Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039608.846ON27827814730.0
ZYRO0G14300g8.846ON2802775871e-74
KNAG0J002408.846ON2862815741e-72
Skud_13.4538.846ON3002985612e-70
YMR281W (GPI12)8.846ON3043005561e-69
Smik_13.4948.846ON3043005542e-69
Suva_13.4708.846ON3032985527e-69
NDAI0K003308.846ON3133055413e-67
TDEL0B005208.846ON2682795165e-64
CAGL0M03047g8.846ON3042925161e-63
Kpol_1068.48.846ON2912865116e-63
NCAS0C003808.846ON2762774984e-61
TBLA0B033008.846ON3193114841e-58
Kwal_27.102278.846ON2542804772e-58
SAKL0D01320g8.846ON2602744755e-58
KLTH0C03740g8.846ON2542674661e-56
Ecym_46178.846ON2492674521e-54
TPHA0I002808.846ON3012994501e-53
ABL120W8.846ON2492644372e-52
KLLA0D01430g8.846ON2632604103e-48
Skud_13.2352.492ON74150675.5
NDAI0K023406.362ON33071665.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03960
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   572   0.0  
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   230   1e-74
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   225   1e-72
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   220   2e-70
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   218   1e-69
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   218   2e-69
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   217   7e-69
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   213   3e-67
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   203   5e-64
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   203   1e-63
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   201   6e-63
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   196   4e-61
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   191   1e-58
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   188   2e-58
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   187   5e-58
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   184   1e-56
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   178   1e-54
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   177   1e-53
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   172   2e-52
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   162   3e-48
Skud_13.235 Chr13 complement(396755..398980) [2226 bp, 741 aa] {...    30   5.5  
NDAI0K02340 Chr11 (523158..524150) [993 bp, 330 aa] {ON} Anc_6.3...    30   5.9  

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/278 (100%), Positives = 278/278 (100%)

Query: 1   MIHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAH 60
           MIHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAH
Sbjct: 1   MIHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAH 60

Query: 61  PDDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKE 120
           PDDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKE
Sbjct: 61  PDDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKE 120

Query: 121 IFIFNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYI 180
           IFIFNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYI
Sbjct: 121 IFIFNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYI 180

Query: 181 QSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYI 240
           QSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYI
Sbjct: 181 QSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYI 240

Query: 241 TAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278
           TAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH
Sbjct: 241 TAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  230 bits (587), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 176/277 (63%), Gaps = 16/277 (5%)

Query: 10  KITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFS 69
           K  K+  + W L+I  S +I+  N  + N  +  L        SL+LVVAHPDDEVMFF+
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFL----DEIDSLSLVVAHPDDEVMFFA 61

Query: 70  PTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP--RRNKEIFIFNHT 127
           PT+L+LDS LPPN +FN++  S G A+ LG  R  EL  S+++L+   +R  ++   ++ 
Sbjct: 62  PTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYP 121

Query: 128 DGMNEVWDNKLMLHQL-ESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKN 186
           DG  E WD + +   + +S+L   ++++LLTFD  GVS H+NH ACH+ V++ +Q  +  
Sbjct: 122 DGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNV 181

Query: 187 NFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDH--------LALFNPYSD 238
             AL LDSY  N++ KY+ F W++  L +++++H + LP   +        + L + YS 
Sbjct: 182 KAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLH-RVLPTSSYNENKPATEITLMSDYSS 240

Query: 239 YITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKL 275
           YI ++A+ML +HKSQMVWFRYGWW FSRFV+VNDLK+
Sbjct: 241 YILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  225 bits (574), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 123/281 (43%), Positives = 172/281 (61%), Gaps = 18/281 (6%)

Query: 5   SKLIFKITKLTLIFWCLYIVLS-PKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDD 63
           S+ I+K+TKL+L+   LYI  S  KI   N   L T          +  S+ LV+AHPDD
Sbjct: 7   SRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL------GEHDINSVNLVIAHPDD 60

Query: 64  EVMFFSPTLLQLDSHLP-PNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIF 122
           EVMFF+P+L+ L+  +  P+  FNII +S+G A+GLG++R  EL+ SI ML+P RN  I 
Sbjct: 61  EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIV 120

