query: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F  L       C  C+  KP R+ HC  C++CVL+ DHHC W  NC+G  N+ +F  FLV
Sbjct: 69  FQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128

Query: 186 ---SNTLLLGYAFLRIILL---TAYSDIGFPNIVLTFLILSGAFFA-----ILLVFTYLQ 234
                T  LG+   + I +     ++ I    I L F+ ++    A     I+L+     
Sbjct: 129 WVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCS 188

Query: 235 FALVYDGMTTNEKDKWFTIQEFMREGRLI 263
                 GMT  E+ +W  I+     GRLI
Sbjct: 189 KNQFLCGMTQIERWEWERIENQFNNGRLI 217

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (48%), Gaps = 12/125 (9%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLL 190
           T+C  C   KP R+ HC  CN+C+L+ DHHC W  NC+G  NY +F  FL    V+   L
Sbjct: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL 138

Query: 191 LGYAFLRI--ILLTAYSDIGFPN----IVLTFLILSGAFFAILLVFTYLQFAL--VYDGM 242
           L   F RI  I    YS          ++LT L    AF  + +    ++  +  ++ GM
Sbjct: 139 LAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILLTITLLLIRCTMNQIFSGM 198

Query: 243 TTNEK 247
           +  EK
Sbjct: 199 SQIEK 203

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 73.6 bits (179), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 62/120 (51%), Gaps = 13/120 (10%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C TC + KP RS HC+ CNRCVL  DHHC W + CIG  N ++F  FL+ NT    YA++
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNT---TYAYV 166

Query: 197 RIILLTA----YSDIG-----FPNIVLTFL-ILSGAFFAILLVFTYLQFALVYDGMTTNE 246
             IL +     + D G     F N+ L FL IL+      L  F      +V +  TT E
Sbjct: 167 IAILTSKQMYNWFDDGSYENEFVNMYLLFLWILALVVSLALSCFAGFSVYMVMNNKTTIE 226

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 73/164 (44%), Gaps = 16/164 (9%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLL 190
            FC  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY +F  FL    V+ ++L
Sbjct: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVL 137

Query: 191 LGYAFLRIILLTAYSDIG---FPNIVLTFLILSG-----AFFAILLVFTYLQFALVYDGM 242
                 RI  +     +    F    L FL +S          I ++F    F  + +G 
Sbjct: 138 FCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGR 197

Query: 243 TTNEKDKWFTIQEFMREGRLIRT--DNGQWLIAHPEEPAGQATR 284
           +  E      ++     GRL +   DN  W I +PE  + Q  +
Sbjct: 198 SQIESWDMDRLESLFNSGRLTQKLIDN-TWRI-YPESRSFQNKK 239

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 73.2 bits (178), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 39/54 (72%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           +C+TCR+ +P R+ HC +C+ C+L  DHHC W NNCIG  N++YF  FL S+ L
Sbjct: 186 YCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVL 239

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 72/156 (46%), Gaps = 14/156 (8%)

Query: 120 PYQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQY 179
           P +DF+  +  ++   +C  CR+ KP R+ HC  CN+CVL  DHHC W  NC+G  N+ +
Sbjct: 65  PPKDFKPSAEEWH--NYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPH 122

Query: 180 FYTFL----VSNTLLLGYAFLRIILL-----TAYSDIGFPNIVLTFLILSGAFFAILLVF 230
           F  FL     S   LL     RI LL     TA+       I+   ++     F +L V 
Sbjct: 123 FMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLTVS 182

Query: 231 TYLQ---FALVYDGMTTNEKDKWFTIQEFMREGRLI 263
           + L    +     GMT  E  +   IQ    + RL+
Sbjct: 183 SLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLL 218

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (46%), Gaps = 16/143 (11%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLL 190
            +C  C+  KP R+ HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL    V+   L
Sbjct: 78  NYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFL 137

Query: 191 LGYAFLRIILLTAYSDIGFPN--------IVLTFLILSGAF--FAILLVFTYLQFALVYD 240
           L     RII+L  + D   P+        + LT L    AF    I ++        +++
Sbjct: 138 LYQLVSRIIVL--WRDRNLPDYMFHRSELVFLTILTPLDAFVLLTITILLCRCLANQIFN 195

Query: 241 GMTTNEKDKWFTIQEFMREGRLI 263
           GM+  E  +   +Q      RL+
Sbjct: 196 GMSQIETWELERLQALFDSKRLV 218

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 61/125 (48%), Gaps = 12/125 (9%)

Query: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGY 193
           NT C  C   KP RS HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL+   +  G+
Sbjct: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140

