Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039508.845ON1246124657260.0
TDEL0B005308.845ON1301122319500.0
SAKL0D01342g8.845ON1270100118600.0
KNAG0J002508.845ON1237103717600.0
Suva_13.4688.845ON141892417040.0
Smik_13.4938.845ON143396216770.0
ZYRO0G14278g8.845ON125079416560.0
YMR280C (CAT8)8.845ON143393116650.0
ABL121C8.845ON1285106516380.0
KLTH0C03762g8.845ON120677614820.0
NDAI0K003908.845ON149569814141e-171
Kwal_27.102328.845ON120978313831e-169
CAGL0M03025g8.845ON125470512551e-150
Ecym_46168.845ON157747710881e-125
Skud_13.4528.845ON14324217322e-78
KLLA0D01452g8.845ON14451453483e-32
NCAS0C003908.845ON1164552785e-24
Kpol_1016.201.277ON1086502222e-17
Kwal_26.7397singletonOFF201561982e-16
ZYRO0G15136g1.277ON1027762123e-16
TPHA0I028201.277ON1044542105e-16
KLLA0F14322g1.277ON717522086e-16
KAFR0A014801.277ON725552087e-16
AFR096W1.277ON852522088e-16
SAKL0D05654g1.277ON919522089e-16
KLTH0D03564g1.277ON862562071e-15
Ecym_63401.277ON952562052e-15
NDAI0G055301.277ON1186652017e-15
TDEL0D014501.277ON945522007e-15
Smik_10.1531.277ON829502008e-15
YJL089W (SIP4)1.277ON829501981e-14
Skud_10.1251.277ON833501962e-14
Suva_6.1611.277ON832621953e-14
KNAG0B018401.277ON1072531927e-14
CAGL0L03377g1.277ON1209501873e-13
TBLA0D054201.277ON757501783e-12
NCAS0A094101.277ON932811703e-11
TBLA0E019007.56ON8403221443e-08
TPHA0F013802.231ON8901731434e-08
TPHA0N004407.56ON7572911416e-08
KAFR0F014901.128ON6582321363e-07
SAKL0E08998g2.231ON823421292e-06
CAGL0E05434g7.56ON8162211282e-06
SAKL0D14520g7.17ON983501274e-06
KNAG0E004507.56ON7102201264e-06
KLTH0G09108g2.231ON7821761264e-06
TBLA0G026102.231ON1000421265e-06
NCAS0B065502.231ON906581265e-06
Skud_10.101.128ON8331931256e-06
KLLA0C18953gna 1ON7032051247e-06
KNAG0D006906.279ON875661248e-06
Kpol_1039.112.231ON9921771231e-05
YJL206C1.128ON7581931221e-05
NCAS0D025405.235ON890571221e-05
KLLA0E13993gsingletonON678481221e-05
KAFR0J017102.231ON848331221e-05
Smik_10.251.128ON7721931221e-05
Smik_9.392.231ON1012331221e-05
YIL130W (ASG1)2.231ON964331212e-05
Skud_9.372.231ON954331212e-05
KAFR0E024107.56ON6913061212e-05
NDAI0B038502.231ON930331212e-05
NDAI0F012206.279ON960451212e-05
Suva_9.592.231ON926331212e-05
KLLA0F04609g2.231ON916331212e-05
Suva_8.3877.56ON7593181202e-05
TDEL0C044802.231ON852331202e-05
KLLA0C10923g5.235ON775591202e-05
Kwal_23.47542.231ON812331202e-05
KLTH0E03256gsingletonON6741301192e-05
NDAI0A087907.17ON1059341193e-05
KNAG0E017602.231ON902331193e-05
Suva_6.2851.128ON7861931184e-05
Kpol_1018.306.279ON881511184e-05
YPL248C (GAL4)6.279ON881471184e-05
Smik_6.4526.279ON878471174e-05
KLTH0E00440gsingletonON6882431174e-05
KLTH0B10076gsingletonON6882431174e-05
SAKL0A02860g6.279ON745451175e-05
CAGL0G08844g2.231ON847411175e-05
SAKL0C02024gsingletonON898491166e-05
Suva_10.945.235ON906641166e-05
ZYRO0E06270g2.565ON912461167e-05
KNAG0E002107.17ON948411167e-05
Smik_11.2402.654ON9762251167e-05
KLTH0D07260g2.547ON979511158e-05
NDAI0I023505.235ON889621158e-05
NCAS0G011006.279ON935451159e-05
SAKL0A09856g2.547ON1020521141e-04
TBLA0A058501.128ON6571821141e-04
SAKL0G11902g5.235ON906481141e-04
CAGL0A00451g4.113ON1107611141e-04
YOR337W (TEA1)7.56ON7593211141e-04
AER370W2.231ON801331141e-04
ZYRO0E08272g6.279ON794511141e-04
ZYRO0C18150g1.128ON5711371131e-04
SAKL0C03938g1.128ON780451141e-04
Smik_1.137.17ON1046581141e-04
NCAS0I002707.17ON944531141e-04
Kpol_1071.107.56ON6983181131e-04
KNAG0B051205.235ON888441131e-04
NCAS0D041906.279ON890451131e-04
Smik_15.5157.56ON7593191122e-04
ADR403C7.17ON970591122e-04
Ecym_53972.231ON826331122e-04
TDEL0E039105.235ON862771122e-04
KAFR0J006905.235ON864451112e-04
SAKL0D00264g8.879ON848581112e-04
KNAG0C059804.113ON968721112e-04
KLTH0H16170gna 2ON619331113e-04
Smik_12.775.235ON903641113e-04
Kwal_23.4016singletonON6281061103e-04
Ecym_7440na 3ON898421103e-04
TPHA0H019806.279ON993511103e-04
TBLA0G018006.279ON1154451103e-04
SAKL0H24860gna 4ON9711281103e-04
TPHA0N002307.17ON1232521104e-04
Skud_1.107.17ON1040581104e-04
CAGL0M12298g7.17ON994461104e-04
Suva_16.596.279ON895431094e-04
Skud_15.5027.56ON7593191094e-04
KLTH0D02222gna 5ON847361094e-04
Suva_1.147.17ON1045581094e-04
YAL051W (OAF1)7.17ON1047581095e-04
YKL015W (PUT3)2.654ON9791291095e-04
Suva_15.773.109ON1029471086e-04
TBLA0G00490singletonON918541086e-04
ZYRO0C00726g7.17ON1035701086e-04
AGR280C6.75ON11061821086e-04
KLLA0A02585gna 6ON370511066e-04
KLLA0C03201g1.128ON6501821076e-04
NDAI0I007406.279ON1033501087e-04
KLLA0A06039g1.199ON657431077e-04
YLR014C (PPR1)5.235ON904451077e-04
Smik_15.561na 7ON546461077e-04
KAFR0F010406.279ON834511077e-04
KLTH0E14454gna 3ON902451077e-04
KLTH0H02684g6.279ON749451078e-04
Ecym_50177.17ON978591078e-04
TDEL0C056801.128ON6911351068e-04
TBLA0C040504.113ON1207561078e-04
ZYRO0A10956g5.235ON855591069e-04
YOR380W (RDR1)na 7ON546461069e-04
CAGL0L09691g2.654ON8242271069e-04
KAFR0F034104.113ON995511069e-04
KAFR0C049807.17ON951411060.001
Smik_2.438na 8ON469451050.001
Skud_12.825.235ON899451060.001
Suva_11.1872.547ON1171741060.001
KLLA0D12672g6.279ON865451050.001
Kwal_23.29055.235ON881491050.001
KAFR0I002307.17ON1045331050.001
Kwal_26.81092.547ON970531050.001
YKL038W (RGT1)2.547ON1170741050.001
NDAI0B025208.283ON7102831050.001
KAFR0A031807.512ON846511040.001
KLTH0G07898g5.235ON866491040.002
Kpol_495.213.109ON1085481040.002
TBLA0D006307.389ON1077441040.002
TDEL0E00160singletonON631471040.002
NDAI0F00110singletonON508451030.002
KLLA0A09119g4.113ON1082491040.002
NCAS0D04860singletonON701411030.002
ZYRO0A00440g8.879ON850581030.002
TDEL0H043407.17ON989331030.002
SAKL0B01870gsingletonON1009431030.002
CAGL0L04400g6.60ON987541030.002
Skud_11.1902.547ON1171741030.002
Kwal_34.15751na 2ON628391030.002
KLLA0D10197g8.879ON856511030.002
SAKL0A00704gna 9ON718521030.002
KLLA0A03443g7.17ON975551030.002
SAKL0B04620gna 6ON362501010.002
SAKL0F16522gsingletonON7081731020.002
TBLA0E007007.17ON1274401030.002
TBLA0A007302.654ON10371681030.003
CAGL0J07150g7.17ON1022451030.003
TPHA0A045403.109ON1178451030.003
KAFR0B014502.547ON1088611020.003
ADR404Cna 10ON875391020.003
KNAG0E041507.17ON1136461020.003
Kwal_27.96888.879ON841571020.003
YBR297W (MAL33)na 8ON468421010.003
SAKL0D14542gna 10ON946331020.003
Skud_15.546na 7ON542371010.003
KLLA0A10329gna 11ON639451020.003
NCAS0A047502.547ON1141511020.003
NDAI0G041403.109ON1001551020.003
TBLA0G011308.879ON1132341020.003
SAKL0B06732gna 3ON878451010.003
Smik_18.8singletonON775381010.003
NCAS0C002208.879ON839371010.004
TPHA0A06090singletonON847331010.004
TBLA0C062306.60ON795331010.004
NCAS0A03070singletonON656331000.004
YDR213W (UPC2)8.423ON913451010.004
CAGL0F07909g3.109ON1049361010.004
NDAI0D03540na 12ON1107551010.004
SAKL0D01100g4.113ON940411000.005
KLLA0F25630g2.547ON1007581000.005
KLTH0E16500g8.879ON833411000.005
Ecym_27321.380ON1198511000.005
NDAI0D00900singletonON865331000.005
Smik_11.2102.547ON1169601000.005
KLTH0B00352gsingletonON934331000.005
Suva_8.436na 7ON54538990.005
Skud_15.643.109ON1032501000.006
Suva_11.2132.654ON9852251000.006
KLLA0C14212gna 13ON1040361000.006
TBLA0A012101.380ON1422361000.006
KLLA0D10153gsingletonON65539990.006
NCAS0C027308.423ON77548990.006
TDEL0D00260singletonON647190990.006
KLLA0A03421gna 10ON88043990.006
NDAI0D035504.113ON111855990.006
CAGL0I07755g3.109ON105336990.006
KNAG0A02300singletonON72956990.007
NDAI0H019907.17ON116133990.007
SAKL0C09944g3.109ON106136990.007
NCAS0A035804.113ON111337990.008
Skud_15.5327.17ON100046980.008
Kpol_538.427.17ON108842980.008
NDAI0B016802.547ON92458980.008
YOR363C (PIP2)7.17ON99646980.008
ZYRO0D04422g7.56ON764287980.008
KAFR0L021308.879ON88246980.008
Skud_11.2142.654ON981225980.009
TBLA0A058601.128aON81067980.009
TBLA0G005106.60ON93553980.009
KLLA0F02750g3.109ON114847980.009
Smik_4.4608.423ON91845980.010
NCAS0A076107.17ON102233980.010
AER183Cna 3ON87942970.010
SAKL0H00682gna 13ON92246970.010
NDAI0K018002.547ON121053980.010
YGL013C (PDR1)4.113ON106838970.011
Suva_13.1862.565ON89447970.011
KAFR0D020905.676ON13481900.011
KAFR0C03730singletonON79136970.011
KLLA0D05038gna 14ON67350970.011
ZYRO0G19338gna 14ON65329960.012
Skud_9.220singletonON79335970.012
CAGL0F09229gna 15ON83533970.012
Suva_2.3818.423ON91845970.012
ZYRO0G22550gsingletonON72437960.012
TDEL0B004808.879ON83541960.013
Suva_4.4996.154ON45046960.013
Kwal_26.68057.17ON94433960.013
Ecym_42868.283ON62753960.014
Skud_4.4758.423ON91345960.014
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03950
         (1246 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...  2210   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   755   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...   721   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   682   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   660   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   650   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   642   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   645   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   635   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   575   0.0  
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    549   e-171
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   537   e-169
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   488   e-150
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   423   e-125
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   286   2e-78
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   138   3e-32
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     111   5e-24
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    90   2e-17
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    81   2e-16
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    86   3e-16
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    86   5e-16
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    85   6e-16
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    85   7e-16
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    85   8e-16
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    85   9e-16
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    84   1e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    84   2e-15
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            82   7e-15
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    82   7e-15
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    82   8e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    81   1e-14
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    80   2e-14
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    80   3e-14
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    79   7e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    77   3e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    73   3e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    70   3e-11
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    60   3e-08
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    60   4e-08
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    59   6e-08
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    57   3e-07
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    54   2e-06
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    54   2e-06
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    54   4e-06
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    53   4e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    53   4e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   5e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    53   5e-06
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    53   6e-06
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    52   7e-06
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    52   8e-06
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    52   1e-05
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    52   1e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    52   1e-05
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    52   1e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    52   1e-05
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    52   1e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    52   1e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    51   2e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    51   2e-05
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    51   2e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    51   2e-05
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    51   2e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    51   2e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    51   2e-05
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    51   2e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    51   2e-05
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    51   2e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    51   2e-05
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    50   2e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    50   3e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    50   3e-05
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    50   4e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    50   4e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    50   4e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    50   4e-05
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    50   4e-05
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    50   4e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    50   5e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    50   5e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    49   6e-05
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    49   6e-05
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    49   7e-05
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    49   7e-05
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    49   7e-05
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    49   8e-05
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     49   8e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    49   9e-05
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    49   1e-04
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    49   1e-04
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    49   1e-04
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    49   1e-04
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    49   1e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    49   1e-04
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    49   1e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    48   1e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    49   1e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    49   1e-04
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    49   1e-04
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    48   1e-04
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               48   1e-04
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     48   1e-04
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    48   2e-04
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    48   2e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    48   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    48   2e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    47   2e-04
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    47   2e-04
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    47   2e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    47   3e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    47   3e-04
Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W...    47   3e-04
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    47   3e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    47   3e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    47   3e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    47   3e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   4e-04
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    47   4e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    47   4e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    47   4e-04
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    47   4e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    47   4e-04
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    47   4e-04
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    47   5e-04
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    47   5e-04
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    46   6e-04
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                46   6e-04
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    46   6e-04
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    46   6e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    45   6e-04
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    46   6e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    46   7e-04
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    46   7e-04
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    46   7e-04
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    46   7e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    46   7e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    46   7e-04
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    46   8e-04
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    46   8e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    45   8e-04
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    46   8e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    45   9e-04
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    45   9e-04
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    45   9e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    45   9e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    45   0.001
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    45   0.001
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   0.001
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    45   0.001
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    45   0.001
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    45   0.001
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.001
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    45   0.001
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    45   0.001
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    45   0.001
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    45   0.001
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    45   0.002
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    45   0.002
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    45   0.002
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 45   0.002
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.002
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    45   0.002
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               44   0.002
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    44   0.002
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    44   0.002
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    44   0.002
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    44   0.002
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    44   0.002
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    44   0.002
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    44   0.002
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    44   0.002
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    44   0.002
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.002
SAKL0F16522g Chr6 (1361716..1363842) [2127 bp, 708 aa] {ON} some...    44   0.002
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    44   0.002
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    44   0.003
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    44   0.003
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    44   0.003
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    44   0.003
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    44   0.003
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    44   0.003
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    44   0.003
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    44   0.003
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    44   0.003
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    44   0.003
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    44   0.003
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    44   0.003
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    44   0.003
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.003
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    44   0.003
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    44   0.003
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       44   0.004
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    44   0.004
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.004
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               43   0.004
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    44   0.004
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    44   0.004
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    44   0.004
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    43   0.005
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    43   0.005
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    43   0.005
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    43   0.005
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               43   0.005
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    43   0.005
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    43   0.005
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    43   0.005
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    43   0.006
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    43   0.006
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    43   0.006
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    43   0.006
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    43   0.006
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     43   0.006
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       43   0.006
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    43   0.006
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    43   0.006
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    43   0.006
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    43   0.007
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.007
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    43   0.007
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    43   0.008
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    42   0.008
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    42   0.008
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     42   0.008
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    42   0.008
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    42   0.008
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    42   0.008
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    42   0.009
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.009
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    42   0.009
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    42   0.009
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.010
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    42   0.010
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    42   0.010
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    42   0.010
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    42   0.010
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    42   0.011
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    42   0.011
KAFR0D02090 Chr4 complement(421242..421646) [405 bp, 134 aa] {ON...    39   0.011
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               42   0.011
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    42   0.011
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    42   0.012
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    42   0.012
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.012
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.012
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.012
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.013
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    42   0.013
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    42   0.013
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    42   0.014
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    42   0.014
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      42   0.014
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    41   0.014
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    42   0.014
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    42   0.015
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    42   0.015
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    42   0.016
NCAS0D01290 Chr4 complement(233978..236194) [2217 bp, 738 aa] {O...    41   0.017
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    41   0.017
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    41   0.018
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    41   0.018
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    41   0.018
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    41   0.018
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    41   0.019
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    41   0.019
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    41   0.020
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    41   0.021
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    41   0.021
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    41   0.021
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    41   0.023
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    41   0.023
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    40   0.024
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    41   0.025
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    40   0.026
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    41   0.026
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    41   0.026
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    41   0.026
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    41   0.027
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    41   0.028
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    39   0.028
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    40   0.029
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    40   0.029
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    41   0.029
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    40   0.030
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    41   0.030
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    40   0.030
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     40   0.030
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    40   0.031
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    40   0.033
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    40   0.033
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    40   0.034
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    40   0.034
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    40   0.034
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    40   0.035
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    40   0.035
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    40   0.035
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    40   0.036
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    40   0.036
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    40   0.036
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    40   0.038
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    40   0.038
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    40   0.038
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    40   0.039
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    40   0.039
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    40   0.039
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    40   0.039
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    40   0.039
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    40   0.039
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    40   0.040
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    40   0.041
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    40   0.041
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    40   0.041
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    40   0.042
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               40   0.042
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    40   0.042
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    40   0.043
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    40   0.043
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    40   0.043
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    40   0.045
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    40   0.046
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    40   0.046
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    40   0.047
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    40   0.049
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              40   0.049
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    40   0.051
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    40   0.051
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    40   0.052
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    40   0.053
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    40   0.055
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 40   0.056
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    40   0.057
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    39   0.057
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    40   0.057
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    40   0.057
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    40   0.058
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    40   0.059
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.060
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    40   0.060
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    40   0.060
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    39   0.061
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             39   0.063
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    40   0.063
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    39   0.063
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    39   0.064
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.065
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    40   0.066
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               39   0.066
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    40   0.066
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    40   0.067
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    39   0.067
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    39   0.068
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.069
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    39   0.069
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    39   0.070
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.071
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.071
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    39   0.072
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    39   0.072
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      39   0.074
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    39   0.074
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      39   0.075
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    39   0.075
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.075
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    39   0.076
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    39   0.076
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    39   0.076
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    39   0.077
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    39   0.078
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    39   0.078
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    39   0.079
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    39   0.079
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    39   0.080
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    39   0.080
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    39   0.081
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    39   0.082
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    39   0.083
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    39   0.083
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    39   0.084
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    39   0.084
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    39   0.085
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    39   0.085
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    39   0.087
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    38   0.087
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    39   0.088
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.089
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.093
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    39   0.093
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    39   0.093
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    39   0.094
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    39   0.094
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    39   0.095
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    39   0.095
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.095
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    39   0.096
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.097
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    39   0.097
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    39   0.10 
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    39   0.10 
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    39   0.10 
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    39   0.10 
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    39   0.10 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    39   0.11 
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    39   0.11 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    39   0.11 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    39   0.11 
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    39   0.11 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    39   0.11 
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    39   0.11 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    39   0.12 
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    39   0.12 
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    39   0.12 
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    38   0.12 
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.12 
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    39   0.12 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.12 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    39   0.12 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    39   0.13 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    39   0.13 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    38   0.13 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    39   0.13 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.13 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    39   0.13 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    39   0.13 
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    39   0.13 
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    39   0.13 
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    38   0.14 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.14 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    39   0.14 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    39   0.14 
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    39   0.14 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    38   0.14 
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    39   0.15 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      38   0.15 
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    38   0.15 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    38   0.15 
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    38   0.15 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    39   0.15 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    38   0.16 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    38   0.16 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    38   0.16 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    38   0.16 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    38   0.16 
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    38   0.16 
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    38   0.16 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    38   0.16 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    38   0.16 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    38   0.17 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.17 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.17 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    38   0.17 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    38   0.17 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    38   0.17 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     38   0.17 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    38   0.17 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     38   0.18 
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    38   0.18 
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    38   0.18 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    38   0.18 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    38   0.18 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    38   0.18 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    38   0.19 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    38   0.19 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    38   0.19 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.20 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    38   0.20 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    38   0.20 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    38   0.20 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    38   0.21 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    38   0.21 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    38   0.21 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    37   0.23 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    38   0.23 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    38   0.23 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    38   0.23 
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    38   0.24 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    38   0.25 
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    37   0.25 
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    37   0.25 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    38   0.25 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.25 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    37   0.25 
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    38   0.26 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    37   0.26 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    37   0.26 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    37   0.26 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    37   0.26 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    37   0.27 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    37   0.27 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    37   0.27 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    37   0.27 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    37   0.27 
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             37   0.28 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.28 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    37   0.28 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    37   0.30 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    37   0.30 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    37   0.30 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    37   0.31 
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                37   0.31 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.31 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    37   0.31 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               37   0.31 
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    37   0.31 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    37   0.32 
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    37   0.32 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    37   0.32 
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    37   0.33 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.33 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    37   0.34 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.34 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    37   0.34 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.34 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    37   0.35 
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    37   0.36 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    37   0.36 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.38 
Kwal_14.2027 s14 complement(578143..579582) [1440 bp, 479 aa] {O...    37   0.38 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    37   0.39 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    37   0.39 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.39 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    37   0.39 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.40 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    37   0.40 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    37   0.41 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    37   0.42 
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    37   0.43 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    37   0.43 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    37   0.43 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    37   0.43 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    37   0.43 
NDAI0H03240 Chr8 complement(775826..777718) [1893 bp, 630 aa] {O...    37   0.45 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    37   0.45 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    37   0.45 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.46 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    37   0.47 
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    37   0.47 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.48 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    37   0.48 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    37   0.48 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    37   0.49 
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    37   0.49 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    37   0.49 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    37   0.49 
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    37   0.50 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      34   0.51 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     37   0.52 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    37   0.52 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    37   0.53 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    37   0.53 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    37   0.54 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    36   0.55 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    37   0.55 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    37   0.56 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    36   0.57 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    37   0.57 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    36   0.60 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    36   0.62 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    36   0.62 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               36   0.63 
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    34   0.63 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    36   0.64 
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    36   0.64 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    36   0.65 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    36   0.66 
KLTH0F00990g Chr6 (77084..79441) [2358 bp, 785 aa] {ON} similar ...    36   0.67 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    36   0.67 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    36   0.71 
YDR520C Chr4 complement(1481085..1483403) [2319 bp, 772 aa] {ON}...    36   0.71 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    36   0.73 
TBLA0E05030 Chr5 complement(1294821..1297529) [2709 bp, 902 aa] ...    36   0.74 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    36   0.75 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    36   0.76 
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    36   0.76 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    36   0.77 
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    36   0.77 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    36   0.77 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    36   0.78 
Ecym_5662 Chr5 complement(1338979..1341174) [2196 bp, 731 aa] {O...    36   0.78 
TPHA0D01900 Chr4 complement(395128..397812) [2685 bp, 894 aa] {O...    36   0.79 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.79 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    36   0.79 
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...    36   0.81 
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...    36   0.81 
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    36   0.81 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    36   0.82 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   0.85 
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    36   0.86 
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    36   0.87 
Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {...    36   0.88 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    36   0.89 
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    36   0.89 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    36   0.90 
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    36   0.92 
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    36   0.92 
NCAS0A00300 Chr1 (43991..46324) [2334 bp, 777 aa] {ON} Anc_1.26 ...    36   0.94 
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    36   0.94 
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    36   0.97 
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    35   0.97 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    36   0.97 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    35   1.1  
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    35   1.1  
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    35   1.1  
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    35   1.1  
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    35   1.1  
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       35   1.1  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    35   1.1  
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    35   1.1  
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    35   1.1  
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   35   1.1  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    35   1.1  
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    35   1.2  
Smik_2.290 Chr2 complement(527416..530511) [3096 bp, 1031 aa] {O...    35   1.2  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    35   1.2  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    35   1.2  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   1.2  
KAFR0G01220 Chr7 (276857..279406) [2550 bp, 849 aa] {ON} Anc_1.2...    35   1.2  
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    35   1.2  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   1.3  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    35   1.3  
TBLA0D04050 Chr4 (1007986..1009809) [1824 bp, 607 aa] {ON} Anc_8...    35   1.3  
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    35   1.3  
CAGL0H01683g Chr8 (162753..164852) [2100 bp, 699 aa] {ON} simila...    35   1.4  
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    35   1.4  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    35   1.4  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    35   1.4  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    35   1.5  
TBLA0A10770 Chr1 complement(2681017..2683137) [2121 bp, 706 aa] ...    35   1.5  
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    35   1.5  
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    35   1.6  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    35   1.7  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    35   1.7  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    35   1.7  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             35   1.7  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   1.8  
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    35   1.8  
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    35   1.8  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    35   1.8  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    35   1.9  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    35   1.9  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    35   1.9  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    35   1.9  
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    35   1.9  
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    35   2.0  
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    35   2.0  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    35   2.1  
TBLA0J00620 Chr10 complement(140248..142545) [2298 bp, 765 aa] {...    35   2.1  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    34   2.1  
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    34   2.2  
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    34   2.2  
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    34   2.3  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    34   2.3  
ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON} N...    34   2.4  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    34   2.4  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    34   2.4  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 34   2.4  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    34   2.4  
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    34   2.5  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    34   2.5  
CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa...    34   2.5  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    34   2.5  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    34   2.7  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    34   2.9  
Suva_2.718 Chr2 complement(1260979..1262673) [1695 bp, 564 aa] {...    34   2.9  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    34   3.0  
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    34   3.1  
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    34   3.1  
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    34   3.2  
KLTH0E00352g Chr5 (33232..34779) [1548 bp, 515 aa] {ON} similar ...    34   3.2  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    34   3.3  
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    34   3.3  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    34   3.3  
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    34   3.4  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    33   3.5  
KLLA0C01023g Chr3 (76863..78773) [1911 bp, 636 aa] {ON} similar ...    33   3.7  
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    33   3.8  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   3.9  
KLTH0D03718g Chr4 complement(362790..364790) [2001 bp, 666 aa] {...    33   4.1  
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    33   4.3  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    33   4.4  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    33   4.5  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    33   4.5  
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    33   4.5  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    33   4.5  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    33   4.6  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   4.9  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   5.0  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    33   5.0  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    33   5.0  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    33   5.0  
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    33   5.0  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    33   5.1  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    33   5.2  
KNAG0D02330 Chr4 complement(407687..408490) [804 bp, 267 aa] {ON...    33   5.5  
SAKL0H00616g Chr8 (73754..75934) [2181 bp, 726 aa] {ON} some sim...    33   6.2  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    33   6.5  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     33   6.9  
KLTH0F08074g Chr6 (701778..703685) [1908 bp, 635 aa] {ON} some s...    33   7.0  
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    33   7.0  
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 32   7.2  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   7.3  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    32   8.6  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    32   8.6  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    32   8.7  
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     32   8.8  
ZYRO0C18414g Chr3 (1442217..1444001) [1785 bp, 594 aa] {ON} cons...    32   8.8  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   8.9  