Query: 123 IFNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQS 182
           + +  DGM E WD K M+ +L +I+     N+LLTFD  GVS H+NH AC++    Y   
Sbjct: 121 VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE 180

Query: 183 -HAKNNFALL-LDSYSSNLLKKYTGFAWQLVFLAKNYWIH---GKTLPNLD-----HLAL 232
             +K    +L L SYS N++KKY+ + W+L+ L  + W+    G  LP         + +
Sbjct: 181 FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI 240

Query: 233 FNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDL 273
           F+ Y  Y+ + A ML AHK+Q+VWFRYGWWFFSR V+VNDL
Sbjct: 241 FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  220 bits (561), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 180/298 (60%), Gaps = 25/298 (8%)

Query: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61
           ++ SKL++KITKL ++   LYI  +PKI   ND++L    P     ++ D  + LV+AHP
Sbjct: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPH----KNRDSQINLVIAHP 62

Query: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP-RRNKE 120
           DDEVMFFSP + QL S+ P    FNII  S G+A+GLG  R  EL  S  +L+   R   
Sbjct: 63  DDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVS 122

Query: 121 IFIFNHTDGMNEVWD-NKLMLHQLESI-LSDSQTN-ILLTFDQFGVSNHINHKACH---- 173
           + + +  DGM+EVWD N ++    ++I LS+ Q N I++TFD +GVS+HINHK+CH    
Sbjct: 123 VQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVK 182

Query: 174 QVVTSYIQSHAKNN------FALLLDSYSSNLLKKYTGFAWQLVFLAKNYWI-------H 220
           +++  Y +S A+ N       AL L SY +N++ KY  F W+++ +  +  +        
Sbjct: 183 RLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQP 242

Query: 221 GKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278
             T      L L N ++ Y+ AYA ML AHKSQ+VWFRYGWW  SRFV+VN+  +YT+
Sbjct: 243 PTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY 300

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  218 bits (556), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 174/300 (58%), Gaps = 27/300 (9%)

Query: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61
           ++ SKL++KITKL ++   LYI  +PKI   N+  L    P     +  D  + LV+AHP
Sbjct: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPH----KYGDYEINLVIAHP 64

Query: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLI-PRRNKE 120
           DDEVMFFSP + QL+S+ P    FNII  S G+AEGLG  R  EL  S  +L+   R   
Sbjct: 65  DDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVS 124

Query: 121 IFIFNHTDGMNEVWDNKLM---LHQLESILSDSQTNILLTFDQFGVSNHINHKACH---- 173
           + + +  DGM+E+WD   +   L Q   I + +   I++TFD +GVSNHINHK+C+    
Sbjct: 125 VQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVK 184

Query: 174 QVVTSYIQSHAKNN------FALLLDSYSSNLLKKYTGFAWQLV---------FLAKNYW 218
           ++V  Y Q   K N       AL L SY +N++ KY  F W+++         F      
Sbjct: 185 KLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQA 244

Query: 219 IHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278
           +   T    D L+L N ++ Y+ A+ATML AH+SQ+VWFRYGWW FSRFV+VN+  +YT+
Sbjct: 245 LPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY 304

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  218 bits (554), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 171/300 (57%), Gaps = 27/300 (9%)

Query: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61
           ++ SKL++KITKL+++   LYI  +PKI   N++ L    P    ++ +D  + L++AHP
Sbjct: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFP----NKYSDYQINLIIAHP 64

Query: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLI-PRRNKE 120
           DDEVMFFSP + QL S+ P    FNII  S G+AEGLG  R  EL  S  +L+   R   
Sbjct: 65  DDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVS 124

Query: 121 IFIFNHTDGMNEVWDNKLM---LHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVT 177
           + + +  DGMNEVWD   +   L Q   I ++    I++TFD +GVS HINHK+CH  V 
Sbjct: 125 VQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVR 184