Query: 194 AFLRII--LLTAYSDIGFPN--------IVLTFLILSGAF--FAILLVFTYLQFALVYDG 241
             + ++   +T ++    P+        I LT LI   AF    I L+F       +  G
Sbjct: 141 LLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRG 200

Query: 242 MTTNE 246
           MT  E
Sbjct: 201 MTQIE 205

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
            C TC++ KP R  HC+ CN+C+L  DHHC W   CIG  N ++F  FL+  T+   YAF
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI---YAF 164

Query: 196 LRIILLTA-----YSDIGFPNIVLTFLILSGAFFAILLVFTYLQFA--LVYDGMTTNEKD 248
           + + L++      Y +  + N  + F +L     A ++  + L F+   +Y  +      
Sbjct: 165 VALGLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTTI 224

Query: 249 KWFTIQEFMRE 259
           + + I+ + R+
Sbjct: 225 EMYGIRRYNRD 235

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTL 189
           N +C+ C   KP RS HC  C +CVL+ DHHC W  NC+G GN+  F  FL    ++ + 
Sbjct: 79  NRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQ 138

Query: 190 LLGYAFLRI 198
           L  Y  LRI
Sbjct: 139 LFWYLLLRI 147

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV----SNTLL 190
            FC  C   KP RS HC  CN+CVL+ DHHC W  NCIG  N+ +F  FL+    +   L
Sbjct: 78  NFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFL 137

Query: 191 LGYAFLRIILL 201
           L Y   RII +
Sbjct: 138 LFYQIKRIIYM 148

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 67/143 (46%), Gaps = 16/143 (11%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV----SNTLL 190
            FC+ C   KP R+ HC  CN+CVL  DHHC W  NC+G  N+ +F  FL     + + L
Sbjct: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL 137

Query: 191 LGYAFLRIILLTAYSDIGFPN--------IVLTFLILSGAFFAILLVFTYLQFA--LVYD 240
           L Y   RI+ L  ++    PN        I LT L    AF  + +    L+ A   +  
Sbjct: 138 LTYLVKRILFL--WNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILK 195

Query: 241 GMTTNEKDKWFTIQEFMREGRLI 263
           GMT  E  +   I+     G+LI
Sbjct: 196 GMTQIESWEMDRIENMFHSGQLI 218

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 70.1 bits (170), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 68/145 (46%), Gaps = 20/145 (13%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYA 194
            +C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL    +++G  
Sbjct: 78  VYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLF--WVIVGTT 135

Query: 195 FLRIILLTAYSDI----GFPN--------IVLTFLILSGAFFAILLVFTYLQ----FALV 238
            L I L T    I      P+        I LT L    AF  ILL  + L     F  +
Sbjct: 136 SLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAF--ILLTISILMIRCLFNQI 193

Query: 239 YDGMTTNEKDKWFTIQEFMREGRLI 263
           ++G +  E  +   ++   R  +L+
Sbjct: 194 FNGRSQIESWEMDRLETLARMSKLL 218

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 133 PNT---FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           PNT   +C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY +F  F+     
Sbjct: 93  PNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIA 152

Query: 190 LLGYAF 195
             G+ F
Sbjct: 153 TTGFLF 158

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 56/126 (44%), Gaps = 7/126 (5%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNT------- 188
           FC  C + KP R  HC+ C +C L  DHHC W  +C+G  N +YF  FL+  T       
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIF 164

Query: 189 LLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKD 248
           LL G   L       Y+       +L   ILS A    +L FT     L+    TT E  
Sbjct: 165 LLSGTELLLWFKNQRYNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQTTIEMY 224

Query: 249 KWFTIQ 254
           +W  ++
Sbjct: 225 EWSNLK 230

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLLL 191
           +C  C   KP R+ HC  C +CVL+ DHHC W  NC+G  N+ +F  FL    V+ T LL
Sbjct: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138

Query: 192 GYAFLRIILL 201
            +   RI+ L
Sbjct: 139 YFLISRIVFL 148

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
            C TC + KP R  HC+ CNRC+L  DHHC W  +C+G  N +YF  FL+  TL   YAF
Sbjct: 107 LCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL---YAF 163

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 35/53 (66%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           C TC + KP R  HC+ C+RC+L  DHHC W   CIG  N++YF  FL+ N+L
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSL 158

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (54%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYA 194
           ++C  CR  KP R+ HC  CN+CVL  DHHC W  NC+G  N+ +F  FL       GY 
Sbjct: 78  SYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYL 137