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score = 2210 bits (5726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1111/1246 (89%), Positives = 1111/1246 (89%)

Query: 1    MVKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
            MVKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK
Sbjct: 1    MVKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60

Query: 61   VSDKLIRKAYPRGYTESIXXXXXXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTD 120
            VSDKLIRKAYPRGYTESI                 CDLKEQQISLVAKYSSNKSNILPTD
Sbjct: 61   VSDKLIRKAYPRGYTESIEERVRELEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTD 120

Query: 121  RCIIELNSDSDCTNNIKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGN 180
            RCIIELNSDSDCTNNIKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGN
Sbjct: 121  RCIIELNSDSDCTNNIKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGN 180

Query: 181  KMXXXXXXXXXXXXXXXXXXXXKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXX 240
            KM                    KLNSNGTIRSPESNTTVSPLESHTKNLKSNIR      
Sbjct: 181  KMFQQNQSNVSTSSSSSPFFANKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRNNNTTT 240

Query: 241  XXHVCDGICCTDKLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAIL 300
              HVCDGICCTDKLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAIL
Sbjct: 241  TTHVCDGICCTDKLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAIL 300

Query: 301  VSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQ 360
            VSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTV               DFLMDNSQ
Sbjct: 301  VSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQ 360

Query: 361  NSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSNLIPV 420
            NSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSNLIPV
Sbjct: 361  NSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSNLIPV 420

Query: 421  LXXXXXXXXXXXXKIQCQSFIQGNQSNNLRDYKFFGCFLMVMCQMGLLIKLKEHKSNNSL 480
            L            KIQCQSFIQGNQSNNLRDYKFFGCFLMVMCQMGLLIKLKEHKSNNSL
Sbjct: 421  LNEEEFFNRYNNFKIQCQSFIQGNQSNNLRDYKFFGCFLMVMCQMGLLIKLKEHKSNNSL 480