Query: 178 SYIQSHAKNNF----------ALLLDSYSSNLLKKYTGFAWQLV---------FLAKNYW 218
             I  + ++N           AL L SY +N++ KY  F W+++         F      
Sbjct: 185 KLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQA 244

Query: 219 IHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278
           +    +   + L L N ++ YI A+A ML AHKSQ+VWFRYGWW  SRFV+VN+  +Y +
Sbjct: 245 LPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYIY 304

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  217 bits (552), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 124/298 (41%), Positives = 172/298 (57%), Gaps = 28/298 (9%)

Query: 5   SKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDE 64
           SKL+FKITKL ++   LYI  +PKI   N   L    P     R  +  + LV+AHPDDE
Sbjct: 10  SKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPH----RDRNSQINLVIAHPDDE 65

Query: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP-RRNKEIFI 123
           VMFFSP + QL ++ P    FNI+  S GDAEGLG  R+ EL  S  +L+   R   + +
Sbjct: 66  VMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQV 125

Query: 124 FNHTDGMNEVWDNKLM---LHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYI 180
            +  DGM+EVWD   +   L Q   + ++  + I++TFD +GVSNHINHK+CH  V  +I
Sbjct: 126 MDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFI 185

Query: 181 --------QSHAKNNF--ALLLDSYSSNLLKKYTGFAWQLV-FLAKNYWIHGKTLPNL-- 227
                   +  A+N    AL L SY +N+  KY  F W+++  L +     G+++  L  
Sbjct: 186 DDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAA 245

Query: 228 -------DHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278
                  + L L N +S YI A+A ML AHKSQ+VWFRYGWW  SRFV+VN+  ++T+
Sbjct: 246 PSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFTY 303

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  213 bits (541), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 137/305 (44%), Positives = 177/305 (58%), Gaps = 36/305 (11%)

Query: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLI--KDRS----NDP--S 53
           +  SK  +K  KL L+ W  Y++ + KI   N +  +  + + I  +D S    ++P   
Sbjct: 3   LRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQ 62

Query: 54  LTLVVAHPDDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDML 113
           L+LV+AHPDDE+MFF+PTLLQL+  LP +  FNII +SDGDAEGLG LR  EL  SI++L
Sbjct: 63  LSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLL 122

Query: 114 IPRRNKE---IFIFNHTDGMNEVWDNKLMLHQLESIL-----SDSQTNILLTFDQFGVSN 165
           +   N     I I +  DGM++VWD K +L  L++ L        + NILLTFD  G+SN
Sbjct: 123 LSSSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISN 182

Query: 166 HINHKACHQVVTSYI-----QSHAKNNFALLLDSYSS------NLLKKYTGFAWQLVFLA 214
           H NH AC++ V   I     +    N   L+L S S       NLL KYT F   LV   
Sbjct: 183 HPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLV--- 239

Query: 215 KNYWIHG----KTLPNLDHLAL--FNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFV 268
           K YW        T+PN   L L   N YS YI +YA+ML  HKSQMVWFRYGWW+FSRFV
Sbjct: 240 KVYWNLATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFV 299

Query: 269 YVNDL 273
           + NDL
Sbjct: 300 FSNDL 304

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  203 bits (516), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 114/279 (40%), Positives = 167/279 (59%), Gaps = 18/279 (6%)

Query: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61
           +++S    K+ KL      LY+ L+ +I   N+        ++        SLTL++AHP
Sbjct: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAI----GTPESLTLLIAHP 56

Query: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLI--PRRNK 119
           DDEVMFFSP+LLQLD  LP + +FN +  S GDA+ LG  R  EL  S+++L    +R  
Sbjct: 57  DDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKT 116

Query: 120 EIFIFNHTDGMNEVWDNKLMLHQLES-ILSDSQTNILLTFDQFGVSNHINHKACHQVVTS 178
           +++ F++ DG +E W+ + ++  +ES +   S  N+LLTFD  GVSNH NH ACH  V  
Sbjct: 117 QLYQFDYPDGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVAR 176

Query: 179 YIQSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDH--LALFNPY 236
            I+   K + AL L+S+S NL  KY+GF W+L+ +  +      ++  L+   L   N +
Sbjct: 177 LIE---KGHKALYLNSHSRNLPLKYSGFIWELIRMLSD------SVMKLERTGLTFMNSF 227