Query: 195 FLRIIL 200
              + L
Sbjct: 138 LYELCL 143

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 70/163 (42%), Gaps = 24/163 (14%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C  C + KP R  HC+ C+ CVL  DHHC W   C G  N ++F  FL+  T    YAFL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTC---YAFL 162

Query: 197 RII-----LLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFAL--VYDGMTTNEKDK 249
            +I     L T ++   F   ++ F +L  A  A+ +  T L F +  +Y         +
Sbjct: 163 VLIYTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQTTIE 222

Query: 250 WFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYD 292
              ++ + R+  +I    G              T  YS N +D
Sbjct: 223 VHGMRRYRRDLEIINDSYG--------------TNVYSENVFD 251

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 56/124 (45%), Gaps = 11/124 (8%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNT------- 188
           FC TC + KP R  HC+ CN+C L  DHHC W  +C+G  N +YF  FL+  T       
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVF 191

Query: 189 LLLGYAFLRIILLTAYSD--IGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNE 246
            L G   L       Y+   I  P  +L   ILS      +L FT     LV    TT E
Sbjct: 192 FLTGADLLMWFRSQGYNQELINLP--LLIVWILSLVITISMLAFTSYTIYLVAKNQTTIE 249

Query: 247 KDKW 250
             +W
Sbjct: 250 MYEW 253

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 81/195 (41%), Gaps = 17/195 (8%)

Query: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIG---LGNYQYFYT 182
           F  L +    +C+ C   KP R+ HC  CN+CVL+ DHHC W  NC+G   L      + 
Sbjct: 69  FRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFC 128

Query: 183 FLVSNTLLLGYAFLRIILLTAYSDIGFPNIV-------LTFLILSGAF--FAILLVFTYL 233
           ++++ T +L + F++ I  T  +     N+V       LT L    AF    I L+F   
Sbjct: 129 WIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRC 188

Query: 234 QFALVYDGMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRF-----YST 288
               + +G T  E  +   I+      RL+          +P    GQ          ST
Sbjct: 189 VKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEVEEFLSSST 248

Query: 289 NAYDHTIYCPVNFRP 303
            ++D  I  P +  P
Sbjct: 249 CSFDEVINFPYDINP 263

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C  C + KP R  HC+ C+ C+L  DHHC W   C G  N ++F  FL+  TL   YAFL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTL---YAFL 162

Query: 197 RII-----LLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFA 236
            +I     L T ++   F   ++ F +L  A  A+ +  + L F 
Sbjct: 163 VLIYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISVLAFT 207

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           FC TC + KP R  HC+ CN+C L  DHHC W  +C+G  N ++F  FL   T+   Y  
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 196 L--RIILLTAYSDIGFPNIVLTFLILSGAFFAIL-----LVFTYLQFALVYDGMTTNEKD 248
           L     L + +  + + + +L   +L     +++       FT     LV    TT E+ 
Sbjct: 164 LMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQY 223

Query: 249 KWFTIQE 255
           +W  I+ 
Sbjct: 224 EWGNIRH 230

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 68/136 (50%), Gaps = 10/136 (7%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
            C TC++ KP R  HC+ C++C+L  DHHC W   CIG  N +YF  FL+  T    Y+ 
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCT---AYSI 156

Query: 196 LRIILLTA-----YSDIGFPNIVLTFLILSGAFFAILLVFTYLQFA--LVYDGMTTNEKD 248
           + +   +      +S   + + ++  ++L+    AI++  + + F+   +Y  +      
Sbjct: 157 VVLFFTSCELHYWFSGKQYEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQTTI 216

Query: 249 KWFTIQEFMREGRLIR 264
           + + ++   R+  L+R
Sbjct: 217 EMYGMKREKRDLELLR 232

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 62/139 (44%), Gaps = 10/139 (7%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C  C + KP R  HC+ C+ C+L  DHHC W   C G  N + F  FL+  T    YAFL
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTF---YAFL 162

Query: 197 RII-----LLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFAL--VYDGMTTNEKDK 249
            +I     L T +    F   ++ F +L  A  AI +  + L F    +Y         +
Sbjct: 163 VLIYSCYELGTWFHSGSFNQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQTTIE 222

Query: 250 WFTIQEFMREGRLIRTDNG 268
            + ++ + R+  +I    G
Sbjct: 223 LYGMRRYRRDLEIINDTYG 241

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C  C + KP R  HC+ C+ C+L  DHHC W   C G  N ++F  FL+  T    YAFL
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTF---YAFL 162