Query: 481  FKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMA 540
            FKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMA
Sbjct: 481  FKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMA 540

Query: 541  HQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECA 600
            HQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECA
Sbjct: 541  HQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECA 600

Query: 601  LPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALI 660
            LPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALI
Sbjct: 601  LPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALI 660

Query: 661  HENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTK 720
            HENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTK
Sbjct: 661  HENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTK 720

Query: 721  VDLEDKVTETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFT 780
            VDLEDKVTETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFT
Sbjct: 721  VDLEDKVTETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFT 780

Query: 781  LISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQ 840
            LISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHS            Q
Sbjct: 781  LISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQ 840

Query: 841  NSNTKPEKIEXXXXXXXXXXXXXMGKPLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELEN 900
            NSNTKPEKIE             MGKPLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELEN
Sbjct: 841  NSNTKPEKIEKLLQKKLNYYNKLMGKPLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELEN 900

Query: 901  DINSLHPILIDNEGVTPSDAAPLIXXXXXXXXXXXXXXXXEFAEALQVDPILNSDYYQFS 960
            DINSLHPILIDNEGVTPSDAAPLI                EFAEALQVDPILNSDYYQFS
Sbjct: 901  DINSLHPILIDNEGVTPSDAAPLINKTNSNTNNPVVTTQNEFAEALQVDPILNSDYYQFS 960

Query: 961  NLDLATLFNSDKLNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTASNSTLNMEQLLRNQ 1020
            NLDLATLFNSDKLNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTASNSTLNMEQLLRNQ
Sbjct: 961  NLDLATLFNSDKLNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTASNSTLNMEQLLRNQ 1020

Query: 1021 GKFNISPNIFSPNFQSKENLLGXXXXXXXXXXXXXXXXXXXXXXTTMMMLLNNEIPFSSI 1080
            GKFNISPNIFSPNFQSKENLLG                      TTMMMLLNNEIPFSSI
Sbjct: 1021 GKFNISPNIFSPNFQSKENLLGNSKVNNNLLYSNLKNNSNNQSLTTMMMLLNNEIPFSSI 1080

Query: 1081 NSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTENYLSDFSYIIDGSLGL 1140
            NSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTENYLSDFSYIIDGSLGL
Sbjct: 1081 NSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTENYLSDFSYIIDGSLGL 1140

Query: 1141 APLLANPFKPTGENNLVNVSSIETTGQCINPKVLSSQSSDANKDDTDLNLENGAVQRRPR 1200
            APLLANPFKPTGENNLVNVSSIETTGQCINPKVLSSQSSDANKDDTDLNLENGAVQRRPR
Sbjct: 1141 APLLANPFKPTGENNLVNVSSIETTGQCINPKVLSSQSSDANKDDTDLNLENGAVQRRPR 1200

Query: 1201 RYNGNFGLGGTGMNSNFSVSDLLRPDDQKKREKETLNDLFNWQNSD 1246
            RYNGNFGLGGTGMNSNFSVSDLLRPDDQKKREKETLNDLFNWQNSD
Sbjct: 1201 RYNGNFGLGGTGMNSNFSVSDLLRPDDQKKREKETLNDLFNWQNSD 1246

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1223 (39%), Positives = 661/1223 (54%), Gaps = 227/1223 (18%)

Query: 16   SDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
            + VN  ++SN RV QACDRCRSKKTRCDG++PQCSQCAAVGFEC++SDKL R+A+PRGYT
Sbjct: 86   TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYT 145

Query: 76   ESIXXXXXXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNN 135
            E++                 CD+KEQQI LV+ + +NK  I   D  +++          
Sbjct: 146  ETLEERVRELEAENRRLVALCDIKEQQIHLVSHFPTNKKKIGGNDEQMLQ---------- 195

Query: 136  IKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQT---QKKAELNNGNKMXXXXXXXXXX 192
               EL         T  N+  L IS TNL+LLN+    ++ A ++NG+            
Sbjct: 196  ---EL---------TGANNGRLRISSTNLFLLNKARDGKQPATISNGD------------ 231

Query: 193  XXXXXXXXXXKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXXHVCDGICCTD 252
                                   +    P   HT                H CD + C +
Sbjct: 232  -----------------------DHMTKPDHEHTGK--------------HRCDELDCNN 254

Query: 253  KLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEI 312
            KLH +PV+TN NDPT+ISFEQ+EAPGL A KAL S+  +E++TQLA LV+LSVPRSTEEI
Sbjct: 255  KLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEI 314

Query: 313  LFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNSL--------- 363
            LFIPQLLA+I Q+HGFTSKQCLY+V                 L+ + +N+L         
Sbjct: 315  LFIPQLLARIIQIHGFTSKQCLYSVS----------------LLASLKNNLPGPQLVKWD 358

Query: 364  ---LLKNTNIWQINDLNVFFTDLLKFNI----SNDSKTSTLLSFDDIDDLTNLYFNHWSN 416
                LK TN+W++++L+ FF + LKFNI     +D   S  LS  +ID+L NL+F+ W+ 
Sbjct: 359  ELDYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAV 418

Query: 417  LIPVLXXXXXXXXXXXXK----IQCQSFIQG----NQSNNLRDYKFFGCFLMVMCQMGLL 468
             IP+L            K     Q   F +G     + N +  YK F C L  +CQMGLL
Sbjct: 419  HIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLL 478

Query: 469  IKLKEHK---SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGN 525
             K+K  K   +++   K+ +YYH+   ++  NP +   TTS++S+Q L+LLLFY +N GN
Sbjct: 479  TKVKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFVNTGN 538

Query: 526  IEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQ 585
            +  IYELRG ++SMA QLRLHRCPSAVL GSGSTM K EQ +RR+LFW IYYLDVFS+LQ
Sbjct: 539  VSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598

Query: 586  LGVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSI 644
            LGVPRL+KD+EIECALPV +N     ++ G  I+LEG VSQ SL + RFAKVLGNI+D++
Sbjct: 599  LGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTV 658

Query: 645  FKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINL--------NDLDTENS 696
            FKR M+ S+S+++ALIHENALDNWR  LP +  F+++VNGTIN+        N+   EN 
Sbjct: 659  FKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENV 718

Query: 697  DTIFLIVFYFLAKCMIHLPVCSTK-----------VDLEDKVTETGNDVIYNDRFSTSYV 745
            + + L+V YFLAKCMIHLPV +T+           +  E++V +   +  +  R S+SYV
Sbjct: 719  EQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYV 778

Query: 746  SLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLL 805
             LQQ+TNTMLN L  ++  YLP+PFNV+RT  RF L+SA+GSL+YIKGG+LF+DNK LLL
Sbjct: 779  LLQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLL 838

Query: 806  DCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEKIEXXXXXXXXXXXXXMG 865
            D V+ IE +RKL++PG+ISWH             Q  NTK EK++             MG
Sbjct: 839  DVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMG 898

Query: 866  KPLVKNLPIQKRTNQNKGNNNDE--------------------------PSRKKVKKELE 899
            +P++K   +++  N  + N++D+                          P  KK+K  LE
Sbjct: 899  RPILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIK--LE 956

Query: 900  NDINSLHPILID---NEGVTPSDAAPLIXXXXXXXXXXXXXXXXEFAEALQVDPILNSDY 956
            ++ +     L+D    + ++ S   P +                  AEAL +DP+LN++ 
Sbjct: 957  DESSDTSNALVDKSYTDDLSSSANQPQVPASTQTA----------IAEALHLDPVLNNNI 1006

Query: 957  YQFSNLDLATLFNSDKLNKINSHHGSSINLIDQKPFN---DSLIPKFSQVNTASNSTLNM 1013
               S  DLA  F  +      + H S  N  D  P +   +     FS +    +S   +
Sbjct: 1007 --LSVADLAAFFGGNMPAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGV 1064

Query: 1014 EQLLRNQGKFNISPNIFSPNFQSKENLLGXXXXXXXXXXXXXXXXXXXXXXTTMMMLLNN 1073
            + L R     +   + + P+  S  NL                             L NN
Sbjct: 1065 DGLFRVPSNADFLMDEYYPSGTSHINL----------------------------TLFNN 1096

Query: 1074 EI-----PFSSINSNTGESGVN-----KQNANATENDNVETIN--FKQDLTNKNESGNML 1121
                    F   + +  ++GVN     K    +T + ++   N   + +      SGNM 
Sbjct: 1097 NANNHDDTFGLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNM- 1155

Query: 1122 STENYLSDFSYIIDGSLGLAPLL 1144
               N  SDF++ +D SLGLAPLL
Sbjct: 1156 ---NSGSDFNFAVDASLGLAPLL 1175

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1001 (41%), Positives = 563/1001 (56%), Gaps = 142/1001 (14%)

Query: 22  SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXX 81
           S+SNYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SDKL R+A+PRGYTE++   
Sbjct: 81  SASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEER 140

Query: 82  XXXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELN 141
                         CDLKE+Q+ LV+KYS+ +++        I  N D      +     
Sbjct: 141 VRELEAENRRLVALCDLKEEQLHLVSKYSNKRTSE-------ISENEDEQILQQL----- 188

Query: 142 KDRQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMXXXXXXXXXXXXXXXXXXX 201
                   +  N   L +S TNLYLLN+T    + +  ++M                   
Sbjct: 189 --------SAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQM------------------- 221

Query: 202 XKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXXHVCDGICCTDK----LHPQ 257
                        S TTV                         C+G+ C       +H +
Sbjct: 222 ------------SSKTTVD------------------------CNGVGCNHSHQPNIHDK 245

Query: 258 PVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQ 317
           PV+TN NDPTSISFEQ+EAPGL A KAL S+ N E + QLA LV+LSVPRSTEEIL IPQ
Sbjct: 246 PVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQ 305

Query: 318 LLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNSLLLKNTNIWQINDLN 377
           LLA+I QVHG TSKQ LYT                   +    N  +LK+TN+W+++D+ 
Sbjct: 306 LLARIGQVHGLTSKQSLYTASLLASLKE-------SIPLTLPTNVDMLKSTNLWEVDDVI 358

Query: 378 VFFTDLLKFNISNDSKTSTL--LSFDDIDDLTNLYFNHWSNLIPVLXXXXXXXXXXXXKI 435
            FF  + KF+I  +S T++   L   +ID L + +F+ W N IP+L            K 
Sbjct: 359 QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418

Query: 436 QCQ--SFIQG-----NQSNNLRDYKFFGCFLMVMCQMGLLIKLKEH--KSNNSLFKILTY 486
                +F        N+ N    YK FGC L+++CQMGL+ K+K     + N   +++ Y
Sbjct: 419 DLMDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAY 478

Query: 487 YHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLH 546
           Y  +   L  NP ++  +TSI+S+Q  +L LFY LN+G +  +Y+LRG ++SM+ QLRLH
Sbjct: 479 YDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLH 538

Query: 547 RCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV-DN 605
           RCPSAVL G+GS + K +Q  RR+LFW IYYLDVFS+LQLGVPRLLKD+EIECALPV DN
Sbjct: 539 RCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADN 598

Query: 606 TTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENAL 665
                 + G  I LEG VS +SL++ RFAKVLGNI+DSIFKR MS S+++Q++L+HENAL
Sbjct: 599 DDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENAL 658

Query: 666 DNWRSRLPEQFQFKLDVNGTINLND------LDTE----NSDTIFLIVFYFLAKCMIHLP 715
           DNWR  LP+Q +F+LDVNGTIN+++      LDT     + +   L+V YF+AKCMIHLP
Sbjct: 659 DNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLP 718

Query: 716 VCSTKVDLEDKVTETGNDVIYN---DRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNV 772
           V + +  + D      +    N   DR S+SYV LQQ+TNT+LN    +R+ Y P+P NV
Sbjct: 719 VVAKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINV 778

Query: 773 SRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXX 832
           SRT TRF+L+SA+GSL+Y KGG+LF DNK LLLD V+++E ++KL+LPG +SWHS     
Sbjct: 779 SRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLSWHSLKLLD 838

Query: 833 XXXXXXXQNSNTKPEKIEXXXXXXXXXXXXXMGKPLVKNLPIQKRTNQNKGNNNDEPSRK 892
                  Q +NTKPEK+E               K    N    +R+N   G +   P   
Sbjct: 839 MSISLILQPANTKPEKLEKMLQR----------KLNYYNKLTNRRSNLGGGRSASSPGGN 888

Query: 893 KVKKELENDINSLHPILI--DNEGVTPSDA---------APLIXXXXXXXXXXXXXXXXE 941
             +K  EN  ++  P L    ++G TP D           P+                 +
Sbjct: 889 SKRKLDENQGSAEPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQ 948

Query: 942 --------FAEALQVDPILNSDYYQFSNLDLATLFNSDKLN 974
                    AEA  +DP+LN++   FSN DL   FN++  N
Sbjct: 949 PPVAPQNSIAEAFHLDPVLNNN--PFSNTDLNAFFNTNNGN 987

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1037 (41%), Positives = 582/1037 (56%), Gaps = 111/1037 (10%)

Query: 243  HVCDGICCTD-KLHPQPVATNYN--DPTSISFEQSEAPGLVAAKALKSINNQEEATQLAI 299
            HVCDGICC D KLH +PVATN+N  DPTS+SFEQ+EAPGL+AA+A+  I+N E++TQLAI
Sbjct: 277  HVCDGICCQDTKLHSRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAI 336

Query: 300  LVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXX----XXXXXDFL 355
            LVSLS+PRSTEEILFIPQLLAKIRQV GFTSKQCLYTV                     +
Sbjct: 337  LVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLLKNSKMI 396

Query: 356  MDNSQNSLLLKNTNIWQINDLNVFFTDLLKFNISND-----SKTSTLLSFDDIDDLTNLY 410
            + NS N  +L + N+W + +L+ FF ++LK NI  D      K    L+  +ID+L  LY
Sbjct: 397  LQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPDDDDHLKKNDDHLALSEIDELVALY 456

Query: 411  FNHWSNLIPVLXXXXXXXXXXXXKIQCQSFIQGNQSN--NLRDYKFFGCFLMVMCQMGLL 468
            F +WS+ IP+             K       +   S+  N+ + K FGC L V+CQMG+L
Sbjct: 457  FKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLENILNIKIFGCLLTVICQMGIL 516

Query: 469  IKLKEHKSNNSLF-KILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIE 527
            IK K  K+ +  F K+L+YYH L Y+LPKN  +   TTSIK+VQ+L+L+LFYHLN G+I 
Sbjct: 517  IKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDII 576

