Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039808.848ON48348324250.0
Kpol_1068.28.848ON49148314400.0
TDEL0A079708.848ON48948713800.0
Suva_13.4728.848ON51049013570.0
NCAS0C003508.848ON48648413490.0
Skud_13.4558.848ON49449013251e-180
KNAG0J002208.848ON49948813201e-179
TPHA0I003008.848ON49349213111e-178
YMR283C (RIT1)8.848ON51349013101e-177
NDAI0K003508.848ON50450513061e-177
ZYRO0G14344g8.848ON47248112901e-175
Smik_13.4968.848ON49449012881e-174
SAKL0D01276g8.848ON50247012411e-167
Kwal_27.102198.848ON50048312141e-163
KLTH0C03696g8.848ON47448312071e-162
Ecym_46238.848ON48049111911e-160
KLLA0D01386g8.848ON48949111871e-159
AFR451C8.848ON4084239331e-122
CAGL0E03520g4.40ON22676741.2
KLTH0G17798g4.171ON70686723.0
SAKL0C05192g1.176ON351158713.6
NDAI0D034804.121ON70899704.8
NDAI0A03470singletonON45797705.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03980
         (483 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   938   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   559   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   536   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   527   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   524   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   514   e-180
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   513   e-179
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   509   e-178
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   509   e-177
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   507   e-177
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   501   e-175
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   500   e-174
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   482   e-167
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   472   e-163
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   469   e-162
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   463   e-160
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   461   e-159
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   363   e-122
CAGL0E03520g Chr5 (325118..325798) [681 bp, 226 aa] {ON} similar...    33   1.2  
KLTH0G17798g Chr7 complement(1543360..1545480) [2121 bp, 706 aa]...    32   3.0  
SAKL0C05192g Chr3 (495987..497042) [1056 bp, 351 aa] {ON} highly...    32   3.6  
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    32   4.8  
NDAI0A03470 Chr1 (794669..796042) [1374 bp, 457 aa] {ON} Anc_3.1...    32   5.2  

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/483 (95%), Positives = 463/483 (95%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
           MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180
           WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE
Sbjct: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180

Query: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240
           LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD
Sbjct: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240

Query: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300
           GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH
Sbjct: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300

Query: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKL 360
           EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKL
Sbjct: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKL 360

Query: 361 EEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDM 420
           EEATTKII                    PEIFDTINPYFQDASNLAKKPILICCNSGNDM
Sbjct: 361 EEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGNDM 420

Query: 421 SVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480
           SVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS
Sbjct: 421 SVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480

Query: 481 YLM 483
           YLM
Sbjct: 481 YLM 483

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/483 (56%), Positives = 343/483 (71%), Gaps = 5/483 (1%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           S++ I KDIK EY+SLKNR+QSI+LD  FLE+ V+P FP +P+IPNERCGLWYC+PK FE
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGHINQWDFSTRRLNFHLLP LA++ GI+IVDSTRRGKKIPDALSKT+PIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN L+LE       DY KVLFVPP+TV NSEY RIL+K+  L+ +L  L ++   +LY
Sbjct: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242
              NGKL+RP W++PGSSLL +  D FTGE T + W  PE+E IIPIILCTVSY+AQDGV
Sbjct: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQDGV 249

Query: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHEK 302
           DKR GF YVQGAADDHELWS GL P  FW+NI+  ND+ +++ +L+  V+ L L    ++
Sbjct: 250 DKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDL-LAAKQKE 308

Query: 303 KASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSET--IEITKL 360
            + +  ++ F  L+ +T +I LGKI D  +I   L  EL  KFS+VI+ SE+  + ++K 
Sbjct: 309 VSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVSKN 368

Query: 361 EEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDM 420
           EE  T+ I                    PE+   I P+F      ++ PILICCNSG DM
Sbjct: 369 EEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGTDM 428

Query: 421 SVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480
           S+A++L +L K Y   W   TS    ++K +IRKHL KLIS L+GRNVNPSRATLNS+N 
Sbjct: 429 SIALVLMLLCKHYDLDWN--TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVNE 486

Query: 481 YLM 483
           YLM
Sbjct: 487 YLM 489

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/487 (56%), Positives = 343/487 (70%), Gaps = 12/487 (2%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
           +DSL  I KDIK EY+SL+NRLQSI+LD +FL  EV+PCFP YP++PNERCGLWYC+PK 
Sbjct: 11  IDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKD 70

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           F QTSYFKSTDGH NQWDFS+RRLNFH++P +AKSNGIIIVDSTRRGKK+PDALSKTIPI
Sbjct: 71  FTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPI 130

Query: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180
           WCAVLN L+LE         ++ L+VPP TVS SE++ I  +I ELV KLK+LEV+  KE
Sbjct: 131 WCAVLNHLMLESQGGSV--KQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKE 188