Query: 197 RII-----LLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFA 236
            +I     L T ++   F   ++   +L  A  AI +  + L F+
Sbjct: 163 VLIDTCYELGTWFNSGSFSRELIDLHLLGTALLAIAVFISVLAFS 207

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 29/48 (60%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL 184
           C TC   KP R  HC+ CNRC+L  DHHC W   CIG  N +YF  FL
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFL 153

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C TC + KP R  HC+ C++C+L  DHHC W   C+G  N +YF  FL+  T+   YA L
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTV---YAIL 162

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 16/137 (11%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C +CR  KP R  HC+ C+RC+L  DHHC W   C+G  N + F  FL+  T    YA  
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTT---AYAIF 159

Query: 197 RIILLTA------YSDIGFPNIVLTFL----ILSGAFFAILLVFTYLQFALVYDGMTTNE 246
            + + +       Y+D     ++  +L    I S   F  + +F+    + V    TT E
Sbjct: 160 VLSMTSVQLYRWFYNDKFQEELISGYLLFLWIFSLVVFIAMTLFSAFSVSQVLKNQTTIE 219

Query: 247 KDKWFTIQEFMREGRLI 263
               + +Q +  + R++
Sbjct: 220 M---YGVQRWRNQARIL 233

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 73/177 (41%), Gaps = 15/177 (8%)

Query: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F+  I     +C  C   KP R+ HC  C +CVL  DHHC W  NC+G  N+ +F  FL 
Sbjct: 69  FEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLT 128

Query: 186 SNTLLLGYAFLRIILLTAYSDIGFPNI-------VLTFLILSGAFFA-ILLVFTYLQFAL 237
              L   Y  L ++   A+      N         L FL ++    A ILL  + L F  
Sbjct: 129 WVVLTTSYLGL-LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRC 187

Query: 238 V----YDGMTTNEKDKWFTIQEFMREGRLIRT--DNGQWLIAHPEEPAGQATRFYST 288
           V     +GMT  E  +   I+      RL+    DN + L        G A +  S+
Sbjct: 188 VKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQKLLSS 244

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +C  C++ KP R  HC+ C++C L  DHHC+W   CIG  N+++F  FL+  ++   YAF
Sbjct: 170 YCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASV---YAF 226

Query: 196 LRIILLT--------AYS-DIGFPNIVLTFL-ILSGAFFAILLVFTYLQFALVYDGMTTN 245
              I+ T        A+S +    N+ L  L  LS A    L  F      LV    TT 
Sbjct: 227 WICIITTWDLVVWFRAHSYERELLNVHLVCLWALSAAATVALTAFCAFNIYLVCKNETTG 286

Query: 246 EKDKWFTIQE 255
           E  +  T+  
Sbjct: 287 EYQRRSTLNS 296

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C  C++ KP RS HC+ CN+C L  DHHC W  +CIG  N + F  FL+  T    + F+
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 12/141 (8%)

Query: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL---VSNTLLL 191
            +C  C+  KP R+ HC  C +CVL+ DHHC +  NC+G  N+ +F  FL   ++ T  L
Sbjct: 78  NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL 137

Query: 192 GYAFLR-------IILLTAYSDIGFPNIVLTFLILSGAF--FAILLVFTYLQFALVYDGM 242
              F +       I   TA        I LT L  + AF    I ++F       V +GM
Sbjct: 138 SIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGM 197

Query: 243 TTNEKDKWFTIQEFMREGRLI 263
           T  E  +   I+      RL+
Sbjct: 198 TQIEAWEMDRIESMFYNRRLV 218

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFL 196
           C +C   KP R  HC+ CN CVL  DHHC W   C+G  N ++F  FL+  T+   Y+ L
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTV---YSIL 162

Query: 197 RIIL 200
            +IL
Sbjct: 163 VLIL 166

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 137 CSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNT 188
           C TC + KP R  HC+ C++C+L  DHHC W   CIG  N ++F  +L+  T
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYAT 158

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 43/89 (48%), Gaps = 12/89 (13%)

Query: 147 RSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLLLGYAFLRIILL- 201
           R+ HC  CN CV++ DHHC W  NC+G  NY +F  FL    +S T LL     +   L 
Sbjct: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLY 159

Query: 202 -------TAYSDIGFPNIVLTFLILSGAF 223
                    Y ++ +  I+LT LI    F
Sbjct: 160 IYRNSPFHLYQNVKYKIIILTLLIPGTIF 188

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 77/178 (43%), Gaps = 30/178 (16%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQ-------YFYTFL 184
           YP  +CSTC+  K  RS H  +   CV   DH+C+W    IG  NY+       YF  +L
Sbjct: 123 YP-MWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYL 181