Query: 237 SDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKL 275
             YI A+A M  AH+SQ+VWFRYGWW  SRFV+VNDL++
Sbjct: 228 PQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  203 bits (516), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/292 (42%), Positives = 173/292 (59%), Gaps = 26/292 (8%)

Query: 5   SKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDE 64
           SKL+FK+TKLT+IF  LYI  +PK++  N + L   +P+      N   L LV+AHPDDE
Sbjct: 19  SKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPT----HDNFGVLNLVIAHPDDE 74

Query: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKE---I 121
           +MFFSPT+LQL  H+    + N++  S+GDA+GLG LR+ EL  +I  L   RN     +
Sbjct: 75  IMFFSPTILQLIDHVQ---ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSL 131

Query: 122 FIFNHTDGMNEVWDN---KLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTS 178
            I ++TDG NEVW      L  + L S     Q +I+LTFD+ G+S H NH AC++ V S
Sbjct: 132 NILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVIS 191

Query: 179 YIQSHAKNNFALL-LDSYSS-NLLKKYTGFAWQLVFLAKN-YWIHGKT----LPNLDHLA 231
           Y+++   N+F  L L S S+  ++ KY+G   +L+ +  N      KT    LPN D +A
Sbjct: 192 YLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIA 251

Query: 232 ------LFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYT 277
                   + +  Y  ++A M  AHKSQMVWFRY WW FSR+V+VNDL   T
Sbjct: 252 TDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  201 bits (511), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 170/286 (59%), Gaps = 22/286 (7%)

Query: 7   LIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVM 66
            +FK  KL  + WC Y+  +  I+  N + +    P      S   S+ LV+AHPDDEVM
Sbjct: 6   FVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYF---SGSSSVNLVIAHPDDEVM 60

Query: 67  FFSPTLLQLDSHLPPNCKFNIISYSDG---DAEGLGSLRSNELAHSIDMLIPR-RNKEIF 122
           FFSPTL+QLD+ LP +   N+I +S G   D    G  R+ EL  S+ MLI   R   + 
Sbjct: 61  FFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVH 120

Query: 123 IFNHTDGMNEVWDNKLMLHQLESILSDS----QTNILLTFDQFGVSNHINHKACHQVVTS 178
             ++ DG +++WD   M+  L+++++ S    + ++L+TFD+ GVS+H NH ACH  V  
Sbjct: 121 QLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHR 180

Query: 179 YIQSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYW---IHGKTL--PNLD---HL 230
            I+       A  L+S+S+N++ KY+ FA ++V    NY    I G+T    N+D     
Sbjct: 181 LIEEEPLF-MAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEY 239

Query: 231 ALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLY 276
            LFN +S+YI AYATML AH+SQ+VWFRYGWWFFSR  Y N+LKL+
Sbjct: 240 VLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  196 bits (498), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 167/277 (60%), Gaps = 13/277 (4%)

Query: 5   SKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDE 64
           SKLIFK+TKL L+ W LY++ S +I+  N    +     +  + +   +L LV+AHPDDE
Sbjct: 9   SKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIFHEGT---TLNLVIAHPDDE 65

Query: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP-RRNKEIFI 123
           VMFF+PTLLQLD+ +P +   N+I +S+GDA+GLG  R +EL  SI  LI  +R   + +
Sbjct: 66  VMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTV 125

Query: 124 FNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSH 183
            +  DG +++WD    + Q+   L  +     LTFD  GVS H NH ACH  V +    +
Sbjct: 126 LHFQDGNDQIWD----IDQMTQYLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNL--KN 179

Query: 184 AKNNFALL-LDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKT--LPNLDHLALFNPYSDYI 240
             NN  +L LDS   +LL KYT F   LV L  N W   +     + D +  FN YS YI
Sbjct: 180 TNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYI 239

Query: 241 TAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYT 277
            AY+TML AHKSQ+VWFRYGWW FSRFV+ N LK+ T
Sbjct: 240 LAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  191 bits (484), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 177/311 (56%), Gaps = 47/311 (15%)