Query: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240
           L+    GKL+RPFW+YPGSS+L +  D FTGE T ++W +P + +IIPIILCTVSYQAQD
Sbjct: 189 LHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIILCTVSYQAQD 247

Query: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300
           GVDKRRGF YVQGAADDHELWS GL  K FW NID L +   ++  L+ FV  L+L    
Sbjct: 248 GVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCD 307

Query: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETI----E 356
             K      D F  ++ VTPE+SLG +IDN   + KL GE+    SLVI+LS+++    +
Sbjct: 308 LSK-EIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFPQK 366

Query: 357 ITKLEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNS 416
           + ++E A ++ I                     +I   I  +  D     +KP+LICCNS
Sbjct: 367 VAEMENA-SEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDK-QRKPVLICCNS 424

Query: 417 GNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLN 476
           G DMS+ ++L +L + Y+  WQL T     +SK V++KHLAKLIS L+GRNVNP RATLN
Sbjct: 425 GTDMSIGLLLVVLCRNYNMDWQLNTPTS--VSKIVVKKHLAKLISHLKGRNVNPPRATLN 482

Query: 477 SINSYLM 483
           S+NSYLM
Sbjct: 483 SVNSYLM 489

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/490 (55%), Positives = 340/490 (69%), Gaps = 12/490 (2%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           SLS I KD++ E +S++NRLQSI+LDN FL + V+P FP +PI+PNERCGLWYC+P  FE
Sbjct: 24  SLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPSSFE 83

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGH+NQWDFSTRRLNFHLL I+ ++ GIIIVDSTRRGKKIPDALSKT+PIWC
Sbjct: 84  QTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVPIWC 143

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN ++L+  + E +D +KVL+VPP TV  SEY  I  KI ELV KL+ L  +  K L 
Sbjct: 144 AVLNTIMLQE-TEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKTLN 202

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVPENENIIPIILCTVSYQAQDG 241
            +  GK++RP WV+PGSSLL+  VD FTGE    E W  PE++NIIPIILCTVSYQAQDG
Sbjct: 203 KLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSYQAQDG 262

Query: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTL---TLEE 298
           +DKR GF YVQGAADDHELWS GL+ K FW +IDYL D   +D  L  ++  L    LE 
Sbjct: 263 MDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKLEY 322

Query: 299 NHEKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358
               +   ++ DIFE+++++T EISLGK+I    I+ KL  EL   +  VII S ++ I 
Sbjct: 323 QLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVAIA 382

Query: 359 ----KLEEATT-KIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILIC 413
                +EE+ T   I                    P I   + P F + +    KPIL+C
Sbjct: 383 AHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAK-GMKPILVC 441

Query: 414 CNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRA 473
           CN+G DMS+ VIL+IL  KY+E W L TS+  +++K +IRKHL KLIS L GRNVNPSRA
Sbjct: 442 CNTGTDMSIGVILSILCAKYNEEWIL-TSELPVVNKIIIRKHLTKLISHLHGRNVNPSRA 500

Query: 474 TLNSINSYLM 483
           TLNS+NS+LM
Sbjct: 501 TLNSVNSFLM 510

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/484 (53%), Positives = 335/484 (69%), Gaps = 4/484 (0%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
           ++SL  I KDI+ E +S++NRLQSI+LDN FL +EV+PCFP++PIIPNERCGLWY  P+ 
Sbjct: 6   LESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPED 65

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           F+QTSYFKSTDGH NQWDFSTRRLNFHL P L  S GIIIVDSTRRGKKIPDALSKTIPI
Sbjct: 66  FKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPI 125

Query: 121 WCAVLN-CLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPK 179
           WCAVLN  ++L    ++ ID   VLF PP T+S +EY  I  +I +LV KL  L+++   
Sbjct: 126 WCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGN 185

Query: 180 ELYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQ 239
           EL+ +  GKL+RPFWVYPGSSLL +  D FTGE TG+ W+VP++ NIIPIILCT+SY+AQ
Sbjct: 186 ELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQ 245

Query: 240 DGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEEN 299
           DG DKR GF YVQGAADDHELWS GL P  FW +I++  ++  T+  + +FV+TL ++E 
Sbjct: 246 DGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL-VQEQ 304

Query: 300 HEKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITK 359
            +    S I D F+ ++ VTP++ LGKI DN VI   L  +LS +F+L IILSE +E+  
Sbjct: 305 DDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDP 364

Query: 360 LEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGND 419
           ++     I                      +I + I       +N   KPILICCN+G D
Sbjct: 365 VDNENLPI--STHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILICCNTGTD 422

Query: 420 MSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSIN 479
           MS+ ++L +L + YSE W L   +   + K +IRK L +LIS L+GR +N SRATLNS+N
Sbjct: 423 MSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSVN 482

Query: 480 SYLM 483
           +YLM
Sbjct: 483 NYLM 486

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  514 bits (1325), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 262/490 (53%), Positives = 338/490 (68%), Gaps = 12/490 (2%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           SLS I KD++ E +S++NRLQSI+LDN FL+  VV  FP++PI+PNERCGLWYC+P  F+
Sbjct: 8   SLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWYCEPSTFK 67