Query: 185 VSNTLLLGYAFLRIILLTAYSD--IGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGM 242
           V+ +L +     RI+      D  +    IVL  L+L+ AFF   L      FA+    M
Sbjct: 182 VTASLTIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTPL------FAVFSFYM 235

Query: 243 TTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEE---------PAGQATRFYSTNAY 291
           + N      T  + +++  + R     + + +PE+         PA Q   +   NA+
Sbjct: 236 SCNR-----TSLDIIQKKAIKRHRKAYFCVYNPEDRYRYVVDCLPAEQYNIWNKRNAW 288

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 66/143 (46%), Gaps = 19/143 (13%)

Query: 105 TMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHH 164
           T   +P S++     P + ++ DS   YP  +CS C   K  RS H ++ N C+   DH+
Sbjct: 94  TSETQPTSTV-----PAKLYQCDS-NGYPR-WCSNCEGLKSLRSHHSSVANYCIPRFDHY 146

Query: 165 CIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIILLTAYSDIG--------FPNIVLTF 216
           CIW    IG  NY+ F  FL   T+  G  ++  I+   Y   G        F   ++T 
Sbjct: 147 CIWLGTTIGKDNYKQFVIFLFYCTVSFGIMWISAIV--CYLKYGRHYQEQNNFDGNLVTL 204

Query: 217 LILS--GAFFAILLVFTYLQFAL 237
           +IL   G FF   L+  ++ + +
Sbjct: 205 VILGAMGWFFVAGLLLAHISYMV 227

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 56/120 (46%), Gaps = 8/120 (6%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLL 191
           YP  +CS C+  K  R+ H +    CV   DH+C+WA   IG  NY+ F  F+   ++LL
Sbjct: 128 YP-IWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSILL 186

Query: 192 GYAFLRIIL----LTAYSDIGFPNI-VLTFLILSGAFFAILLVFTYLQFALVYDGMTTNE 246
              +  I +    +T       P I V   L L+ A    LL  + L  A+ Y  M+ N+
Sbjct: 187 LIMWASICVYTKEITQRHHSQGPRINVNVMLTLAFAILGWLLTTSTLGSAIFY--MSQNK 244

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 74/155 (47%), Gaps = 26/155 (16%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLL 190
           F   +FC    + KP RSK+  + +  +L  DH+C W  N +GL N++ F  F+++  L 
Sbjct: 450 FDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILA--LE 507

Query: 191 LG-YAFLRIIL-------------LTAYSDI--GFPNIVLTFLILSGAFFAILLVFTY-- 232
           LG ++F+++ L             +    D+  G      TFLI++ A    + +F+   
Sbjct: 508 LGIFSFVKVCLKYFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVI 567

Query: 233 LQFALVYDGMTTNEKDKWFTIQEFMREGRLIRTDN 267
           +Q   +  G+T +E      +   +REGR +  D+
Sbjct: 568 VQLFQITKGLTNSE------LNALIREGRRVDIDS 596

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLL 191
           YP T+C+ C+  K  R+ H      CV   DH+C W    IG GNY  F  FLV    LL
Sbjct: 122 YP-TWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLL 180

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 58/123 (47%), Gaps = 2/123 (1%)

Query: 108 IRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIW 167
           +   S+   ++ P + ++ D   + P  +C+ C+  K +RS H     RC+L  DH+C W
Sbjct: 91  VGSSSNQVISTKPPKYYQCDKNGYPP--WCTHCQSLKLSRSHHSKQVGRCILRFDHYCAW 148

Query: 168 ANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAIL 227
               I   NY+ F  ++    LLL + +L I +      +   N+++ F++    +   L
Sbjct: 149 IGCVIARNNYRLFLQYVGWFNLLLLWYWLTIAVFIRTIGMLNGNVIVGFILSCLGWMMTL 208

Query: 228 LVF 230
            +F
Sbjct: 209 GLF 211

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 72/162 (44%), Gaps = 17/162 (10%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLL 191
           YP  +C TC+  K  R+ H      C+   DHHC+W    IG  NY  F  F+   + LL
Sbjct: 120 YP-IWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYFSCLL 178

Query: 192 GYAFLRII----LLTAYSDIGF---PNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTT 244
              ++ I+     +  Y   G+   PN+++  LILS  F  + L          +   T+
Sbjct: 179 LIFWISIVSYIKRIVDYPHTGYKLDPNLIV-ILILSVPFSIMTLSLFLSHVYFTFMNRTS 237