Query: 528  QIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLG 587
            QIY+LRG IISMA QLRLHRCPSAVLTGSGS M +LEQ NRR LFW IYYLDVF SLQLG
Sbjct: 577  QIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLG 636

Query: 588  VPRLLKDYEIECALPVDNTT-TMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFK 646
            VPRL+KD+EIECALP+ +     D +DG  ++LEGT+S+ SL++ R AKVLGNI+DSIFK
Sbjct: 637  VPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFK 694

Query: 647  RNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYF 706
            RNMS SI+ QV  IHENALD+WR++LP+++QFKL+ NG ++L  L+ EN   + L     
Sbjct: 695  RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNHENLILVLLFF--- 751

Query: 707  LAKCMIHLPVCSTKVDLEDKVTETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYL 766
            L K MI++P+ S   +L +   +  ND   N +   S+ SLQQS N +L+  + I ++YL
Sbjct: 752  LVKSMIYMPLSSAITELANN-PKVKNDYYMNHK--VSHTSLQQSINALLSVFKNINNQYL 808

Query: 767  PMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWH 826
            P+P N SRT+TRF L+SAKGSL+Y KGG LF DNK LLL  +Q+IE +RKL+LPGII WH
Sbjct: 809  PLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWH 868

Query: 827  SXXXXXXXXXXXXQNSNTKPEKIEXXXXXXXXXXXXXMGKPLVKNLPIQKRTNQNKGNNN 886
            S                   +K+E             MGKPL+ +LP  K T + +   +
Sbjct: 869  SLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSK-TKRKQSKED 927

Query: 887  DEPSRKKVKKELENDINSLHPILIDNEGVTPSDAAPLIXXXXXXXXXXXXXXXXEFAEAL 946
               + KK K++++ ++++L    +  E   P     L                  F EAL
Sbjct: 928  LFTANKKRKQQVKTELSTLE---VKRE---PQQVQLL---KREGQGNTTESTQSAFVEAL 978

Query: 947  QVDPILNSDYYQFSNLDLATLFNSDKLNKINSHHGSSINLIDQKPFND--SLIPKFSQVN 1004
            Q+DPILN++ Y FS  DL+  F S++   +      S     Q+P  D  SL    + V 
Sbjct: 979  QLDPILNANIYNFSGTDLSNFFISNQNGDVPRE---SREPAVQQPIPDRTSLPATNTSVV 1035

Query: 1005 TASNSTLNMEQLLRNQGKFNISPNIFS--PNFQSKENLLGXXXXXXXXXXXXXXXXXXXX 1062
            T  +S    E       K  I P++    P+F   ++                       
Sbjct: 1036 TGFDSLPKPEN--SKPAKDAIGPSLKKGYPSFIGTKS--------------------HNN 1073

Query: 1063 XXTTMMMLLNNEIPFSSINSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLS 1122
              +TMMM LNN+ PFSS+N N   +    + ++A           KQ   N  E  +   
Sbjct: 1074 SVSTMMMFLNNDYPFSSMNLNALYAPDGYKESSAQPG--------KQFTLNTGEPHSTY- 1124

Query: 1123 TENYLSDFSYIIDGSLGLAPLLANPFKPTGENNLVN---VSSIETTGQCINPKV------ 1173
                  DF  I+D SLGLAPLL    +  G+    N   +S  + TG+ +   V      
Sbjct: 1125 ------DFGMIVDASLGLAPLLNEAPEIPGQPEFFNSDEMSPSQLTGKLMPMAVNKPMDQ 1178

Query: 1174 -----LSSQSSDANKDDTDLNLENGAVQRRPRRYNGNFGLGGTGMNSNFSVSDLLRPDDQ 1228
                  + +SS  N +   L    G      R  NG+  +                    
Sbjct: 1179 NSNFTYNYKSSVENNEGLTLEAIRGGETSTQRVSNGHIRV-------------------N 1219

Query: 1229 KKREKETLNDLFNWQNS 1245
            ++R+ + ++DLF+WQNS
Sbjct: 1220 RQRQSDAVDDLFSWQNS 1236

 Score = 98.6 bits (244), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/77 (54%), Positives = 52/77 (67%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXXXX 86
           R +QACDRCR KK +CD ++PQCS CA+VGFECK+SDKL R ++PRGYTES+        
Sbjct: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 87  XXXXXXXXXCDLKEQQI 103
                     DLKEQQ+
Sbjct: 231 SENRRLLAMNDLKEQQL 247

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/924 (42%), Positives = 527/924 (57%), Gaps = 148/924 (16%)

Query: 26  YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXXX 85
           YR+ QACDRCRSKKTRCDG++PQCSQCAAVGFEC++SDKL+RKAYP+GYTES+       
Sbjct: 63  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 86  XXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQ 145
                     CD+KEQQI+LV++         PT         D+  ++N K +L KD  
Sbjct: 123 EAENKRLLALCDIKEQQINLVSQSRP------PTSL-------DNTVSDNFKQDL-KD-- 166

Query: 146 NDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMXXXXXXXXXXXXXXXXXXXXKLN 205
                     PLN+S TN+YLLNQT  K +L NG                       K++
Sbjct: 167 ---------APLNLSSTNIYLLNQTVNK-QLQNG-----------------------KID 193

Query: 206 SNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXXHVCDGICCTDKLHPQPVATNYND 265
           +N +  +     T  PL                    HVCDG+ CT+ LH +P +T+ ND
Sbjct: 194 TNRSDSTMGLLATSPPLPQK----------------DHVCDGVSCTNNLHAKPTSTSLND 237

Query: 266 PTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQV 325
           PT+ISFEQ+EAPGL A KALKS+   + +TQLA LVSLS+PRSTEEILFIPQLL +IRQ+
Sbjct: 238 PTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQI 297

Query: 326 HGFTSKQCLYTVXXXXX------XXXXXXXXXXDFLMDNSQNSLL--LKNTNIWQINDLN 377
            GF SKQCLYTV                       + +N  +  L   + T++ +  DL 
Sbjct: 298 FGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNTFETTSLAEFGDLK 357

Query: 378 VFFTDLLKFNIS----------NDSKTSTLLSFDDIDDLTNLYFNHWSNLIPVLXXXXXX 427
            F    LKF+I+          N+   + LLS ++I +L +L+F  WSN + +L      
Sbjct: 358 KFLIS-LKFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLHLFFKFWSNQVSILNNDHFL 416

Query: 428 XXXXXXKIQCQSF------IQGNQSNNLRDYKFFGCFLMVMCQMGLLIKLKEHK------ 475
                     ++         G +++   +++ F   L++M QMGLLIK+K  K      
Sbjct: 417 LYFNNFVEVIKALPLELKKTNGTKTHATTNHQIFALKLLIMLQMGLLIKVKREKIKDTVP 476

Query: 476 --SNNSLFKILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFYHLNMGNIEQIYEL 532
              N+   K++ YYHQ++ I+PKNP + + +TTS+ S+QLL+L  FY LN+G+I  IY L
Sbjct: 477 GNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFLNVGDIPAIYGL 536

Query: 533 RGNIISMAHQLRLHRCPSAVLT-GSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRL 591
           RG I+SM+ QLRLHRCPSAVL+  S   +Q+ EQS RRLLFW +YY+DVF+SLQLGVPRL
Sbjct: 537 RGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDVFASLQLGVPRL 596

Query: 592 LKDYEIECALPVDNTTTMDAIDG---------TSIKLEGTVSQISLTLFRFAKVLGNIVD 642
           LKD++IECALP+ +    D +             I+L+G VS  SL + RFAK+LGNI+D
Sbjct: 597 LKDFDIECALPISDVEFEDQLASENEKTKNKTKKIQLQGQVSSFSLQIIRFAKILGNILD 656

Query: 643 SIFKRN-MSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENS----- 696
           SIFKR  M   ++ +VAL+HENALDNWR++LPE + F++ VNGT+NL+D+   NS     
Sbjct: 657 SIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDDIRANNSRNTEA 716

Query: 697 -----DTI-----FLIVFYFLAKCMIHLPVCSTK--VDLEDKVTETGNDVIYND------ 738
                D I      L++FYFLAK MIHLPV +TK      D  T+  + +  ND      
Sbjct: 717 KFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTVDNSTKKKHSMFNNDTKSINN 776

Query: 739 ---------------RFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLIS 783
                          R S+SY+ LQQ+TN  L   + I   YLP+P NVSRTL RF+L+ 
Sbjct: 777 QDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSINSVYLPLPLNVSRTLIRFSLLC 836

Query: 784 AKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSN 843
           A+GSL+Y KGG+LF+DNK LLLD ++DIE +R LDLPG+ SWH+            +  N
Sbjct: 837 ARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHTLKLFDMTINLLLKAPN 896

Query: 844 TKPEKIEXXXXXXXXXXXXXMGKP 867
            K E+++             MG P
Sbjct: 897 VKVERLDKFLEKKLNYYNRLMGLP 920

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 1078 SSINSNTGESGVNKQNANATENDNVETI-NFKQDLTNKNESGNMLSTENYLSDFSYIIDG 1136
            +S  SNT  S +     N  +N ++    NF   +TN N SG          D+ YI+D 
Sbjct: 1207 ASTASNTSRSSITGNKKNGMDNCDINDFGNFNNFMTNVNYSG---------VDYDYIVDA 1257

Query: 1137 SLGLAPLLAN 1146
            SLGLAPLL +
Sbjct: 1258 SLGLAPLLVD 1267

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/962 (42%), Positives = 536/962 (55%), Gaps = 156/962 (16%)

Query: 26  YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXXX 85
           YR+ QACDRCRSKKTRCDG++PQCSQCAAVGFEC++SDKL+RKAYP+GYTES+       
Sbjct: 64  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 86  XXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQ 145
                     CD+KEQQISLV++         PT       + D+    + K EL KD  
Sbjct: 124 EAENKRLLALCDIKEQQISLVSQSRP------PT-------SMDNTANGSFKQEL-KD-- 167

Query: 146 NDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMXXXXXXXXXXXXXXXXXXXXKLN 205
                     PLN+S TN+YLLNQT  K +L NG KM                      N
Sbjct: 168 ---------APLNLSSTNIYLLNQTVNK-QLQNG-KMDSD-------------------N 197

Query: 206 SNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXXHVCDGICCTDKLHPQPVATNYND 265
           SN  + S       +PL                    HVCDGI CT+ LH +P +T+ ND
Sbjct: 198 SNTVMNS----LAAAPLPPQ---------------KDHVCDGISCTNHLHVKPTSTSLND 238

Query: 266 PTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQV 325
           PT+ISFEQ EAPGL A KALK +   + +TQLA LVSLS+PRSTEEILFIPQLL +IRQ+
Sbjct: 239 PTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQI 298

Query: 326 HGFTSKQCLYTVXXX---------------XXXXXXXXXXXXDFLMDNSQNSLLLKNTNI 370
            GF SKQCLYTV                                L D+S      + TN+
Sbjct: 299 FGFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAFFKKFQTTNL 358

Query: 371 WQINDLNVFFTDLLKFNISNDSKTS---------TLLSFDDIDDLTNLYFNHWSNLIPVL 421
            +  DL  F    LKF+I + SK S          LLS  +I +L +L+F  WSN +P+L
Sbjct: 359 SEFVDLKGFLVS-LKFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKFWSNQVPIL 417

Query: 422 XXXXXXXXXXXXKIQCQSFIQGNQSNNL-------RDYKFFGCFLMVMCQMGLLIKLKEH 474
                           +     N   N+        +++ F   L +M  MGLL+K+K  
Sbjct: 418 NNDHFLLYFNNFVEVVKDLSSANLKTNVTNTSIVTTNHELFALKLSMMLLMGLLVKIKME 477

Query: 475 K--------SNNSLFKILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFYHLNMGN 525
           K         N+   +++ YYHQL+ I+PKNP + + +TTS+ S+QLL+L  FY+LN+G+
Sbjct: 478 KIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGD 537

Query: 526 IEQIYELRGNIISMAHQLRLHRCPSAVLT-GSGSTMQKLEQSNRRLLFWTIYYLDVFSSL 584
           I  IY +RG I+SMA QLRLHRCPSAVL+  S   +QK EQS RRLLFW IYY+DVF+SL
Sbjct: 538 ISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASL 597

Query: 585 QLGVPRLLKDYEIECALPVDNTTTMDAI---------DGTSIKLEGTVSQISLTLFRFAK 635
           QLGVPRLLKD++IECALP+ +    D +             I+L+G VS  SL + RFAK
Sbjct: 598 QLGVPRLLKDFDIECALPISDVEYKDQLFMENKKTNKKAKKIQLQGQVSSFSLQIIRFAK 657

Query: 636 VLGNIVDSIFKRN-MSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDL--- 691
           +LGNI+DSIFKR  M   I+ +VAL+HENALDNWRS+LP+ + F++ VNGT+NL+++   
Sbjct: 658 ILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNGTVNLDEIRVN 717

Query: 692 DTENSDTIF------------LIVFYFLAKCMIHLPVCSTKVDLE--DKVTETGNDVIYN 737
           D++N +T F            L++FYFLAK MIHLPV +TK   +  D  T+    V  N
Sbjct: 718 DSKNIETRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNIDNGTKKKQSVFSN 777

Query: 738 D---------------------RFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTL 776
           D                     R S+SY+ LQQ+TN  L   + I   Y+P+P NVSRTL
Sbjct: 778 DSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTINWMYIPLPLNVSRTL 837

Query: 777 TRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXX 836
            RF+L+ A+GSL+Y KGG+LF+DNK LLLD ++DIE +R LDLPG  SWH+         
Sbjct: 838 IRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGTASWHTLKLYDMTIN 897

Query: 837 XXXQNSNTKPEKIEXXXXXXXXXXXXXMGKPLVKNLPIQK-RTNQNKGNNNDEPSRKKVK 895
              +  N K E+++             MG PL     I+    +Q+K +    P +  VK
Sbjct: 898 LLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPILGSQSKDSPETRPRKSIVK 957

Query: 896 KE 897
           +E
Sbjct: 958 RE 959

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 9/71 (12%)

Query: 1076 PFSSINSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTENYLSDFSYIID 1135
            P S+    +  S +   N      D  +  NF   +TN N SG          D+ YI+D
Sbjct: 1221 PPSTAGHRSQSSSIGNTNHGVDNCDFNDLGNFNNFMTNVNYSG---------VDYDYIVD 1271

Query: 1136 GSLGLAPLLAN 1146
             SLGLAPLL +
Sbjct: 1272 ASLGLAPLLVD 1282

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/794 (44%), Positives = 484/794 (60%), Gaps = 76/794 (9%)

Query: 243  HVCDGICCTDKLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVS 302
            HVCDG+CC  KLH +PV+TN NDPTS+SFEQSEAPGL A +AL S+  +E++ QLA LV+
Sbjct: 243  HVCDGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVA 302