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           +TSYFKSTDGH+NQWDFSTRRLNFHLL  +    GIII+DSTRRGKKIPD+LSKT+PIWC
Sbjct: 68  RTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLSKTVPIWC 127

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN ++L+    E +D +KVL+VPP TV  SEY  I  KI ELV KLK L V+  ++L 
Sbjct: 128 AVLNTIMLQ-KEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVVDSEKLN 186

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVPENENIIPIILCTVSYQAQDG 241
           ++  GK++RP WV+PGSSLL+  VD FTGE    E W  P+++NIIPIILCTVSYQAQDG
Sbjct: 187 DLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVSYQAQDG 246

Query: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLT---LEE 298
           +DKR GF YVQGAADDHELWS GL+ + FW ++DYL D  K+D  L +++  L    LE 
Sbjct: 247 MDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLVAKKLEN 306

Query: 299 NHEKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358
               K   S+ +IF +++ +T EISLGK+I    I  KL  EL  ++  VI+ S+++ IT
Sbjct: 307 QLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFSDSVAIT 366

Query: 359 -----KLEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILIC 413
                + E +    I                    P I + +   F +      KPILIC
Sbjct: 367 EDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDG-GTKPILIC 425

Query: 414 CNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRA 473
           CN+G DMS+ VIL+IL  KY+E W+L T +   ++K +IR+HL KLIS L+GRNVNPSRA
Sbjct: 426 CNTGTDMSIGVILSILCTKYTEDWKL-TPELPEVNKIIIRRHLTKLISHLRGRNVNPSRA 484

Query: 474 TLNSINSYLM 483
           TLNS+NS+LM
Sbjct: 485 TLNSVNSFLM 494

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  513 bits (1320), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 259/488 (53%), Positives = 330/488 (67%), Gaps = 10/488 (2%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
           + SL  I K++K + RSL+NR+QSI+LDN FLE  V   FP++P+IPNERCGLWYC+P H
Sbjct: 17  LTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSH 76

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           F QTSYFKSTDGH NQWDFSTRRLNFHLLP L ++ G++IVDSTRRGKKIPDALSKT+P+
Sbjct: 77  FAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPL 136

Query: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180
           WCAVLN L+LE    +  +   VLFVPP TV  SE  ++ +K+ +LV KLK L V    +
Sbjct: 137 WCAVLNSLMLESVGKK-FNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTK 195

Query: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240
              M +GKL+RPFWV+PGSSLL +  D FTGE    +W V  +ENI+PIILCTVSYQAQD
Sbjct: 196 TSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQD 255

Query: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300
           G+DKR GF YVQGAADDHELWS GLE   FW NID   ++   D+ L E VD +  ++N+
Sbjct: 256 GIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNN 315

Query: 301 EKKASS---SIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEI 357
             + S+   S+  I   +++VT  +SLG+I DN  + S+   +L   +S VI+LSET+ +
Sbjct: 316 NMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHL 375

Query: 358 TKLEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAK-KPILICCNS 416
            K      +++                    P+I  TIN    +A  L   KP+LICCN+
Sbjct: 376 DKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTIN----NAIILQPIKPLLICCNT 431

Query: 417 GNDMSVAVILTILSKKYSEGWQLETSD-DLLISKTVIRKHLAKLISSLQGRNVNPSRATL 475
           G DMS+ V+L +L + Y E W L   D    +SK VIR+HL KLI+ L GRNVNPSRATL
Sbjct: 432 GKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSRATL 491

Query: 476 NSINSYLM 483
           NSINS+LM
Sbjct: 492 NSINSFLM 499

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  509 bits (1311), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 262/492 (53%), Positives = 340/492 (69%), Gaps = 15/492 (3%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           S++ I KDI+ E +SLKNR+ SI+LD+ FL+ +V+P FP YP++PNERCGLWYC   +F 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
            TSYFKSTDGHINQWDFSTRRLNFHL+P++ +  GIII+DSTRRGKKIPDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN +IL+H  NE     +VLFVPPATVS SEY RI  KI ELV KL  L+V+  K+LY
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVP-ENENIIPIILCTVSYQAQD 240
               G L+RP W++PGSS+L +  DPFTGE  +   W  P + E IIPI+LCTVSYQ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300
           GVD R GF YVQGAADDHELWS GL P+ FW+NI+ LN++  ++ +L+++V+ + L E+ 
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLSESM 304

Query: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKL 360
            K  +  +  +F+S++++T E+ LG I+D   I   L    +  +SLVIILS +I++   
Sbjct: 305 -KITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363

Query: 361 EE---------ATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPIL 411
           E+         + T II                    PEI D +      +S   KKPIL
Sbjct: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELS-SSGSTKKPIL 422