Query: 245 NE-----KDKWFTIQEFMREGRLIRTDNGQWLIA-HPEEPAG 280
            E     ++K   I++F+    L +T   +++I   PE+ A 
Sbjct: 238 LEIINIKRNKKLNIKKFV--CYLDKTSGNRYVIEMSPEDMAN 277

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLL 191
           YP  +CS C+  K  R+KH +    CV   DH+C+W    IG  NY+ F  F+    +LL
Sbjct: 112 YP-VWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVLL 170

Query: 192 GYAFLRI 198
              ++ I
Sbjct: 171 MIVWITI 177

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 10/105 (9%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGY-- 193
           +CS C   K  R+ H +    CV   DH C W    IG  NY++F  F++   +L  +  
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVF 185

Query: 194 ----AFLRIILLTAYSDIGF-PNIVLTFLILSGAFFAILLVFTYL 233
               AF+R I+    +     PN+++  +I   A FA L+  + L
Sbjct: 186 VPICAFIRRIIHDGDTQHSLNPNLIVILII---AVFAWLMTTSML 227

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 59/127 (46%), Gaps = 21/127 (16%)

Query: 117 NSSPYQDFEFDSLI----------FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCI 166
           N+S     E+D+++           YP  +CS C+  K  R+ H +    C+   DH+C+
Sbjct: 102 NTSQNTSVEYDAVVPPKCYQSDPHGYP-IWCSECQSLKMERTHHSSELGHCIPRFDHYCM 160

Query: 167 WANNCIGLGNYQYFYTFLV--SNTLLLGY----AFLRIILLTAYSDIGFPNIVLTFLILS 220
           W    IG  NY+ F  F    S  LL+ +     ++RII  T ++    PN  L   I+S
Sbjct: 161 WIGTVIGRDNYRLFVQFAAYFSTLLLIMWVSICVYIRII--TQHNHNYSPN--LNANIIS 216

Query: 221 GAFFAIL 227
              FAIL
Sbjct: 217 TLVFAIL 223

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 76/194 (39%), Gaps = 32/194 (16%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLL 190
           F   +FC      KP RSK+ ++ N  V   DH+C W  N +GL N++ F  F+ S    
Sbjct: 466 FDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITSMESG 525

Query: 191 LGYAFLRII------LLTAYSDI-----------------GFPNIVLTFLILSGAFFAIL 227
           + + FL +       L  AY +I                 G  +   TFLI+  A    +
Sbjct: 526 I-FTFLALCLEYFDELEDAYEEISQKNSKCFILGDSDLCSGLAHDKFTFLIMLWALLQSI 584

Query: 228 LVFT--YLQFALVYDGMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRF 285
            V +  ++Q   +  G+T +E    F +   M+E + I  D           P G A   
Sbjct: 585 WVASLIFVQAFQICKGLTNSE----FNV--LMKESKAIGPDGLSLNENFNTTPEGFAPSI 638

Query: 286 YSTNAYDHTIYCPV 299
            S      T+  PV
Sbjct: 639 ESGEENSDTVLSPV 652

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           +CS C+  K  R+ H +    CV   DH+C+W    IG  NY  F  F+    + L   +
Sbjct: 122 WCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIW 181

Query: 196 LRII 199
           + I+
Sbjct: 182 VSIV 185

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 13/83 (15%)

Query: 115 GFNSSPYQD--FEFDSLI----------FYPNTFCSTCRLEKPARSKHCNICNRCVLLSD 162
           G N    QD   E+D++I           YP  +CS C+  K  R+ H +    CV   D
Sbjct: 104 GANGEGSQDASMEYDAVIPPRCYQCDPHGYP-IWCSPCQSLKMERTHHSSELGHCVPRFD 162

Query: 163 HHCIWANNCIGLGNYQYFYTFLV 185
           H+C+W    IG  NY+ F  F+ 
Sbjct: 163 HYCLWVGTVIGRDNYRLFVQFVT 185

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 65/161 (40%), Gaps = 31/161 (19%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYT-FLVSNTL 189
           F    FC    ++KP RS+  ++ N  V   DH+C W  N IGL N++ F    L+   L
Sbjct: 458 FDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEIL 517

Query: 190 LLGYAFLRIILLTAYSDI-------GFP--------NIVLTFLILSGAFFAILLV----- 229
           +L + +L +       D+       G P        N+ L F     AF   + V     
Sbjct: 518 MLLFNYLCMEYFDELEDVHKHADNGGEPKCTILRNENLCLGFTYDRFAFLTFVWVVFHSV 577