Query: 10  KITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDP-----SLTLVVAHPDDE 64
           +  KL LIFW +YI  S  I+L NDQ  N F    I+  SN       SL+L++AHPDDE
Sbjct: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKH-IQLMSNKQHVKINSLSLIIAHPDDE 67

Query: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSL----RSNELAHSIDMLIPR---- 116
           +MFFSPTLLQL+++L  +  FN++  S G  +  GS     R +EL  S+++L  R    
Sbjct: 68  IMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNN 126

Query: 117 ---RNKEIFIFNHTDGMNEVWDNKLMLHQLESIL--SDSQTNILLTFDQFGVSNHINHKA 171
              RN ++   ++TDGM E+W+  L++  L   L  +D+  N+LLTFD+ GVSNH NH A
Sbjct: 127 EHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLA 186

Query: 172 CHQVVTSYIQ-SHAKNNF-ALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTL----- 224
           C++ VT  ++ S+  +N   + L+S+S N   KY+ F  +L  + K  +    +L     
Sbjct: 187 CNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFC 246

Query: 225 -PNLDHL-------------------ALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFF 264
            PN D L                     FNP++ Y+ +Y+TML AH+SQMVWFRY WW F
Sbjct: 247 FPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIF 306

Query: 265 SRFVYVNDLKL 275
           SRF ++NDL +
Sbjct: 307 SRFAFINDLTI 317

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  188 bits (477), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/280 (36%), Positives = 163/280 (58%), Gaps = 39/280 (13%)

Query: 6   KLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDP-SLTLVVAHPDDE 64
           + +FK++    I W +YI+ S +I+ SN + L +        R + P S+ LV+AHPDDE
Sbjct: 5   RTVFKVSG---ILWLVYILGSVQIERSNRRALGSLF------RGSAPTSINLVIAHPDDE 55

Query: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIF 124
           VMFF+PTLLQ+D  LP + + N+IS +DG A+GLG LR+ EL   + +L+ +R   + + 
Sbjct: 56  VMFFAPTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRKASVEVL 115

Query: 125 NHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHA 184
           +  DGM+  WD +  +  L+  + D ++ + LTFD+ G+S H+NH +C++ V    + ++
Sbjct: 116 DFLDGMDVEWDLERAVKALQERILD-ESPLFLTFDENGISGHVNHISCYKAVQKVRKHYS 174

Query: 185 KNN-FALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDH-------LALFNPY 236
           K++ F L+   Y   L +KY+GF                 +P L H         L N +
Sbjct: 175 KSSCFKLVSKRY---LFEKYSGF-----------------IPALFHSFISSSPSTLINSF 214

Query: 237 SDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLY 276
             Y+ A ++M+ AH SQMVWFRYGWW FS +VY N+L+ +
Sbjct: 215 RQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  187 bits (475), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 151/274 (55%), Gaps = 18/274 (6%)

Query: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61
           + + +++ K+ K   +   LYI +S +I   N Q+     PS         S+ L+VAHP
Sbjct: 1   MRVVEVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPS-----RTPTSVNLIVAHP 55

Query: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEI 121
           DDE MFFSPTLLQL  + PP+    +I  ++GDA+GLG++R  EL  S+ +L+P RN  +
Sbjct: 56  DDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNTSV 115

Query: 122 FIFNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQ 181
            +    DGM   WD + ++  +   +SD+ + +LLTFD+ GVS H+NH +C+  V++ ++
Sbjct: 116 IVEGFEDGMGVEWDTRQVVATINRHVSDA-SPLLLTFDEHGVSGHVNHVSCNTAVSALVE 174

Query: 182 SHAKNN--FALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDY 239
              +    F  L  +       KY  FA  L  +     I G+  P        + +  Y
Sbjct: 175 QREQREQRFTALYLNSKRYFPPKYGSFAVDLARI-----ITGRQPP-----VFMSTFPQY 224

Query: 240 ITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDL 273
           + + A M  AH SQMVWFR+GWW  SRFV+VN+L
Sbjct: 225 LLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  184 bits (466), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 146/267 (54%), Gaps = 20/267 (7%)