Query: 412 ICCNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPS 471
           +CCN+G+DMS+AVIL  LSK Y++ W+  TS+   I+K  IRKHL K+IS L GRNVNPS
Sbjct: 423 VCCNNGSDMSIAVILVTLSKFYTQEWR-RTSEHTEINKITIRKHLTKVISHLGGRNVNPS 481

Query: 472 RATLNSINSYLM 483
           RATLNS+N +LM
Sbjct: 482 RATLNSVNDFLM 493

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  509 bits (1310), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/490 (53%), Positives = 334/490 (68%), Gaps = 12/490 (2%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           SLS I KDI+ E +S++NRLQSI+LDN FL++ V+P FP+YP+IPNERCGLWYC+P  F+
Sbjct: 27  SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFK 86

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGH+NQWDFSTRRLNFHLL  +  + GIIIVDSTRRGKKIPDALSKT+PIWC
Sbjct: 87  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 146

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN L+L+  + + +  +KVL++PP TV  SEY  I  KI ELV KL+ L ++  K+L 
Sbjct: 147 AVLNTLMLQE-TEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVPENENIIPIILCTVSYQAQDG 241
            +  GKL+RP WV+PGSSLL   VD FTGE    E W  PE++NIIPIILCTVSYQAQDG
Sbjct: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDG 265

Query: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHE 301
           +DKR GF YVQGAADDHELWS GL+   FW +I+YL D   +D  L +++  L   +   
Sbjct: 266 MDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRN 325

Query: 302 K---KASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358
           +   +   S+ ++F +++++T EISLGK+     I+  L  +L  ++  VII S ++ + 
Sbjct: 326 QCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVA 385

Query: 359 -----KLEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILIC 413
                + E  T   I                    P I   I   F +      KP+LIC
Sbjct: 386 EDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDE-KIKPMLIC 444

Query: 414 CNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRA 473
           CN+G DMS+ VIL+IL  KY+E W L TS+   ISK ++RKHL KLIS L+GRNVNPSRA
Sbjct: 445 CNTGTDMSIGVILSILCTKYTEEWML-TSELPDISKLIVRKHLTKLISHLKGRNVNPSRA 503

Query: 474 TLNSINSYLM 483
           TLNS+NS+LM
Sbjct: 504 TLNSVNSFLM 513

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  507 bits (1306), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 270/505 (53%), Positives = 335/505 (66%), Gaps = 29/505 (5%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
            DSLS I KDIK EY+SL+NRLQSI+LDN FL +E++  FPNYPIIPNERCGLWY  P  
Sbjct: 7   FDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQ 66

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           + QTSYFKSTDGH NQWDFSTRRLNFHLL  +AKS GI I+DSTRRGKKIPDALSKTIPI
Sbjct: 67  YNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPI 126

Query: 121 WCAVLNCLILEH--ASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKP 178
           WCAVLN ++L      N+ +  E  LFVPPATV  SEY  IL+KI  LV KL  LE++  
Sbjct: 127 WCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINA 186

Query: 179 KELYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGE-RWSVPENENIIPIILCTVSYQ 237
            EL +  +GKL+RP W+YPGSS+LH+  D FTGE T    W  P  ENIIPI+LCT+SYQ
Sbjct: 187 NELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVLCTISYQ 244

Query: 238 AQDGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVD---TL 294
           AQDGVDKR GF YVQGAADDHELWSCGL P+ FW +I+YL +   +D  L E+V     +
Sbjct: 245 AQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEM 304

Query: 295 TLEENHEKKASSSIIDIF-ESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSE 353
            ++++  K    ++  IF   ++ +TPEISLGKI +N  I   +  E    FSLV+ILSE
Sbjct: 305 KIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSE 364

Query: 354 TIEITK--LEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPIL 411
           T+ +     +E  +  +                    P+I++ +     +      KPIL
Sbjct: 365 TVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG-----KPIL 419

Query: 412 ICCNSGNDMSVAVILTILSKKY------SEGW---QLETSDDLL----ISKTVIRKHLAK 458
           ICCN+G D+S+ +ILTIL K Y       + W   + ET D  +    + KT+IRK+L  
Sbjct: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479

Query: 459 LISSLQGRNVNPSRATLNSINSYLM 483
           LIS L+GRNVNPSRATLNS+N YLM
Sbjct: 480 LISHLEGRNVNPSRATLNSVNDYLM 504

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  501 bits (1290), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 258/481 (53%), Positives = 327/481 (67%), Gaps = 16/481 (3%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           SL+ I +DIK EY SL+NR+QSI+ DN+F+   V+P FPNYP+IPNERCGLWYCDPK F+
Sbjct: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGH NQWDFSTRRLN HLLPIL + NGIIIVDSTRRGK +PDALSKTIPIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN L+      +P D  +VLF PP  VS SE+  I  +I  LV +L+ L++L  ++L 
Sbjct: 128 AVLNSLM------QP-DKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR 180