Query: 303  LSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNS 362
            LSVPRSTEEILFIPQLLA+IRQ++GFTSKQCLYTV                  +   +  
Sbjct: 303  LSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPH----LVKHEPL 358

Query: 363  LLLKNTNIWQINDLNVFFTDLLKFNISNDSKTS----TLLSFDDIDDLTNLYFNHWSNLI 418
              L +TN+W+++DL  FF ++ KF + + S +S      L+  +I++L +++F H S  I
Sbjct: 359  ETLASTNLWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLNLSEIEELISIFFEHSSIHI 418

Query: 419  PVLXXXXXXXXXXXXK---IQCQSFI----QG----NQSNNLRDYKFFGCFLMVMCQMGL 467
            P+L            K   +Q   F+    QG     +   +  YK FGC ++++CQ+GL
Sbjct: 419  PILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGL 478

Query: 468  LIKLKEH--KSNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGN 525
            L K+K     + +   ++ +YYH+   ++  NP +   +TS++S+Q L+L+LFY LN+GN
Sbjct: 479  LSKIKAENLGATSKHHRLASYYHKAISLVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGN 538

Query: 526  IEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQ 585
            +  IYELRG ++SMA QLRLHRCPSAVL G+GSTM K EQ +RR+LFW IYYLDVFS+LQ
Sbjct: 539  VSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598

Query: 586  LGVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSI 644
            LGVPRL+KD+EIECALPV DN      + G  I+LEG V+  SL + RF+KVLGNI+DSI
Sbjct: 599  LGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSI 658

Query: 645  FKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLD--------TENS 696
            FKR M+ SI++QV+LIHENALDNWR  LP++  F+LDVNGTIN+++ +         E S
Sbjct: 659  FKRGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERS 718

Query: 697  DTIFLIVFYFLAKCMIHLPVCSTKV----DLEDK-----VTETGNDV-----------IY 736
            + + L+V YFLAKCMIHLPV +T+     D  D       T  GN+V             
Sbjct: 719  ENMTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAA 778

Query: 737  NDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSL 796
             DR S+SYV LQQ+TNTMLN L  ++  +LP+P N+SRT  RF L+SA+GSL+Y KGG+L
Sbjct: 779  ADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGAL 838

Query: 797  FIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEKIEXXXXXX 856
            F+DNK LLLD ++D+E +RKLDLPG+ISW+S            Q  NT+  K++      
Sbjct: 839  FLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKK 898

Query: 857  XXXXXXXMGKPLVKNLPIQKRTNQNKGNNNDE---PSRKKVKKELENDINSLHPILIDNE 913
                   MG+P VK  P  K  +    ++ DE   P+ K++K E E  I    P+ +  +
Sbjct: 899  LNYYNRLMGRPTVKQEPASKGHDLTPASSKDEEDTPAAKRIKIE-ETSI----PLAVPQQ 953

Query: 914  GVTPSDAAPLIXXXX-----------------XXXXXXXXXXXXEFAEALQVDPILNSDY 956
                   AP++                                  FAEALQ+DP+LNS+ 
Sbjct: 954  QQHMQAPAPVMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSN- 1012

Query: 957  YQFSNLDLATLFNS 970
              F N    TL++ 
Sbjct: 1013 VSFQNAPPTTLYDG 1026

 Score =  134 bits (336), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 69/147 (46%), Positives = 82/147 (55%), Gaps = 23/147 (15%)

Query: 22  SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXX 81
            S N RV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SD+L R+A+PRGYTE++   
Sbjct: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEER 153

Query: 82  XXXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELN 141
                         CD+KEQQI L ++  S        +R + EL S             
Sbjct: 154 VRELEAENRRLVALCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQS------------- 200

Query: 142 KDRQNDVTTIPNSLPLNISQTNLYLLN 168
                      N   LNIS TNLYLLN
Sbjct: 201 ----------ANGGSLNISSTNLYLLN 217

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/931 (42%), Positives = 524/931 (56%), Gaps = 155/931 (16%)

Query: 26  YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXXX 85
           YR+ QACDRCRSKKTRCDG++PQCSQCAAVGFEC++SDKL+RKAYP+GYTES+       
Sbjct: 64  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 86  XXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQ 145
                     CD+KEQQISLV++     S    TD             N I G    D +
Sbjct: 124 EAENKRLLALCDIKEQQISLVSQSRPQTS----TD-------------NTINGNFKHDLK 166

Query: 146 NDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMXXXXXXXXXXXXXXXXXXXXKLN 205
           +         PLN+S TN+YLLNQT  K                                
Sbjct: 167 D--------APLNLSSTNIYLLNQTVNKQL------------------------------ 188

Query: 206 SNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXXHVCDGICCTDKLHPQPVATNYND 265
            NG +    S + +SPL +       +          H+CDG+ CT+ LH +P +T+ ND
Sbjct: 189 QNGKMDGDNSGSAMSPLGAPPPPPHKD----------HLCDGVSCTNHLHVKPTSTSLND 238

Query: 266 PTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQV 325
           PT+ISFEQ EAPGL A KALKS+   + +TQLA LVSLS+PRSTEEILFIPQLL +IRQ+
Sbjct: 239 PTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQI 298

Query: 326 HGFTSKQCLYTVXXXX------------XXXXXXXXXXXDFLMDNSQNSLLLK---NTNI 370
            GF SKQCLYTV                           D       +S  +K   +TN+
Sbjct: 299 FGFNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNL 358

Query: 371 WQINDLNVFFTDLLKFNISNDSKTS---------TLLSFDDIDDLTNLYFNHWSNLIPVL 421
            +  DL  F    LKFNI++ SK S          LLS  +I +L +L+F  WSN +P+L
Sbjct: 359 SEFVDLKKFLIS-LKFNINSFSKQSEKPANDQDDELLSLTEIKELLHLFFKFWSNQVPIL 417

Query: 422 XXXX-----XXXXXXXXKIQCQSFIQGN--QSNNLRDYKFFGCFLMVMCQMGLLIKLKEH 474
                             +  ++    N  +S    +++ F   L++M QMGLL+K+K  
Sbjct: 418 NNDHFLIYFNNFVEVVKHLSTENLETNNTTKSTVTTNHEIFALKLLMMLQMGLLVKIKME 477

Query: 475 KSNNSLFK--------ILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFYHLNMGN 525
           K   ++ K        ++ YYHQL+ I+PKNP + + +TTS+ S+QLL+L  FY+LN+G+
Sbjct: 478 KIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGD 537

Query: 526 IEQIYELRGNIISMAHQLRLHRCPSAVLT-GSGSTMQKLEQSNRRLLFWTIYYLDVFSSL 584
           I  IY +RG I+SMA QLRLHRCPSAVL+  S   +QK EQS RRLLFW IYY+DVF+SL
Sbjct: 538 ISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASL 597

Query: 585 QLGVPRLLKDYEIECALPVDNTTTMDAID---------GTSIKLEGTVSQISLTLFRFAK 635
           QLGVPRLLKD++IECALP+ +    D +             I+L+G VS  SL + RFAK
Sbjct: 598 QLGVPRLLKDFDIECALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQIIRFAK 657

Query: 636 VLGNIVDSIFKRN-MSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDL--- 691
           +LGNI+DSIFKR  M   I+ +VAL+HENALDNWR++LPE + F++ VNGT+NL+++   
Sbjct: 658 ILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDEIRAT 717

Query: 692 DTENSDTIF------------LIVFYFLAKCMIHLPVCSTKVDLE--DKVTETGNDVIYN 737
           +  N++T F            L++FYFLAK MIHLPV +TK   +  D  T+    +  N
Sbjct: 718 NQRNTETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNVDNATKKKQSMFNN 777

Query: 738 D---------------------RFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTL 776
           D                     R S+SY+ LQQ+TN  L   + I   YLP+P NVSRTL
Sbjct: 778 DSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPLNVSRTL 837

Query: 777 TRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXX 836
            RF+L+ A+GSL+Y KGG+LF+DNK LLLD ++DIE +R LDLPGI SWH+         
Sbjct: 838 IRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKLFDMSIN 897

Query: 837 XXXQNSNTKPEKIEXXXXXXXXXXXXXMGKP 867
              +  N K E+++             MG P
Sbjct: 898 LLLKAPNVKVERLDKFLEKKLNYYNRLMGLP 928

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 29/111 (26%)

Query: 1065 TTMMMLLNNEIPFSSI-----------NSNTGESGVNKQ--------------NANATEN 1099
            T +M LLNN+  FS+I           NS + + G NK+               +N ++ 
Sbjct: 1172 TKLMRLLNNDNSFSNISINNFLYQNDQNSASADPGTNKKAVTNAGANFKPPSTGSNTSQG 1231

Query: 1100 DNVETINFKQDLTNKNESGNM---LSTENYLS-DFSYIIDGSLGLAPLLAN 1146
              + +     D  + N+ GN    ++  NY   D+ YI+D SLGLAPLL +
Sbjct: 1232 SILGSTKHGMDNCDFNDLGNFNNFMTNVNYSGVDYDYIVDASLGLAPLLVD 1282

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1065 (39%), Positives = 569/1065 (53%), Gaps = 144/1065 (13%)

Query: 7    GSSDPRKQDSDVNHPSSS----NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
            G+S      S    P SS    NYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+S
Sbjct: 49   GASPAAAPQSTTGTPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 108

Query: 63   DKLIRKAYPRGYTESIXXXXXXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRC 122
            DKL R+A+PRGYTE++                 CDLKE+Q+ LV+KY    +    T   
Sbjct: 109  DKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPA--TSSS 166

Query: 123  IIELNSDSDCTNNIKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKM 182
                  DSD T     ++ +   N      +   L +S TNLYLLN+      L      
Sbjct: 167  SANKKGDSDHTTLEDEQILQQLSNS-----DGGALRVSSTNLYLLNKKTAAFPL------ 215

Query: 183  XXXXXXXXXXXXXXXXXXXXKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXX 242
                                +L SN     P +  T+SP      +  +++R        
Sbjct: 216  ---------VQPVQQNLSPTQLRSN-----PYTRATLSPSHVAEADHVTDLRKGLPANPV 261

Query: 243  HVCDGICCTDKLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVS 302
             +   +    ++ P P  TN NDPTSISFEQ +APGL A KAL S+ + EE++QLA LV+
Sbjct: 262  AISSSV---GQVPPYPF-TNLNDPTSISFEQDQAPGLPAVKALSSLASHEESSQLAALVA 317

Query: 303  LSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNS 362
            +S+PR+TEEILF+PQLLA+I Q+HGFTSKQCLYT                  L       
Sbjct: 318  VSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPRKTSSILEQ----- 372

Query: 363  LLLKNTNIWQINDLNVFFTDLLKFNISNDSKTS--------------------------- 395
              LK  N+W+I++++ F  + L+ +I   S                              
Sbjct: 373  --LKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQE 430

Query: 396  -TLLSFDDIDDLTNLYFNHWSNLIPVLXXXXXXXXXXXXKIQCQS---FIQGNQSNNLR- 450
             T L+F +I++L  L+F+ W +LIP+             K    +   F  G+   + R 
Sbjct: 431  LTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRH 490

Query: 451  ---DYKFFGCFLMVMCQMGLLIKLKE--HKSNNSLFKILTYYHQLTYILPKNPVYDFATT 505
                YK F C L+ +CQMGL+ K+K   H+  + L  ++TYY +    +  NP +  ++T
Sbjct: 491  KSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPYFSSSST 550

Query: 506  SIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQ 565
            SI+S+QLL+LLLFY LN+G++  +YELRG ++S+  QLRLHRCPSAVL   GST+ K++Q
Sbjct: 551  SIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQ 610

Query: 566  SNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV----DNTTTMDAIDGTSIKLEG 621
              RR+LFW +YYLDVFSSLQLGVPRL+KD+EIECALPV    DN   +    G  I LEG
Sbjct: 611  GERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNL---AGQMIALEG 667

Query: 622  TVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLD 681
             +S  SL++ RF+KVLGN++DSIFKR M+ S+++QVAL+HENALDNWR  LP+  +F+LD
Sbjct: 668  KMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLD 727

Query: 682  VNGTINLNDL-----DTENSDTIF------LIVFYFLAKCMIHLPVCSTK--VDLEDKVT 728
            VNGTIN+ DL     D  N DT         +  YFLAK MIHLPV +TK  +D    V 
Sbjct: 728  VNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVV 787

Query: 729  ETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSL 788
            +T       DR S+SYV LQQ+TNT LN L  +   YLP+P N++RT TRF L+SA+GSL
Sbjct: 788  DTNIPGSQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSL 847

Query: 789  DYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEK 848
            +Y KGG+LF DNK LLLD ++D+EA++KL++PG ISWHS            Q  NTKPEK
Sbjct: 848  EYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPPNTKPEK 907

Query: 849  IEXXXXXXXXXXXXXMGKPL--VKNLPIQKRT----------------------NQNKGN 884
             E             +   L    +LP   +T                       +++G+
Sbjct: 908  QEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIPEKEKPPSSKRHRGD 967

Query: 885  NNDEPS-----RKKVKKELEND--------INSLH---PILIDNE-GVTPSDAAPLIXXX 927
            +N   S      KKVK E            I++LH   P ++D   G   S A  ++   
Sbjct: 968  DNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLA--VLAAK 1025

Query: 928  XXXXXXXXXXXXXEFAEALQVDPILNSDYYQFSNLDLATLFNSDK 972
                            EA Q+DPIL      FSN DL + F  D+
Sbjct: 1026 HEPEGSLHSSAGNAITEAFQLDPILQPT--PFSNTDLPSFFGVDQ 1068

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 24/130 (18%)

Query: 1130 FSYIIDGSLGLAPLLANPFKPTGE-------NNLVNVSSIETTGQCIN-PKVLSSQSSDA 1181
            + +++D SLGLAPLLA   +P  +         L +  S     +  + P ++S+Q   A
Sbjct: 1165 YGFVVDASLGLAPLLAWSPRPADDLLLDDKGAKLASARSFTHVNKLSSIPTLMSTQPPPA 1224

Query: 1182 NKDDTDL------NLENGAVQRRPRRYNGNFGLGGTGMNSNFSVSDLLRPDDQKKREKET 1235
            +     L      + ++G +   PR   G   L  + +N     + L   DD       +
Sbjct: 1225 SAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNSALNQARPAAAL---DD-------S 1274

Query: 1236 LNDLFNWQNS 1245
            ++DLF WQNS
Sbjct: 1275 ISDLFRWQNS 1284

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/776 (42%), Positives = 453/776 (58%), Gaps = 63/776 (8%)

Query: 243 HVCDGICCTDKLHP----QPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLA 298
           H C GI C    HP    +PV+T  +DPT+ISFEQ EAPGL A KAL S+ N E +TQLA
Sbjct: 203 HKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLA 262