Query: 11  ITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSP 70
           + KL  +   LY   S +I+ SN+Q   T    L     N  S+ LV+AHPDDEVMFF+P
Sbjct: 7   VCKLLAVLCILYFASSARIKASNEQAFTTLFSVL-----NPTSINLVIAHPDDEVMFFAP 61

Query: 71  TLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDGM 130
           TLLQLD +   +   ++ S +DG A+GLG LR  EL  S+ +L  RR  E+ + N  DGM
Sbjct: 62  TLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGM 121

Query: 131 NEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKN-NFA 189
              WD +     L   +   Q  + LTFD  GVS+HINH +C++ V +   +H ++ +F+
Sbjct: 122 KVEWDLQKTSEALRKQVVGDQP-LFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFS 180

Query: 190 LLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYATMLKA 249
           L   +   ++ +KYT F   L+            L         + +  Y+ A + M+ A
Sbjct: 181 L---TSKRSIFQKYTAFVPSLI----------TVLRGSRQAVFMSTFKQYLLALSVMMNA 227

Query: 250 HKSQMVWFRYGWWFFSRFVYVNDLKLY 276
           H SQMVWFRYGWWFFS +V+ N+++ +
Sbjct: 228 HTSQMVWFRYGWWFFSCYVFANEVREF 254

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 152/267 (56%), Gaps = 27/267 (10%)

Query: 9   FKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFF 68
           F + KL L+   +Y      ++  N ++    + S      N  S+TL++AHPDDEVMFF
Sbjct: 6   FAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGS----HGNYTSVTLIIAHPDDEVMFF 61

Query: 69  SPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTD 128
           +PTLLQLD+ +  +  F ++  +DGDA+GLG +R  EL  ++ +L+  R+ EI +    D
Sbjct: 62  APTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKD 121

Query: 129 GMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNF 188
           GM+E W  +++  +L  +++D +  ++LTFD+ GVS H NH AC         +HA    
Sbjct: 122 GMDEEWKMEVVREELAQVVTDRRP-LVLTFDERGVSGHRNHIAC---------AHAAAKL 171

Query: 189 A---LLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYAT 245
               L LDS   NL++KY+ F   L  L     + G  +P +      + +S Y+ +  T
Sbjct: 172 GHHTLHLDS-GHNLIRKYSFFFVDLFRL-----LFGYPMPTV----FLSTFSQYLHSLVT 221

Query: 246 MLKAHKSQMVWFRYGWWFFSRFVYVND 272
           ML AHKSQMVWFR+GWW  SR+VY N+
Sbjct: 222 MLVAHKSQMVWFRWGWWTASRYVYANE 248

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  177 bits (450), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 168/299 (56%), Gaps = 33/299 (11%)

Query: 7   LIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSND--PSLTLVVAHPDDE 64
           ++FK+ K   I   LYI L+P I+   D  L +F  ++  + S     S+ L++AHPDDE
Sbjct: 3   ILFKLFKCYCILSILYIWLTPHIE---DLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDE 59

Query: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDG---DAEGLGSLRSNELAHSIDMLIPRR---- 117
           VMFF+PTLLQLD  LP +  FN+I  S G   D   +G LRSNE+  S+ ML+  R    
Sbjct: 60  VMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGL 119

Query: 118 NKEIFI--FNHTDGMNEVWDNKLMLHQLESILS-----DSQTNILLTFDQFGVSNHINHK 170
           N+E+ +  F + DGM++ WD   ++  +++ +S     D   + LLTFD  GVS H NH 
Sbjct: 120 NREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHI 179

Query: 171 ACHQVVTSYIQ--SHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKN------YWIHGK 222
           AC+  + +  Q  S+  +   + L+SY SN++ KY+ F   +  L  N           K
Sbjct: 180 ACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELK 239

Query: 223 TLPNL------DHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKL 275
            +P L      D +   N +  YI A ++ML +H SQMVWFRYGWW FSRFV+VNDL +
Sbjct: 240 QVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHI 298