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242
           N   GK++RPFWVYPGS +L +  DPFTGE    +W    NE IIPIILCT SY+AQDGV
Sbjct: 181 NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGV 240

Query: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHEK 302
           DKR GF YVQGAADDHELWSCGL+PK  W N  Y +D+ + D  L+  V TL +E     
Sbjct: 241 DKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTL-IELAETT 299

Query: 303 KASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLEE 362
              + + DI E ++ +T E+SLGK+ D+  I   +  EL  +FSLVIILS+++ ++K   
Sbjct: 300 DHRNHLADIVE-MDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSK--- 355

Query: 363 ATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDMSV 422
                I                     EI   ++ +  +   + +KPI++CCNSG D+SV
Sbjct: 356 -PFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHL-NKDVVKRKPIMVCCNSGTDISV 413

Query: 423 AVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINSYL 482
            VIL IL K YS+ W L   D   ++K VIR+HL ++I+ ++ RNVNPSRATLNSINS+L
Sbjct: 414 GVILMILCKYYSQDWLLGKPDS--VNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFL 471

Query: 483 M 483
           M
Sbjct: 472 M 472

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 251/490 (51%), Positives = 338/490 (68%), Gaps = 12/490 (2%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           SL+ I +D++ E +S++NRLQSI+LDN FL++ V+P FP +P++PNERCG+WYC P  ++
Sbjct: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGH+NQWDFSTRRLNFHLL  +  + GIIIVDSTRRGKKIPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN ++L+  + E  D +K L++PP TV  SEY  I  KI ELV KL+ L ++  K+L 
Sbjct: 128 AVLNTIMLQE-TEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLN 186

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVPENENIIPIILCTVSYQAQDG 241
            +  GK++RP WV+PGSSLL+  VD FTGE    E W  PE++NIIPIILCTVSYQAQDG
Sbjct: 187 ELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDG 246

Query: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLT---LEE 298
           +DKR GF YVQGAADDHELWS GL+ K FW ++++L D   +D  L +++  L    L+ 
Sbjct: 247 MDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKS 306

Query: 299 NHEKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358
               +    + +IF  ++++T EISLGK++    I+ KL  EL  ++  V+ILS+++ + 
Sbjct: 307 QMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVA 366

Query: 359 K---LEEATTK--IIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILIC 413
           +   + EAT     I                    P+I + +   F + +    +P+L+C
Sbjct: 367 EDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAE-EMRPMLVC 425

Query: 414 CNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRA 473
           CN+G DMS+ VIL+IL  KY+E W L T +   ++K +IRKHL KLIS L GRNVNPSRA
Sbjct: 426 CNTGTDMSIGVILSILCTKYTEEWML-TQELPEVNKIIIRKHLTKLISHLHGRNVNPSRA 484

Query: 474 TLNSINSYLM 483
           TLNS+NS+LM
Sbjct: 485 TLNSVNSFLM 494

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  482 bits (1241), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/470 (52%), Positives = 320/470 (68%), Gaps = 17/470 (3%)

Query: 17  SLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFEQTSYFKSTDGHINQ 76
           SL+NRLQSII D+ FL   V+P FP+YP++PNERCGLWYC+P+ F Q SYFKSTDGHINQ
Sbjct: 47  SLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQ 106

Query: 77  WDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWCAVLNCLILEHASNE 136
           WDFSTRRLNFHLLP +A+  GI+I+DSTRRGKKIPDALSKTIPIWCAV+N LILE ASN 
Sbjct: 107 WDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILE-ASNR 165

Query: 137 PIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELYNMTNGKLIRPFWVY 196
               E+VLF PP TV  SEY RI  +I  LV KLK L ++   EL     GK++RP WVY
Sbjct: 166 S---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVY 222

Query: 197 PGSSLLHTIVDPFTGEPT-GERWSVPENENIIPIILCTVSYQAQDGVDKRRGFIYVQGAA 255
           PGSSL  +  D FTG+ T  ++W  PE+++ +P+ILCT SYQ QDGVDKR GF YVQGAA
Sbjct: 223 PGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAA 282

Query: 256 DDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHE-KKASSSIIDIFES 314
           DDHELW+ GL P  FW+N ++L D  K++  L E+V+    E     K+AS + ++   S
Sbjct: 283 DDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFS 342

Query: 315 LNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLEE-ATTKIIXXXXX 373
           ++ +T E+ LG ++D   ++ KL  +L  +++L ++LSE+++I  ++E   TKI      
Sbjct: 343 VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTSG 402

Query: 374 XXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDMSVAVILTILSKKY 433
                                I P  Q + N +  PILICCN+G DMSV V+L  L + Y
Sbjct: 403 NKKSSKELRSKLIE-------ICPLIQASLN-SPLPILICCNTGKDMSVGVLLATLCQNY 454