Query: 299 ILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDN 358
            LV+LSVPRSTEEILFIPQLLA++ QVHG TSKQCLYT                  ++  
Sbjct: 263 CLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQA-----VVPT 317

Query: 359 SQNSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSNLI 418
           +     LK T++W+I+D   FF D  KFN+ +D+    LLS  +I+DL ++YF     LI
Sbjct: 318 TDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVE-LLSISEIEDLISIYFEECHALI 376

Query: 419 PVLXXXXXXXXXXXXK----IQCQSFIQGNQSNNLRD----YKFFGCFLMVMCQMGLLIK 470
           PVL            K    +    F + N S   R     YK F C L+V+CQ+G++ K
Sbjct: 377 PVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGIMSK 436

Query: 471 LKEHK--SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQ 528
           +K  +  + +   +I+ YY+     L  NP +   TTS+K++QL++LLLFY LN+G +  
Sbjct: 437 VKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSS 496

Query: 529 IYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGV 588
           +YELRG I+SMA QLRLHRCPSAVL   GSTM K EQ +RRLLFW IYYLDVFS+LQLGV
Sbjct: 497 VYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGV 556

Query: 589 PRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKR 647
           PRLLKD+EIECALP+ +N     ++    I+LEG VS+ SL+L RF+K+LGNI+DSIFKR
Sbjct: 557 PRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKR 616

Query: 648 NMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDT-----------ENS 696
            M++SI++QVALIHENALD+WR  LP+   F+LDVNGTIN+ +L++            + 
Sbjct: 617 GMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSC 676

Query: 697 DTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVTETGND--VIYND------RFSTSYVSLQ 748
           D   L+V YFL KC++HLPV + K  L    +E   D  + ++D      R S+SYV LQ
Sbjct: 677 DNRTLMVLYFLVKCLVHLPVLAAK-PLLGGASEVDTDATLAFDDASSGADRSSSSYVLLQ 735

Query: 749 QSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCV 808
           Q+TNT L+    ++ ++LP+  N+ R   RF L+SA+G L+Y KGG+LF  NK LLLD V
Sbjct: 736 QATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVV 795

Query: 809 QDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEKIEXXXXXXXXXXXXXMGKPL 868
           +++E  ++L++PG +SWHS            Q  +TK  K++             MG+  
Sbjct: 796 KELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRS- 854

Query: 869 VKNLPIQKRTNQNKGNNNDEPSR-------------KKVKKELENDINSLHPILIDNEGV 915
             N+   KR  +    +    ++             K+VK E  + +    P+ ++N G 
Sbjct: 855 -ANVASTKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKVGET-PVGVENTGQ 912

Query: 916 TPSDAAPLIXXXXXXXXXXXXXXXXEFAEALQVDPILNSDYYQFSNLDLATLFNSD 971
              +                       AEA  +DP+LN++   FSN DL   F++D
Sbjct: 913 PNGNT----QEHYAATWSNQNQPHSTVAEAFHLDPVLNNN--PFSNGDLTAFFSTD 962

 Score =  142 bits (357), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 89/148 (60%), Gaps = 20/148 (13%)

Query: 23  SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXX 82
           SSNYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECKVSDKL R+A+PRGYTE++    
Sbjct: 65  SSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERV 124

Query: 83  XXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNK 142
                        CDLK++Q+ LV KYSSNK    P      E                 
Sbjct: 125 RELEAENRRLVALCDLKDEQMHLVYKYSSNKR---PEPSSTEE----------------- 164

Query: 143 DRQNDVTTIPNSLPLNISQTNLYLLNQT 170
           ++  +  +  N   L +S TNLYLLN+T
Sbjct: 165 EQMLEQLSSSNGGSLRVSSTNLYLLNKT 192

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 74/197 (37%), Gaps = 65/197 (32%)

Query: 1083 NTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTENYLSDFSYIIDGSLGLAP 1142
             +G SG N++ A             KQ  TN  + G           F + +D SLGLAP
Sbjct: 1039 GSGSSGSNQRQA-------------KQQQTNTTDPG-----------FGFTVDASLGLAP 1074

Query: 1143 LLA-------NPFKPTGENNLVNVSSIETTGQCINPKVL---SSQSSDANKDDT------ 1186
            LLA        P   T +++  N S +          VL    SQ +D++ D        
Sbjct: 1075 LLAWSPEAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQLADSSTDPASQQQRR 1134

Query: 1187 ----------DLNLENGAV------QRRP-RRYNGNFGLGGTGMNSNFSVSDLLRPDDQK 1229
                      D ++E+ A+       R P RR+N   G      NS+       RP +  
Sbjct: 1135 VGSYDHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSD-------RPRNAP 1187

Query: 1230 KREK-ETLNDLFNWQNS 1245
              E  E L DLF WQNS
Sbjct: 1188 ASETDENLQDLFRWQNS 1204

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  549 bits (1414), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 309/698 (44%), Positives = 417/698 (59%), Gaps = 70/698 (10%)

Query: 243 HVCDGICCTD----KLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLA 298
           H  +G    D     LHP+PV+TN N   SISFEQ+EAPGL   KALKS+ N E+ TQLA
Sbjct: 275 HTTNGKLHRDTNDHHLHPKPVSTNSNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLA 334

Query: 299 ILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDN 358
            LVSL++PRSTEEILFIPQ+LAK+RQ  GFTSK CLYTV                    +
Sbjct: 335 TLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAAS 394

Query: 359 SQNSLL--LKNTNIWQINDLNVFFTDLLKFNI-----------------------SNDSK 393
           + N  L  LKNTN+W+ N L  FFT  LK +                        S +  
Sbjct: 395 ADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQD 454

Query: 394 TSTLLSFDDIDDLTNLYFNHWSNLIPVLXXXXXXXXXXXXKIQCQSF-IQGNQSNNLRDY 452
             + LS  +ID+L  L+F +WS+ + ++            K   Q+  I     + L +Y
Sbjct: 455 GISPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYYSVFKSDLQNNNISKMSLSTLMNY 514

Query: 453 KFFGCFLMVMCQMGLLIKLKEHKSNNS---------LFKILTYYHQLTYILPKNPVYDFA 503
           K FG  +++ CQMGLL K+K   +N           L K++ YYH L   L  N  +  +
Sbjct: 515 KIFGLIILLFCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFFKIS 574

Query: 504 TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKL 563
             +++S++LL+L+LFY+L+MGNI  IYELR  +ISM+ QLRLHRCPSAVL GS   + KL
Sbjct: 575 NVTLQSLKLLSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGSTLKIHKL 634

Query: 564 EQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV--------DNTTTMDAI--- 612
           EQSNRRLLFW IYYLD+F+SLQLGVPRLLKD+EIECALP+        DN +   A    
Sbjct: 635 EQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNA 694

Query: 613 --DGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRS 670
             D   IKLEG VS +SL + R+++++GNI+D IFKRNM+ S+++ +ALIH +ALD+WR+
Sbjct: 695 ENDDNKIKLEGCVSHLSLVIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIHALDDWRN 754

Query: 671 RLPEQFQFKLDVNGTI---------NLNDLDTENSDTIFLIVF-YFLAKCMIHLPVCSTK 720
            LP   +F L+VNG+I         NLN+ +        L++F YF    MIH+PV +++
Sbjct: 755 TLPSNLKFDLNVNGSIDLSSFIDQQNLNEEEQRTQQQKLLVIFLYFFGVNMIHMPVVASR 814

Query: 721 VDLEDKVTETGNDVIYN--DRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTR 778
                 +    ND +    DR S+SY++LQ +TNTMLN L ++   Y+P+P N+SRT+ R
Sbjct: 815 -----PLPLVENDSLNQIPDRSSSSYIALQHATNTMLNVLDLLSPTYVPLPINMSRTMVR 869

Query: 779 FTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXX 838
           F++ISA G LD+IKGGSLF++NK LL   V++IE +R LDLPG+ISWHS           
Sbjct: 870 FSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLPGVISWHSLKLFDLTLTLF 929

Query: 839 XQNSNTKPEKIEXXXXXXXXXXXXXMGKPLVKNLPIQK 876
            QN+N K EK++             MGKP+V+N P +K
Sbjct: 930 FQNTNIKLEKLDKLLEKKSNYYNRLMGKPIVRN-PAEK 966

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 60/77 (77%), Gaps = 5/77 (6%)

Query: 7   GSSDPRKQDS---DVNHPSSSNY--RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKV 61
            SS   K DS    +   +S NY  R++QACDRCRSKKTRCDG++PQCSQCA VGFECKV
Sbjct: 78  SSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKV 137

Query: 62  SDKLIRKAYPRGYTESI 78
           SDKL RK+YPRGYTE++
Sbjct: 138 SDKLQRKSYPRGYTETL 154

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 105/222 (47%), Gaps = 53/222 (23%)

Query: 1065 TTMMMLLNNEIPFSSIN-------------SNTGESGVNKQNANATENDNVETI--NFKQ 1109
            +TMMML+NNEIPFSS+N             ++   +G++  + N+ E  N   +  N   
Sbjct: 1285 STMMMLINNEIPFSSVNLSELLKPSESKTSNDNASNGISANSHNSLEFGNTLKLNQNGNS 1344

Query: 1110 DLTNKNESGNMLS----------TENYLSDFSYIIDGSLGLAPLLA-----NPFKPTGEN 1154
            ++T    S N +           T+  + D++Y +D SLGLAPLL      N F P    
Sbjct: 1345 NVTTNGTSMNQVEIPSTLIADSLTDTPIPDYNYFVDASLGLAPLLETQRRHNSF-PETSQ 1403

Query: 1155 NLVNVSSIETTGQCINPKVLSSQSSDANKDDTDLNLEN----------GAVQRRPRRYNG 1204
             LVN S+    G        +S SS AN ++T  ++ N           + +++PR    
Sbjct: 1404 PLVNTSNAMNLGN-------ASLSSTANNNNTMPSIANNVGYNNPPLLSSSKQKPRHLPT 1456

Query: 1205 NFGLGGTGMNSNFSVSDL-LRPDDQKKREKETLNDLFNWQNS 1245
            N    G  +N N  +S+L  R D ++KR  E L DLF+WQNS
Sbjct: 1457 ND--TGDILNFNGDLSNLNFRRDVRRKR--ENLEDLFSWQNS 1494

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/28 (67%), Positives = 25/28 (89%)

Query: 941  EFAEALQVDPILNSDYYQFSNLDLATLF 968
            +FA+ALQ DPILNS+ + FSNLDL++LF
Sbjct: 1095 QFADALQFDPILNSNSFNFSNLDLSSLF 1122

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  537 bits (1383), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 326/783 (41%), Positives = 449/783 (57%), Gaps = 78/783 (9%)

Query: 243 HVCDGICCTDKLHP----QPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLA 298
           H C G+ C    HP    +PV+T+ +DP +ISFEQ+EAPGL A KAL ++ N E + QLA
Sbjct: 203 HKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLA 262

Query: 299 ILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDN 358
            LV+LSVPRST+EILFIPQLLA++ QVHG TSKQCLY+                  L ++
Sbjct: 263 YLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLAA------------LKES 310

Query: 359 SQNSLL-------LKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYF 411
           SQ S         LK+ ++W+I+D   FF    KFN+++ SK +  L+  +I++L ++YF
Sbjct: 311 SQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTS-SKDAECLTISEIEELISIYF 369

Query: 412 NHWSNLIPVLXXXX-----------XXXXXXXXKIQCQSFIQGNQSNNLRDYKFFGCFLM 460
                LIPVL                       K    SF Q ++S +   YK F C L+
Sbjct: 370 GECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSIS---YKIFACILL 426

Query: 461 VMCQMGLLIKLKEHK--SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLF 518
           V+CQ GL+ K+K  +  + N    +++YY      L  NP +    TSI+++QLL+LLLF
Sbjct: 427 VICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSIQTLQLLSLLLF 486

Query: 519 YHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYL 578
           Y+LN+G +  +YE+RG ++SMA QLRLHRCPSAVL   GSTM K EQ +RRLLFW IYYL
Sbjct: 487 YYLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYL 546

Query: 579 DVFSSLQLGVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVL 637
           DVF +LQLGVPRLLKD+EIECALP+ ++     ++    IKLEG VS++SL+L RF+K+L
Sbjct: 547 DVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKIL 606

Query: 638 GNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLD----- 692
           GNI+DSIFKR M++S ++QVALIHENALDNWR  LP+   F+LDVNGTI + +L      
Sbjct: 607 GNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQN 666

Query: 693 ----TEN--SDTIFLIVFYFLAKCMIHLPVCSTKVDL-------EDKVTETGNDVIYNDR 739
               T+N  SD   L++ YFL KC++HLPV + K  L       +D      +     DR
Sbjct: 667 NQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFDDASSGADR 726

Query: 740 FSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFID 799
            S+SYV LQQ+TNT L+     + ++LP+  ++ R   RF L+SA+G L+Y KGG+LF D
Sbjct: 727 SSSSYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQD 786

Query: 800 NKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEKIEXXXXXXXXX 859
           NK LLL+ V+++EA++KL+LPG +SWHS            Q   TK +K++         
Sbjct: 787 NKALLLEVVKELEASKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNY 846

Query: 860 XXXXMGKPLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELENDINSLHPILIDNEGVTPSD 919
               MG+  + +        + K   ND  S+      L ++ N+     I  E +  S 
Sbjct: 847 YNKLMGRSTLTS------NGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG 900

Query: 920 AAP-----------LIXXXXXXXXXXXXXXXXEFAEALQVDPILNSDYYQFSNLDLATLF 968
             P           +                   AEA  +DP+LN +   FSN DL   F
Sbjct: 901 NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGN--PFSNGDLTAFF 958

Query: 969 NSD 971
           NSD
Sbjct: 959 NSD 961

 Score =  142 bits (358), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 93/148 (62%), Gaps = 20/148 (13%)

Query: 23  SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXX 82
           +SNYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECKVSDKL R+A+PRGYTE++    
Sbjct: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERV 124

Query: 83  XXXXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNK 142
                        CDLK++Q+ LV+KYSSNK +               + ++  +G + +
Sbjct: 125 RELEAENRRLVALCDLKDEQMHLVSKYSSNKRH---------------EPSSTEEGRMLE 169

Query: 143 DRQNDVTTIPNSLPLNISQTNLYLLNQT 170
              N      +   L +S TNLYLLN+T
Sbjct: 170 QLSNS-----DGGSLRVSSTNLYLLNKT 192

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 55/150 (36%), Gaps = 39/150 (26%)

Query: 1130 FSYIIDGSLGLAPLLA------NPFKPTGENN--------LVNVSSIETTGQCINPKVLS 1175
            F + +D SLGLAPLLA       P  P    N        L        T    +P  + 
Sbjct: 1063 FGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVI 1122