Query: 230 ----FTYLQFALVYDGMTTNEKDKWFTIQEFMREGRLIRTD 266
                  +Q   V+ G+T  E  K       M+E R+ RTD
Sbjct: 578 WVGLLVIVQLFQVFQGVTNYEFSK------LMKESRINRTD 612

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS 186
           F    FC    + KP RSK     N  V   DH+C W  N IGL N++ F  F++S
Sbjct: 457 FDTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIIS 512

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 111 ESSLG--FNSSPYQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWA 168
           ESS G   +++P + ++ D    YP  +C+ C+  K  R+ H +    C+   DH+C+W 
Sbjct: 106 ESSQGTQMSTNPPRIYQCDPQ-GYP-IWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWI 163

Query: 169 NNCIGLGNYQYFYTF 183
              +G  NY+ F  F
Sbjct: 164 GTVVGRKNYRLFVQF 178

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 108 IRPESSLGFNSSPYQD--FEFDSLI------FYPNTF---CSTCRLEKPARSKHCNICNR 156
           I P +S    S   Q+   E+D++I        PN +   CS C+  K  RS H +    
Sbjct: 91  IVPVTSKELTSDDSQNASVEYDAVIPPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGH 150

Query: 157 CVLLSDHHCIWANNCIGLGNYQYF--YTFLVSNTLLLGY----AFLRIILLTAYSDIGFP 210
           C+   DH+C+W    IG  NY+ F  +T   S+ LL+ +     F+R I    + +   P
Sbjct: 151 CIPRFDHYCVWIGTIIGRDNYRPFVQFTGYFSSLLLIMWVSICVFIRNI-TQHHHNHNSP 209

Query: 211 NIVLTFLILSGAFFAILLVFTYLQFALVY 239
                FL L+ A F  L   + L   + Y
Sbjct: 210 LNANVFLTLAFAIFGWLFTTSMLASNIFY 238

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 111 ESSLGFNSSPYQDFEFD-SLIFY---PNTF---CSTCRLEKPARSKHCNICNRCVLLSDH 163
           ES LG  S  YQ+   D S I Y   PN +   C+ C+  K  R+ H      CV   DH
Sbjct: 95  ESDLG-ASEKYQNHGSDGSSICYQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDH 153

Query: 164 HCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRII 199
            C +  + IG  NY+ F  + V  T+ L   +  I+
Sbjct: 154 KCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWTSIV 189

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F  N FC    + KP RS++  + +  V   DH C W  N IGL N++ F  F++
Sbjct: 473 FDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFII 527

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLL 191
           YP  +C+ C+  K  R  H      C+   DH+C W    IG  NY+ F  ++    LLL
Sbjct: 113 YP-IWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLL 171

Query: 192 GYAFLRI 198
            + +L I
Sbjct: 172 AWIWLSI 178

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTF 183
           YP  +CS C+  K  R+ H      CV   DH+C+W    +G  NY+ F  F
Sbjct: 123 YP-IWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTF 183
           YP  +C+ C+  K  R+ H +    C+   DH+C+W    +G  NY+ F  F
Sbjct: 121 YP-IWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQF 171

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           YP  +CS C+  K  R+ H      CV   DH+C+W    IG  NY+ F  FL+
Sbjct: 118 YP-VWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 108 IRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIW 167
           +  ES++  NS    D        YP  +CS C+  K +R+ H      CV   DH+C+W
Sbjct: 100 VSSESAVPDNSIAPPDIYPCDERGYP-IWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVW 158

Query: 168 ANNCIGLGNYQYFYTF 183
               +G  NY+ F  F
Sbjct: 159 IGTVLGRLNYKLFVQF 174

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC      KP RSK+ ++ N  V   DH C W  N +GL N++ F  F++
Sbjct: 468 FDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFIL 522

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC      KP RSK  ++ N  V   DH+C W  N +GL N++ F  F+ 
Sbjct: 466 FDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIA 520

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC    + KP RSK   + N  V   DH+C W  N +GL N++ F  F+ 
Sbjct: 466 FDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT 520

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLG 192
           + FC      KP RS++  + N  V   DH+C W  N +GL N++ F  F++S    +G
Sbjct: 461 SNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSMETGIG 519

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC +  + KP RSK  N     V   DH C W  N IGL N++ F  F++
Sbjct: 446 FDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC      KP RS+  ++ N  V   DH+C W  N +GL N++ F  F+ 
Sbjct: 465 FDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFIT 519

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 25/151 (16%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV-SNTL 189
           F  +TFC    + KP R     +  + V   DH+C W  N +GL N++ +  FL+   T 
Sbjct: 399 FNCHTFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETF 458