Query: 434 SEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINSYLM 483
            E W + + +    +KT+IRKHL +LIS L+GRNVNPSRATLNS+N+YLM
Sbjct: 455 DEDWCIGSPNSF--NKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  472 bits (1214), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 236/483 (48%), Positives = 322/483 (66%), Gaps = 18/483 (3%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           +L+ + K+IK E ++L+NRLQSI+ D+ FLE +V+  FPNYP+IPNERCGLWYCDP+ + 
Sbjct: 34  TLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPERYS 93

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGH NQWDFS RRLN HLLP + +  GI+IVDSTRRGK++PDALSKT+PIWC
Sbjct: 94  QTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWC 153

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN ++LE   +E    E+VLF PP TVS SE+ RI  +I  LV + K L +    EL+
Sbjct: 154 AVLNSIMLEGRQSE----EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDELF 209

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242
            + +GK++RP WVYPG+SLL++  DPFTG+     W   +NEN +P++LCTVSYQ QDGV
Sbjct: 210 KILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEA-QNENFMPVVLCTVSYQCQDGV 268

Query: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHEK 302
           DKR GF YVQGAADDHELW+ GL  + FW++I+   D   +D  L  +V+ L    +   
Sbjct: 269 DKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGDANN 328

Query: 303 KASSSI-IDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLE 361
           K + S+ +D   + N +T E+ LG++ +N  +D  L  +L  K+SLV++LS +I +   E
Sbjct: 329 KLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLSTSISV--YE 386

Query: 362 EATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDMS 421
           EA    I                     +I   I    Q++      P+LICCN+G DMS
Sbjct: 387 EAEN--IRIFKLQSGSKKSSRALRAALTQICPLIEANLQNS-----LPVLICCNNGKDMS 439

Query: 422 VAVILTILSKKYS-EGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480
           V V+L++L + ++ E WQLE      + K++I+KHLAK+I+ L GRN+NP R +LNS+N 
Sbjct: 440 VCVVLSVLCRNFNVESWQLEQRPS--VHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVND 497

Query: 481 YLM 483
           YLM
Sbjct: 498 YLM 500

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  469 bits (1207), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 320/483 (66%), Gaps = 18/483 (3%)

Query: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62
           +++ + ++IK EYRSL+NRLQSI+ D+ FL+ +V   FP+YPIIPNERCG+WYCDPK + 
Sbjct: 8   TINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYL 67

Query: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122
           QTSYFKSTDGH NQWDFS RRLNFHLLP LA S GI++VDSTRRGK++PDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWC 127

Query: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182
           AVLN L+LE+   E     +VLF PP TVS  E+ RI  +I +LV K K + +L   ++ 
Sbjct: 128 AVLNSLLLEYQGLEG----EVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADID 183

Query: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242
            +  GK++RP WV+PG+SLL +  DPFTGE   ++W   E EN IP++LCTVSYQ QDGV
Sbjct: 184 RLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGV 243

Query: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFV-DTLTLEENHE 301
           DKR GF YVQGAADDHELW+ GL  + FW++I  L++I  +D  L+ FV D +  +E + 
Sbjct: 244 DKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNS 303

Query: 302 KKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLE 361
            +   S+  I  + + +T E+ LGKI  N  +   L  EL  K+SLVIILS T+ +++ +
Sbjct: 304 AENGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE-D 361

Query: 362 EATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDMS 421
           EA  KI                       + +   P           P+L+CCN+G DMS
Sbjct: 362 EAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLP--------NSLPMLVCCNTGKDMS 413

Query: 422 VAVILTILSKKYSEG-WQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480
           V V L IL + Y+ G W L       I K  I+KHL+K+I+ L+GRNVNP RA+LNS+N+
Sbjct: 414 VCVSLAILCRNYNVGSWDLNVQQS--IHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNA 471

Query: 481 YLM 483
           YLM
Sbjct: 472 YLM 474

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  463 bits (1191), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 238/491 (48%), Positives = 322/491 (65%), Gaps = 25/491 (5%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
           +D+L  IKK+I+ +  SL+NRLQS+  D+ F+ NEV+P FPNYP++PNERCGLWYC+P  
Sbjct: 7   LDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGK 66

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           +EQT YFKSTDGH NQWDFSTRRLNFH+L  +A++ GIIIVDSTRRGKK+PDALSKTIPI
Sbjct: 67  YEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPI 126

Query: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180
           WCAVLN L+L++   E  D    LF PP TVS  E+  I  K+ +LV KLK L ++  +E
Sbjct: 127 WCAVLNNLMLDYKGKE--DSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEE 184

Query: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240
           LYNM  GK++RPFWVYPGS LL T  D FTGE  G  W   +N   IP+ILCT SYQ QD
Sbjct: 185 LYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS--IPVILCTASYQCQD 242

Query: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFV------DTL 294
           G DK  GF YVQGAADDHELW+ GL P+ FW+NI++L D  K++  L++FV      + L
Sbjct: 243 GEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKL 302