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  172 bits (437), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 144/264 (54%), Gaps = 21/264 (7%)

Query: 9   FKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFF 68
           F + KL L+   +Y     +++  N Q+       L+   S   SLTLV+AHPDDEVMFF
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFE----RLVGGDSQHTSLTLVIAHPDDEVMFF 61

Query: 69  SPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTD 128
           +PTLLQLD+ LP    F ++  +DG AEGLG LR  EL  ++ +L+   +  + + + TD
Sbjct: 62  APTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTD 121

Query: 129 GMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNF 188
           GM E WD   +  +L  +++D++  ++LTFD+ GVS H NH  C         + A+   
Sbjct: 122 GMKEDWDLAEVRTRLGELVTDAKP-LVLTFDERGVSGHRNHIGC-------ALAAARLGH 173

Query: 189 ALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYATMLK 248
             L      NLL+KY+ F   +  +     + G   P +      +  + Y+ A   M+ 
Sbjct: 174 KTLFLRSERNLLRKYSFFVLDVFRV-----VFGTPPPTV----FVSTLAQYLHALVAMVV 224

Query: 249 AHKSQMVWFRYGWWFFSRFVYVND 272
           AH+SQMVWFR+GWW  SR+VY N+
Sbjct: 225 AHRSQMVWFRWGWWMASRYVYANE 248

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  162 bits (410), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 141/260 (54%), Gaps = 17/260 (6%)

Query: 16  LIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSPTLLQL 75
           L+F  +Y  L+  I+  N    +  +   +  +    S+TLVVAHPDDEVMFFSPTL Q 
Sbjct: 15  LVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLT--SVTLVVAHPDDEVMFFSPTLTQF 72

Query: 76  DSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDGMNEVWD 135
           +  LP +   N++  + GDA+GLG +R  EL  S+ ++   R     + +  DGM+ VWD
Sbjct: 73  NELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWD 132

Query: 136 NKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNFALLLDSY 195
             L+  QL S + DS   ++LTFDQFGVS HINH +C ++V     SH      L L S 
Sbjct: 133 QVLLEKQLRSSIPDSNP-LVLTFDQFGVSGHINHISCGRLVEKLPYSH-----KLHLRS- 185

Query: 196 SSNLLKKYTGFAWQLVFLAKN--YWIHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQ 253
              +  KY+ F   +  L  +  Y  +GK  P        +    Y+ A + M  AH SQ
Sbjct: 186 DQPIYVKYSAFIAGIFQLGISTVYPDYGK--PR----CFISTLPQYLLAASAMSLAHTSQ 239

Query: 254 MVWFRYGWWFFSRFVYVNDL 273
           MVWFR GWW FSRF ++N+L
Sbjct: 240 MVWFRVGWWLFSRFCFINEL 259

>Skud_13.235 Chr13 complement(396755..398980) [2226 bp, 741 aa] {ON}
           YMR078C (REAL)
          Length = 741

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 35  QILNTFIPSLIKDRSN--DPSLTLVVAHPDDEVMFFSPTLLQLDSHLPPN 82
           Q+L +F  +LI++RS   D S  LV+  P DEV+   P  +    H  PN
Sbjct: 581 QLLKSFQLNLIQNRSEGFDGSSGLVIDPPIDEVVLLDPKHINEVQHKRPN 630

>NDAI0K02340 Chr11 (523158..524150) [993 bp, 330 aa] {ON} Anc_6.362
           YNR043W
          Length = 330

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 4/71 (5%)

Query: 124 FNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSH 183
           FN   G    WD+K   + L+  L + Q +IL  F +    +   HK   +V+ S + + 
Sbjct: 258 FNQVPG----WDSKYTSNDLQDFLKNFQESILPKFAEHNELDEEVHKGVSRVILSRVGAG 313

Query: 184 AKNNFALLLDS 194
            ++    L+DS
Sbjct: 314 PQSTDKCLIDS 324

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,564,764
Number of extensions: 1503174
Number of successful extensions: 5243
Number of sequences better than 10.0: 32
Number of HSP's gapped: 5343
Number of HSP's successfully gapped: 32
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)