Query: 190 LLGYAFL------------------RIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFT 231
           L+ +  L                  R I+   Y ++    + L + I    F   LL+  
Sbjct: 459 LMTFGVLNWRYFGLMEKTAECFLFNRTIICHGYKNLKVVFLFLVWTIFQAIFVGNLLM-- 516

Query: 232 YLQFALVYDGMTTNEKDKWFTIQEFMREGRL 262
            LQ   +  G+TT E      ++EF+R   L
Sbjct: 517 -LQLRKIAYGITTFE---LVFLKEFVRNRSL 543

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS 186
           F    FC      KP RSK+       V   DH+C W  N +GL N++ F  F V+
Sbjct: 442 FDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVT 497

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 22/146 (15%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAF 195
           FC    + KP RSK   +    V   DH+C W  N IGL N++ F  F+  + + + ++F
Sbjct: 467 FCLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTI-WSF 525

Query: 196 LRIILLTAYSDIGFPNIVLTFLILSGA---------FFAILLVFTYLQFALVY------- 239
           + I+    + ++         L+  G+         F  +L+V++ LQ   V        
Sbjct: 526 V-IVCFEYFDELEVEEDAKCLLMGGGSVCKGVLKSRFTLLLMVWSMLQGVWVMFLICVQL 584

Query: 240 ----DGMTTNEKDKWFTIQEFMREGR 261
                G+T NE +K     E M   R
Sbjct: 585 FQMLRGITNNEFNKLANAHESMVGSR 610

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTL 189
           F    FC      KP R K  +  +R VL  DH+C W  N +GL N++ F  +++S  L
Sbjct: 454 FDTKNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSVGL 512

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%)

Query: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS 186
           N FC      KP RSK+       V   +H+C W  N IGL N++ F  F  S
Sbjct: 428 NNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFS 480

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS 186
           FC      KP RSK        ++  DH C W  N +GL N++ F  FL+S
Sbjct: 453 FCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLS 503

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC    +  P RSK+       +   DH C W  N IGL N++ FY F+V
Sbjct: 462 FDAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVV 516

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           FC    + KP RS+  ++    +   DH+C W  N +GL N++ F  F+ 
Sbjct: 461 FCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVA 510

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 24/56 (42%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVS 186
           F    FC      KP RSK        V   DH C W  N IGL N++ F  F ++
Sbjct: 439 FDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALT 494

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%)

Query: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
            D+  F    FC    + KP RS    +    V   DH C W  N IGL N++ F  F++
Sbjct: 446 LDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 505

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLV 185
           F    FC    +  P RSK+    N  +   DH+C W  N IG  N++ F  F++
Sbjct: 450 FDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIM 504

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTF 183
           FC    +  P R+K+    +  +L  DH+C W  N IG  N++ F  F
Sbjct: 447 FCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQ 178
           F    FC      K  RSK+       V   DH+C W  N IGL N++
Sbjct: 436 FDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHK 483

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%)

Query: 133 PNTFCSTCRLEKPARSKHCNICNRCVLLSDHH-CIWANNCIGLG 175
           P   CS C+  K    K    C+ CV L D   C + N  +G G
Sbjct: 9   PTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKG 52

>KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa]
           {ON} Anc_5.626 YOR034C
          Length = 727

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 131 FYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFY 181
           F  + FC T  + +P +S    +  + V   DH+C+W  N I L N + F+
Sbjct: 429 FDVSGFCLTTWVRRPFKSHISPLQKKRVAGFDHYCMWLYNDIALKNRKAFF 479

>Kpol_1004.69 s1004 complement(148244..149575) [1332 bp, 443 aa]
           {ON} complement(148244..149575) [1332 nt, 444 aa]
          Length = 443

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 17/122 (13%)

Query: 124 FEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTF 183
           FE+ SL    N F + C   KP  S           +   HCI    C+   N  +FY F
Sbjct: 330 FEYKSLECKENYFHNNCGTSKPKAS-----------IVAEHCIEWKECMS-KNQDFFYLF 377

Query: 184 LVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMT 243
             S ++ L Y  L     + +  + F   +L  + L+   F+   +F + +  L Y G++
Sbjct: 378 KSSMSIELIYQTLE----SFFKPMAFKEAILIVIGLAIWLFSSNFLFGFFR-VLSYHGIS 432

Query: 244 TN 245
           ++
Sbjct: 433 SD 434

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,823,687
Number of extensions: 1403090
Number of successful extensions: 4063
Number of sequences better than 10.0: 125
Number of HSP's gapped: 4039
Number of HSP's successfully gapped: 128
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)