Query: 295 TLEENHE--KKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILS 352
           T + N +  +++SSS I + E    +T  + LG + +   +   +  EL  K+SL II S
Sbjct: 303 TAQSNKQSDRESSSSFIKVDE----ITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358

Query: 353 ETIEITKLEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILI 412
           ++  +T   +   + I                     EI   I  +  D     + PILI
Sbjct: 359 QS--VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITD-----QLPILI 411

Query: 413 CCNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSR 472
           CCN+G D+S+ ++LT L + Y   W LE  +   ++KT+++KHLA++I+ L G N+NPSR
Sbjct: 412 CCNTGKDISIGIMLTALCQHYDLQWHLEEQE--TVNKTIVKKHLARIITKLSGININPSR 469

Query: 473 ATLNSINSYLM 483
           +TL ++N++L+
Sbjct: 470 STLKNVNAFLL 480

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  461 bits (1187), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 247/491 (50%), Positives = 321/491 (65%), Gaps = 15/491 (3%)

Query: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60
           +  +  I K+++ E +SLKNRLQSII DN+FL+ +V P F  YP++PNERCGLWYCDPK 
Sbjct: 6   LREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWYCDPKI 64

Query: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120
           ++ TSYFKSTDGH+NQWDFSTRRLNFHLLP+L ++ G++I+DSTRRGKKIPDALSKT+PI
Sbjct: 65  YDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALSKTVPI 124

Query: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180
           WCAVLN L+LE    +    E++LFVPP+TV  SE+ R+  K+ ELV KLK L+++  K+
Sbjct: 125 WCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDIIDVKK 184

Query: 181 LYNM-----TNGKLIRPFWVYPGSSLLHTIVDPFTGEPT-GERWSVPENENIIPIILCTV 234
           L         + KL+RP WVYPGSSLL    D F+GE      W  P   NIIP+ILCTV
Sbjct: 185 LRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPP--SNIIPVILCTV 242

Query: 235 SYQAQDGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTL 294
           SYQ QDG DKR GF YVQGAADDHELW+  L P+ FWENID L DI K+DA LK+  + +
Sbjct: 243 SYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDSYNAV 302

Query: 295 TLEENHEKKA--SSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILS 352
            L    +     S  I  + E ++ +T  + LGKI     I  K    L+ K+S V++  
Sbjct: 303 ILRAKVQNSLDISGDISKMLE-IDTITARLHLGKITSQFRITPKTVKYLNQKYSAVVLCH 361

Query: 353 ETIEITKLEEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILI 412
           E I +T++ E   + I                     +I   I          A  PILI
Sbjct: 362 EAISVTEITE-LPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAANLPILI 420

Query: 413 CCNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSR 472
            C+SG D+SV+++L  L K Y+  W+L+  D   ++KT+I+KHLAK+I SLQGRNVNPSR
Sbjct: 421 ACDSGKDISVSILLVALCKYYNLDWELQPQDS--VNKTIIKKHLAKIIESLQGRNVNPSR 478

Query: 473 ATLNSINSYLM 483
           A+LNS+NS+LM
Sbjct: 479 ASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  363 bits (933), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 199/423 (47%), Positives = 261/423 (61%), Gaps = 18/423 (4%)

Query: 62  EQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIW 121
           E T YFKSTDGH+N WDFS RRLNFHLLP+LA+ +G IIVDSTRRGKKIPDALSKTIPIW
Sbjct: 3   ETTCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIW 62

Query: 122 CAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKEL 181
           CAVLN LILEH         +VLF PP TVS  EY+RI  K+ ELV KLK ++ +   EL
Sbjct: 63  CAVLNTLILEHTEGS----GEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAEL 118

Query: 182 YNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDG 241
            ++  G+L+RPFWVYPG+++L T  D FTGE   E W  P    +IP+ILCT S Q QDG
Sbjct: 119 CSLLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQPP--PGVIPLILCTASRQCQDG 176

Query: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLT-LEENH 300
           VDK +G+ YVQGAADDHELW+ GL P  FW N+  L D    + +L+  V+ +  L ++ 
Sbjct: 177 VDKSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKST 236

Query: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKL 360
             +A +  +   E+ + VT  + LG +   C I  K    L  ++SLV++   +IE++  
Sbjct: 237 HTEAVAHELPCRET-DVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSA- 293

Query: 361 EEATTKIIXXXXXXXXXXXXXXXXXXXXPEIFDTINPYFQDASNLAKKPILICCNSGNDM 420
             A    I                     EI   I+    +A      P+LICC+SG+D+
Sbjct: 294 -AAPHPRIRIYPLNSGCKKSSRALRPALIEIIPLISTALCEA-----LPVLICCSSGSDI 347

Query: 421 SVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480
           SV ++L  L K Y   W+ E   D+  +KT+I+KHL KL S + GR +NPSR TLNS+N+
Sbjct: 348 SVGIVLAALCKNYDLEWRHEDQKDM--TKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNA 405