Query: 1176 SQSS--------------------DANKDDTDLNLENGAVQRRPRRYNGNFGLGGTGMNS 1215
            SQ S                    D + DDT + +   + +   RR+N + G   T +  
Sbjct: 1123 SQDSNNVHLREQYRSNSFNQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGT--TVITP 1180

Query: 1216 NFSVSDLLRPDDQKKREKETLNDLFNWQNS 1245
            N   SD  R     + E E   DLF WQNS
Sbjct: 1181 N---SDRPRNPPSSESENENYKDLFRWQNS 1207

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score =  488 bits (1255), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 288/705 (40%), Positives = 406/705 (57%), Gaps = 83/705 (11%)

Query: 254 LHPQPVATN--YNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEE 311
           +H +PV +N   +  T +SFEQ+ APGL A KAL S+  +EE+ QLA+LVSL++PRSTEE
Sbjct: 184 VHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEE 243

Query: 312 ILFIPQLLAKIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNSLLLKNTNIW 371
           ILFIPQL+A I++  GF+SKQ LYTV               +    NS +S    + N +
Sbjct: 244 ILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKK-------NLPTPNSNSSDENLSPNYY 296

Query: 372 QINDLNVFFTDLLKFNI-----------SNDSKTST--------LLSFDDIDDLTNLYFN 412
              D   FF ++LKF+I            N+S  ST        LLS+ +I  L ++YF 
Sbjct: 297 VSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFE 356

Query: 413 HWSNLIPVLXXXXXXXXXXXXKIQCQSF------IQGNQSNNLRDYKFFGCFLMVMCQMG 466
            WSN IP+             K +   F      +   +   +   K F   L VMCQM 
Sbjct: 357 CWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMA 416

Query: 467 LLIKLKEHKSNNSLFK------ILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFY 519
           LL +LK+ ++     +      ++ +Y+QL   +  +  + D +TT+++S+QLL+ + FY
Sbjct: 417 LLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFY 476

Query: 520 HLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVL-TGSGSTMQKLEQSNRRLLFWTIYYL 578
            LN+G+I ++Y+LRG +ISMA QLRLHRCPSAVL + SGSTMQK EQ  RRLLFW IYYL
Sbjct: 477 FLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYL 536

Query: 579 DVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLG 638
           DVF SLQLGVPRL+KD+EIECALPV         +    +LEG VS  SL + R+AKVLG
Sbjct: 537 DVFYSLQLGVPRLIKDHEIECALPVS--------EEEDSQLEGRVSDFSLAVIRYAKVLG 588

Query: 639 NIVDSIFKRNM-STSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDT-ENS 696
           NI+DSIFKRNM S + +  +A +HE ALD W++RLPE++ F+L+ NG  N ++L   +NS
Sbjct: 589 NILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNS 648

Query: 697 DTIFL-----IVFYFLAKCMIHLPVCSTKVDLEDKVTETGNDVIYND-----------RF 740
           +   +     ++FYFLAKCMIHLPV +T+    ++  + G     ++           R 
Sbjct: 649 EKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRV 708

Query: 741 STSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDN 800
             SY+ +Q++ +TML  +    + YLP P N+SRT  RF L++A  +++Y+KGGSL+++ 
Sbjct: 709 CPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVET 768

Query: 801 KKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEKIEXXXXXXXXXX 860
           K LL + +  +E  RKLDLPGIISWHS            Q+  TK EK++          
Sbjct: 769 KNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHY 828

Query: 861 XXXMGKPLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELENDINSL 905
              MG      +P  K +N  K N       KK+K  LEN+ + L
Sbjct: 829 NRQMG------IPAMKLSNSRKNN-------KKIK--LENESSQL 858

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 41/57 (71%), Positives = 50/57 (87%)

Query: 22  SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
           S+  YRV QACDRCR KKT+CDG+ PQCSQCA VGFECK+SD+L RK++PRGYTE++
Sbjct: 50  STPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTETL 106

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (48%), Gaps = 13/121 (10%)

Query: 1067 MMMLLNNEIPFSSINSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTEN- 1125
            +M+LLNNE    S++S+  E+ V +   N   ++N   +      +  N  GN   + N 
Sbjct: 992  LMLLLNNE--HKSLSSSL-ENDV-RNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNT 1047

Query: 1126 -YLSDFSYIIDGSLGLAPLLANPFKPTGENNLVNVSSIETTGQCINPKVLSSQSSDANKD 1184
             Y  D  +IID SLGLAPLL+       ENN ++     T  Q  N  +LS++     KD
Sbjct: 1048 LYGGDNDFIIDASLGLAPLLS-------ENNEIHRQHEGTQVQAGNNDILSTRIGFNGKD 1100

Query: 1185 D 1185
            D
Sbjct: 1101 D 1101

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 1172 KVLSSQSSDANKDDTDLNLENGAVQRRPRRY-NGNFGLGGTGMNSNFSVSDLLRPDDQKK 1230
            K LS  +S  + D   L+  + + QRRPRRY N N  LG   +         ++ +    
Sbjct: 1187 KSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNNTLGKDSL--------AMKTEINGG 1238

Query: 1231 REKETLNDLFNWQNS 1245
            R +  L+DLF WQNS
Sbjct: 1239 RNQGNLHDLFQWQNS 1253

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  423 bits (1088), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/477 (47%), Positives = 305/477 (63%), Gaps = 24/477 (5%)

Query: 398  LSFDDIDDLTNLYFNHWSNLIPVLXXXXXXXXXXXXKIQCQS---FIQGNQSNNLR---- 450
            LSF + D++ +L+F+ W +LIP+             K    +   F  G+     R    
Sbjct: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653

Query: 451  DYKFFGCFLMVMCQMGLLIKLKEH--KSNNSLFKILTYYHQLTYILPKNPVYDFATTSIK 508
             YK F C L+ + QMGL+ K+K       + L  ++TYY +    +  NP +   +TSI+
Sbjct: 654  SYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQ 713

Query: 509  SVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNR 568
            S+QLL+LLLFY LN+G+I  IYELRG ++S A QLRLHRCPSAVL G G T+ +++Q  R
Sbjct: 714  SLQLLSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGER 773

Query: 569  RLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDA-IDGTSIKLEGTVSQIS 627
            R+LFW +YYLDVF+SLQLGVPRLLKD+EIECALPV + +     + G  I LEG +S  S
Sbjct: 774  RVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFS 833

Query: 628  LTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTIN 687
            L++ RF+KVLGN++DSIFKR M+ SI+++VAL+HENALDNWR  LP+  +F+LDVNGTIN
Sbjct: 834  LSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTIN 893

Query: 688  L------------NDLDTENSDTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVTETGNDVI 735
            +            ND    N +    +  YFLAK MIH+PV + K  ++  V E  +  I
Sbjct: 894  MDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAI 953

Query: 736  YN--DRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKG 793
                DR S+SY+ LQQ+TNT LN L  +R  YLP+P N+SR  TRF L SA+GSL+Y KG
Sbjct: 954  SRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKG 1013

Query: 794  GSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSXXXXXXXXXXXXQNSNTKPEKIE 850
            G+LF DNK LLL+ ++++E +RKL +PG ISWHS            Q  NTKPEK E
Sbjct: 1014 GALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEE 1070

 Score =  131 bits (329), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 65/85 (76%)

Query: 25  NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXX 84
           +YRV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SDKL R+A+PRGYTE++      
Sbjct: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRE 181

Query: 85  XXXXXXXXXXXCDLKEQQISLVAKY 109
                      CDLKE+Q+ LV+KY
Sbjct: 182 LEAENRRLVALCDLKEEQLRLVSKY 206

 Score =  130 bits (328), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 86/128 (67%), Gaps = 7/128 (5%)

Query: 261 TNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLA 320
            N NDPTSISFEQ +APGL A KAL ++ N E+++QLA LV++S+PR+TEEILF+PQLLA
Sbjct: 382 ANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLA 441

Query: 321 KIRQVHGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNSLLLKNTNIWQINDLNVFF 380
           +I QVHGFTSKQCLYT                  L        LL++ ++W+I+D++ F 
Sbjct: 442 RIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELE-------LLRSKSLWEIDDVDSFL 494

Query: 381 TDLLKFNI 388
           +  L+F+ 
Sbjct: 495 SKGLRFSF 502

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  286 bits (732), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 227/421 (53%), Gaps = 92/421 (21%)

Query: 26  YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXXX 85
           YR+ QACDRCRSKKTRCDG++PQCSQCAAVGFEC++SDKL+RKAYP+GYTES+       
Sbjct: 63  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 86  XXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQ 145
                     CD+KEQQISLV++   + S         ++ N D +C   +K        
Sbjct: 123 EAENKRLLALCDIKEQQISLVSQSRPSTS---------LDSNVDGNCKKELKDA------ 167

Query: 146 NDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMXXXXXXXXXXXXXXXXXXXXKLN 205
                     PLN+S TN+YLLNQT  K +L +G KM                      N
Sbjct: 168 ----------PLNLSSTNIYLLNQTVNK-QLQSG-KMDND-------------------N 196

Query: 206 SNGTIRSPESNTTVSPLESHTKNLKSNIRXXXXXXXXHVCDGICCTDKLHPQPVATNYND 265
           S+  I S  ++ +  P +                   HVCDG+ CT++LH +P +T+ +D
Sbjct: 197 SDAAIDSLAASPSPPPKD-------------------HVCDGVSCTNRLHVKPTSTSLSD 237

Query: 266 PTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQV 325
           PT+ISFEQ+EAPGL A KALKS+   + +TQLA LVSLS+PRSTEEILFIPQLL +IRQ+
Sbjct: 238 PTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQI 297

Query: 326 HGFTSKQCLYTVXXXXXXXXXXXXXXXDFLMDNSQNS----------------LLLKNTN 369
            GF SKQCLYTV                 L   S NS                   ++T+
Sbjct: 298 FGFNSKQCLYTVSLLSSLKNRLPAPSI-LLPSTSTNSKEKNEDKTPNDDSAFLKTFQSTS 356

Query: 370 IWQINDLNVFFTDLLKFNISNDSKT---------STLLSFDDIDDLTNLYFNHWSNLIPV 420
           + +  DL  F    LKF+I + SK          S LLS  +I +L +L+F  WSN +P+
Sbjct: 357 LSEFVDLKKFLIS-LKFDIDSFSKQPEKQANGHDSDLLSLTEIKELLHLFFKFWSNQVPI 415

Query: 421 L 421
           L
Sbjct: 416 L 416

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 9/36 (25%)

Query: 1111 LTNKNESGNMLSTENYLSDFSYIIDGSLGLAPLLAN 1146
            +TN N SG          D+ YI+D SLGLAPLL +
Sbjct: 1255 MTNVNYSG---------VDYDYIVDASLGLAPLLVD 1281

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1445

 Score =  138 bits (348), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (62%), Gaps = 17/145 (11%)

Query: 25  NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIXXXXXX 84
           +YRV QACDRCR+KK RCDG++PQC+QCAAVGFECK+SDKL R+A+PRGYTE++      
Sbjct: 176 SYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRE 235

Query: 85  XXXXXXXXXXXCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDR 144
                      CDLKE+Q+ LV+KYS++K      D   +E+ S  +    I  EL+K  
Sbjct: 236 LEAENRRLVALCDLKEEQLHLVSKYSNSK------DENGVEIPSTEE--EQILHELSKT- 286

Query: 145 QNDVTTIPNSLPLNISQTNLYLLNQ 169
                   N   L +S TNLYLLN+
Sbjct: 287 --------NGGSLRVSSTNLYLLNK 303

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  111 bits (278), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (92%)

Query: 24  SNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
           SN R+ QACDRCRSKKTRCDG++PQCSQCA VGFECK+SDKL RK++PRGYTE++
Sbjct: 73  SNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETL 127

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 1065 TTMMMLLNNEIPFSSINSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTE 1124
            +TMMML+NNEIPFS  N N  E   NK +    +    E    +    N N+   M +  
Sbjct: 1004 STMMMLVNNEIPFS--NLNLSELWNNKLSTEDKDKQGQE----QNQPRNTNDDVGMTN-- 1055

Query: 1125 NYLSDFSYIIDGSLGLAPLL 1144
               S++ Y +D SLGLAPLL
Sbjct: 1056 ---SNYGYFVDASLGLAPLL 1072

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
           R++QACDRCR KK +CDG KP CSQC  V F CK SDKL R+ +PRGYTE
Sbjct: 93  RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGYTE 142

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa]
          {OFF} YJL089W (SIP4) - shows homology to DNA binding
          domain of Gal4p, has a leucine zipper motif and acidic
          region; lexA-Sip4p activates transcription [contig 304]
          PARTIAL
          Length = 201

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%)

Query: 23 SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          S+  R++QACDRCR KK +CDG KP C  C+ + F C+ SDKL R+ +PRGYTE +
Sbjct: 20 SNQARMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGYTEML 75

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
          {ON} weakly similar to uniprot|P46954 Saccharomyces
          cerevisiae YJL089W SIP4 Possibly involved in Snf1p
          regulated transcriptional activation shows homology to
          DNA binding domain of Gal4p has a leucine zipper motif
          and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%)

Query: 3  KKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
          K++ G   P + +  +    +   R +QACDRCR KK +CDG KP CSQC  V F C+ S
Sbjct: 9  KRKYGQPRPPQGEKALLIAKNKKMRQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTS 68

Query: 63 DKLIRKAYPRGYTESI 78
          D+L R+ +PRGYTE +
Sbjct: 69 DRLTRRGFPRGYTEML 84

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 85.5 bits (210), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%)

Query: 25  NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
           N R++QACDRCR KK +CDG KP C+ C+ + F CK SD+L R+ +P+GYTE +
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGYTEML 130

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 38/52 (73%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
           R +QACDRCR KK +CDG KP CS C  +G+ C  SDKL R+ +PRGYTE +
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGYTEML 109

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 42/55 (76%)

Query: 24 SNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          S +RV+QACDRCR KK +CDG+KP+CS C  + F C +S KL R+  P+GYT+++
Sbjct: 8  SKFRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGYTQAL 62

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 84.7 bits (208), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 40/52 (76%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          R +QACDRCR KK +CDG +P C+ C  +G++CK SDKL R+ +PRGYTE +
Sbjct: 24 RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGYTEML 75

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
          similar to uniprot|P46954 Saccharomyces cerevisiae
          YJL089W SIP4 Possibly involved in Snf1p regulated
          transcriptional activation shows homology to DNA
          binding domain of Gal4p has a leucine zipper motif and
          acidic region lexA-Sip4p activates transcription
          Length = 919

 Score = 84.7 bits (208), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 39/52 (75%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          R +QACDRCR KK +CDG KP C+ C  VGF C+ SDKL R+ +PRGYTE +
Sbjct: 24 RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGYTEML 75