Query: 481 YLM 483
           +LM
Sbjct: 406 FLM 408

>CAGL0E03520g Chr5 (325118..325798) [681 bp, 226 aa] {ON} similar to
           uniprot|P36523 Saccharomyces cerevisiae YLR312wa MRPL15
          Length = 226

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLND---IGKT---DAVLKEFVDTL 294
           G    +G +  Q AA+   + +  LEP  FW+  D LND    GK+     VL  F+  +
Sbjct: 125 GTPVSKGLVSYQTAAE--YVIAKNLEPLVFWKVSDPLNDGPIKGKSKVMSTVLNSFIGAI 182

Query: 295 TLEENHEKKASSSIID 310
            L++  EKKAS  I++
Sbjct: 183 LLQQG-EKKASQFIVE 197

>KLTH0G17798g Chr7 complement(1543360..1545480) [2121 bp, 706 aa]
           {ON} conserved hypothetical protein
          Length = 706

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 9/86 (10%)

Query: 123 AVLNCLILEHASNE--PI--DYEKVLFVPPATVSNS---EYHRILEKIEELVWKLKALEV 175
           A+L CLILE+A  E  P+   +EK L +   T  ++   +  R L+K+    W L+ LE 
Sbjct: 234 AILECLILEYAPQEQQPLFEKFEKSLALLKRTRFDTRCWKQTRSLQKLHGDDWILEKLET 293

Query: 176 LK--PKELYNMTNGKLIRPFWVYPGS 199
           LK  P+ L +  N  +I P    P S
Sbjct: 294 LKFVPRTLLDALNFDVIMPQDASPFS 319

>SAKL0C05192g Chr3 (495987..497042) [1056 bp, 351 aa] {ON} highly
           similar to uniprot|P08524 Saccharomyces cerevisiae
           YJL167W ERG20 Farnesyl pyrophosphate synthetase, has
           both dimethylallyltranstransferase and
           geranyltranstransferase activities; catalyzes the
           formation of C15 farnesyl pyrophosphate units for
           isoprenoid and sterol biosynthesis
          Length = 351

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 63/158 (39%), Gaps = 21/158 (13%)

Query: 172 ALEVLKPKELYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIIL 231
           A+E  K    YN   GKL R      G S++ T V    G  + E  +  E   +  +  
Sbjct: 34  AVEWYKKSLTYNTPGGKLNR------GLSVIDTYV-ILKGLGSHEDLTAEEYNKVSTLGW 86

Query: 232 CTVSYQAQDGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFV 291
           C    QA         F+     ADD    S     +  W  +D + DI   DA + E  
Sbjct: 87  CIELLQAY--------FL----VADDMMDKSITRRGQPCWYRVDNVGDIAINDAFMLEGA 134

Query: 292 DTLTLEENHEKKASSSIIDIFESLNRVTPEISLGKIID 329
               L++N   +     +D+ E L+ VT +  LG+++D
Sbjct: 135 IYCLLKKNF--RGEPFYVDLLELLHDVTFQTELGQLLD 170

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {ON}
           Anc_4.121
          Length = 708

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 12/99 (12%)

Query: 392 FDTINPYFQ--DASNLAKKPILI--CCNSGNDMSVAVILTILSKKYSEGWQLETSD---D 444
           F+TI+P     D S + +K I I     SG D+S++ +L I+S  +   + +  S    D
Sbjct: 173 FETIHPIIPVLDRSLVRQKLIGIYNSIQSGTDLSISNLLLIMSIFFCSSYSIVASSIIPD 232

Query: 445 LLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINSYLM 483
           LL+     + H       L   +V P+R TL S+ S+L+
Sbjct: 233 LLLCNKYYQSH-----KYLLELSVFPTRPTLESLQSFLI 266

>NDAI0A03470 Chr1 (794669..796042) [1374 bp, 457 aa] {ON} Anc_3.120
           YOL082W
          Length = 457

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 10/97 (10%)

Query: 272 ENIDYLNDIGKTDAVLKEFVDTLTLEENHEKK-------ASSSIIDIFESLNRVTPEISL 324
           E+++ +N+I K    L+E+V     EEN+ K+        + ++I  F++L     E  L
Sbjct: 137 ESVNKVNEIMKKMDSLEEWVKKSYTEENNNKRIFLDIPIGNKNLISFFQNLK---SEDDL 193

Query: 325 GKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLE 361
            K++D   +   L  +  G   + ++L E +E  + E
Sbjct: 194 EKLVDEYELYQDLKKQYDGHMGIEMLLDEALERRRFE 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,968,124
Number of extensions: 2386812
Number of successful extensions: 6868
Number of sequences better than 10.0: 34
Number of HSP's gapped: 6966
Number of HSP's successfully gapped: 38
Length of query: 483
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 370
Effective length of database: 40,524,141
Effective search space: 14993932170
Effective search space used: 14993932170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)