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
          similar to uniprot|P46954 Saccharomyces cerevisiae
          YJL089W SIP4 Possibly involved in Snf1p regulated
          transcriptional activation shows homology to DNA
          binding domain of Gal4p has a leucine zipper motif and
          acidic region lexA-Sip4p activates transcription
          Length = 862

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%)

Query: 23 SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          S + R++QACDRCR KK +CDG KP C+ C  +GF C+ SDKL R+ +PRGYTE +
Sbjct: 20 SKHARMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGYTEML 75

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%)

Query: 23 SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          SS  R +QACDRCR KK +CDG +P C+ C  +G++C+ SDKL R+ +PRGYTE +
Sbjct: 21 SSVKRSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGYTEML 76

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 5/65 (7%)

Query: 12  RKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
           RKQ + ++ P     R  QACDRCR KK +CD  KP CSQC    F+CK +DKL R+ + 
Sbjct: 107 RKQIASIDKP-----RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFS 161

Query: 72  RGYTE 76
           RGYTE
Sbjct: 162 RGYTE 166

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 37/52 (71%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
           R + ACDRCR KK RCDG KP CSQC+   F C  SDKL R+ +P+GYTE +
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGYTEML 105

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 503 ATTSIKSVQLLALLLFYHLNMGNIEQIY-ELRGNIISMAHQLRLHRCPSAVLTGSGSTMQ 561
           ATTS++++Q L L  FY +   N      EL     SM   L L      +   + +T++
Sbjct: 311 ATTSLRNLQCLLLACFYFMGSENHTSFASELLHLAFSMVLDLGLFINSKKLAQLAKATIK 370

Query: 562 KLEQSNRRLLFWTIYYLDVFSSLQLGVPR 590
                 R + FWT  +LD + SL  G P+
Sbjct: 371 ---HDQRIVTFWTFQFLDSWWSLIQGFPK 396

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
          (REAL)
          Length = 829

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          R   ACDRCR KK RCDG KP CS C  + F CK SDKL R+  P+GYTE
Sbjct: 41 RKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGYTE 90

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6
          zinc cluster transcriptional activator that binds to
          the carbon source-responsive element (CSRE) of
          gluconeogenic genes; involved in the positive
          regulation of gluconeogenesis; regulated by Snf1p
          protein kinase; localized to the nucleus
          Length = 829

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          R   ACDRCR KK +CDG KP CS CA + F CK SDKL R+  P+GYTE
Sbjct: 41 RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGYTE 90

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
          (REAL)
          Length = 833

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          R   ACDRCR KK +CDG KP CS C+ + F CK SDKL R+  P+GYTE
Sbjct: 41 RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGYTE 90

>Suva_6.161 Chr6
          complement(283370..284500,284547..284764,
          284948..285781,285812..286127) [2499 bp, 832 aa] {ON}
          YJL089W (REAL)
          Length = 832

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 6/62 (9%)

Query: 21 PSSSN------YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          PS++N       R   ACDRCR KK +CDG KP CS C  + F CK SDKL R+  P+GY
Sbjct: 29 PSTANAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

Query: 75 TE 76
          TE
Sbjct: 89 TE 90

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON}
          Anc_1.277 YJL089W
          Length = 1072

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 38/53 (71%)

Query: 26 YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          +R  QACDRCR KK +CDG KP C+ CA + F CK S KL R+  P+GYTE++
Sbjct: 22 FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGYTEAL 74

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKL R+  P+GYT+
Sbjct: 24 RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGYTD 72

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
           R +QACDRCR KK +CDG  P C+ C  + F C+ + KL R+  P+GYTE
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGYTE 145

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
          {ON} Anc_1.277
          Length = 932

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 1  MVKKEPGSSD---PRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGF 57
          +V  EP +++    RK    V    S   +  QACDRCR KK +CD R P C+ C   G 
Sbjct: 11 LVDSEPNANNLQKKRKNSGQVFVQDSIFIKRKQACDRCRLKKIKCDDRTPDCTPCMKAGI 70

Query: 58 ECKVSDKLIRKAYPRGYTESI 78
           C+ +++L R+ + +GYTE +
Sbjct: 71 PCRTTERLKRRGFAKGYTEQL 91

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 130/322 (40%), Gaps = 44/322 (13%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLMV-MCQMG--LLIKLKEHKSNNSLFKILTYYH 488
           +  +SF+ G   +  NN  D ++    L+  MC +G  L+ +L+E+           YY 
Sbjct: 405 VHRESFLYGFFNHAKNNYEDSEYCSIELIYSMCAIGSRLVPELQEYSE--------IYYE 456

Query: 489 QLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRC 548
           +   IL K    D  T  I +VQ L  L FY L  GN +  +   G  I + +++     
Sbjct: 457 KSKTILLKLVFDDDNTAHITTVQALFCLAFYELGKGNNQLSWYFSGLAIRVGYEMGFQLD 516

Query: 549 PSAVLTGSGSTMQKLEQSN---RRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDN 605
           P    T   +   KL +S    R  ++W  Y  D F  L LG             L V N
Sbjct: 517 PQVWYTDDENDNVKLTKSELEIRSRIYWGCYIADHFICLMLGK---------TSTLSVSN 567

Query: 606 TTTMDA-----IDGTS-IKLEGT-VSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVA 658
           +T  ++     +DGT   +  G  + QISL L     +L  IV+    +    +    + 
Sbjct: 568 STIPESDELPEVDGTEDFRFVGKHILQISLPLKNLI-ILSRIVEIFTSKIFIETDEINLK 626

Query: 659 LIHENALD----NWRSRLPEQFQFKLDVNGTINLNDLDTENSDTI-FLIVFYFLAKCMIH 713
           L++    +    NWR  LP+  ++  D+     + D D     TI +    Y+L + + +
Sbjct: 627 LMYLQNFNLKVYNWRQSLPDLLKWSNDL-----IQDQDVSTDPTISYFWYHYYLVRLIFN 681

Query: 714 LPVCSTKVDLEDKVTETGNDVI 735
            P      +  + V E   D+I
Sbjct: 682 KPFMEDNEESRNVVIEVIEDLI 703

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 21  PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
           PS++  +   AC  CR ++ +CD + P C  C      C ++++ +R+
Sbjct: 83  PSTTGVKRRLACSSCRRRRKKCDMQYP-CGNCVHYKDSCNINEEDMRR 129

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 84/173 (48%), Gaps = 8/173 (4%)

Query: 509 SVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNR 568
           S+Q + +LLF+      +   Y   G  +  A +   HR     +  + +T+  +E   R
Sbjct: 418 SIQTIIILLFFCQCSARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEMR 473

Query: 569 RLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEG-TVSQIS 627
           + +F+TIY LDV+ +  +G+PR L + + +  LP++ +      +G   + EG  +S IS
Sbjct: 474 KRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPIEISDECITENGYLSEQEGQQLSSIS 533

Query: 628 LTLF--RFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQFQ 677
           +  +  +   +L +IV  ++  +  + SI+    +  EN L  W   LP + +
Sbjct: 534 IANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHELK 586

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG+ P C  C    ++C
Sbjct: 67 RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 113/291 (38%), Gaps = 43/291 (14%)

Query: 435 IQCQSFIQGNQSNNLRDY-KFFGC---FLMVMCQMG-LLIKLKEHKSNNSLFKILTYYHQ 489
           +  +SF+ G    +  DY + + C    +  MC +G  L K  EHKS         YY Q
Sbjct: 330 VHRESFLYGFFMEDNDDYGESYYCSKELVYAMCAIGSRLSKKLEHKSE-------YYYEQ 382

Query: 490 LTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCP 549
               L K    + +   I +VQ L  L FY L  GN +  +   G  + + + +     P
Sbjct: 383 CKTSLLKAVFDEHSVAKITTVQALFCLAFYELGKGNNQLAWYFSGLAVRVGYDMGFQLDP 442

Query: 550 SAVLTGSGSTMQKLEQSN---RRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNT 606
                 S  T Q L +S    R  ++W  Y  D F  L LG             L V N+
Sbjct: 443 EGWY--SDDTSQPLTRSELEIRSRIYWGCYIADHFICLMLGRTS---------TLNVSNS 491

Query: 607 TTMDA-----IDGT-SIKLEGT-VSQISLTLFRFAKVLGNIVD----SIFKRNMSTSISR 655
           T  ++     + GT   + EG  V QISL L     VL  IV+     IF     T    
Sbjct: 492 TIPESDELPEVTGTEEFRFEGKHVLQISLPLKNLI-VLSRIVEVYTSKIFIETEETDQKV 550

Query: 656 QVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYF 706
           Q   I  + + NWR  LP    +        +LND++     T+    +Y+
Sbjct: 551 QYLAIFNSQVANWRESLPSFLNW-----SKSSLNDIEVSTDPTLSHFWYYY 596

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
          AC  CR ++ +CD   P C  C+ +G EC ++++ +RK
Sbjct: 50 ACSNCRKRRKKCDVEYP-CGGCSRLGLECNINEEDLRK 86

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 100/232 (43%), Gaps = 35/232 (15%)

Query: 471 LKEHKSNNSLFKIL------------TYYHQLTYILPKNPVYDFA-TTSIKSVQLLALLL 517
           +K+ K+ + +F +L            +Y   L Y      + DF     I S+Q + ++ 
Sbjct: 191 IKQRKAESLIFAVLAVGELFSQEENNSYSRGLNYFNKAKTLIDFKDINDIHSIQAIFMMT 250

Query: 518 FYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYY 577
            +    G+++  Y   G  + +A +  LHR PS  LTG  +    +E   ++ LFW+IY 
Sbjct: 251 IFLQCSGDLKACYYYIGIALRIAIRENLHRKPS--LTGPTA----IEDETKKRLFWSIYK 304

Query: 578 LDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDG----------TSIKLEGTVSQIS 627
           +D++ +  LG+P  L +  I+  LP D        DG          +S  +    +++ 
Sbjct: 305 VDIYMNCTLGLPASLNESFIDQELPYDVDDEKIVSDGVIFNENSNIISSCGMNNEHTKLI 364

Query: 628 LTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFK 679
           L + +  + L +I   I K      I   V L  E+ L  W + LP Q + +
Sbjct: 365 LIMLKIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQLKHR 410

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 15 DSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          DS     + +  RV +AC  CR KK RCDG+ P CS CA     C+ ++     A PR +
Sbjct: 15 DSKTKKLTPTRLRVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTN----TARPRSH 69

Query: 75 T 75
          +
Sbjct: 70 S 70

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 18 VNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          ++ P S   RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 1  MSEPQSKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 77/178 (43%), Gaps = 16/178 (8%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L  +      +   Y   G  +  A +  LHR     LT        +E  
Sbjct: 277 LNSIQTIVMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRN----LTMGAPGFTPIEIE 332

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DNTTTMDAI----DGTSIKL 619
            R+ LF+TIY +D++ +  LG+PR +   + + + P+   D   T D I     G  +  
Sbjct: 333 MRKRLFFTIYKMDIYLNTMLGLPRAISQRDFDQSFPLEIDDEYITEDGIYPERQGDELSS 392

Query: 620 EGTVSQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
            G  +Q +    +   +L NIV  ++  +  +  IS +V    E  L  W ++LP + 
Sbjct: 393 AGIANQHT----KLIMILDNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL 446

>CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337w TEA1
           TY1 enhancer activator
          Length = 816

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 93/221 (42%), Gaps = 30/221 (13%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           I +VQ L  L FY L  GN++  +   G  I + + +     P  V      T +KL QS
Sbjct: 388 ITTVQALFCLAFYELGKGNMQMAWYFSGLAIRVGYAMGFQLDP-KVWHVDDDTDEKLTQS 446

Query: 567 N---RRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDA-----IDGT-SI 617
               R  ++W  Y  D F  L LG             L V N+T  ++     I+GT   
Sbjct: 447 ELEIRSRIYWGCYIADHFICLMLGR---------NSTLSVSNSTIPESDELPEIEGTEEF 497

Query: 618 KLEGT-VSQISLTLFRFAKVLGNIVDSIFKRNM---STSISRQVALIHE--NALDNWRSR 671
           K  G  V Q+SL L     VL  IV  +F   +   S ++  ++  + +    +D W+  
Sbjct: 498 KFVGRHVLQVSLPLKNLI-VLSRIV-QVFTSKIFIESETLEEKLEFLKKFNTQVDYWKHS 555

Query: 672 LPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMI 712
           LPE  Q+    N T+   D+ T+ + + F   +Y +    I
Sbjct: 556 LPEFLQW---TNDTLKDEDITTDPTISYFWYYYYIVQMTFI 593

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 31  ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-YPRGYTESI 78
           AC  CR ++ +CD + P C  C  +G EC ++++ +RK  Y   Y +S+
Sbjct: 75  ACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLRKKRYTNTYVKSL 122

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 983

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 10 DPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          DP KQ+   +H S  N R++  C  CR  KT+CD  KP C++C   G EC
Sbjct: 7  DPYKQEEQNSHSSKRN-RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}
           Anc_7.56 YOR337W
          Length = 710

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 88/220 (40%), Gaps = 28/220 (12%)

Query: 503 ATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLT-----GSG 557
           + TSI +VQ L  L FY L  GN +  +   G  I + +++     P    T     G G
Sbjct: 380 SVTSITTVQALLCLAFYELGKGNNQLAWYFSGLAIRVGYEMGFQLDPEVWYTDADDNGKG 439

Query: 558 STMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTT-----MDAI 612
             + K E   R  ++W  Y  D F  L LG             L V N+T      +  +
Sbjct: 440 K-LTKSELEIRSRIYWGCYIADHFICLMLGR---------TSTLSVSNSTIPASDELPEV 489

Query: 613 DGTS--IKLEGTVSQISLT---LFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDN 667
           +GT     + G V Q++L    L   ++++   +  IF  +   +   +      N + +
Sbjct: 490 EGTEEFRFIGGHVLQVALPLKNLIILSRIVQIFISKIFIESQDNTARLEYLATFNNQVYS 549

Query: 668 WRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFL 707
           WR  LPE   F L     I   D+ T+ + + F   +Y +
Sbjct: 550 WRQSLPE---FLLWSQELIKDEDVSTDPTVSYFWYYYYIV 586

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKV-SDKLIRKAYPRGYTESI 78
          +C  CR ++ +CD   P C  C  +  EC V  D L +K Y  GY +S+
Sbjct: 39 SCSNCRKRRKKCDLGFP-CGNCTRLEIECNVNEDDLRKKRYTSGYVKSL 86

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 78/176 (44%), Gaps = 12/176 (6%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLR--LHRCPSAVLTGSGSTMQKLE 564
           + S+Q + +L  +      +   Y   G  ++M + LR  +HR     L     +   +E
Sbjct: 291 LNSIQAIVMLFIFLQCSARLSTCYTYIG--VAMRNALREGMHRN----LNADTHSYNPIE 344

Query: 565 QSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTV- 623
              R+ LF+TIY +DV+ +  LG+PR +   + + ALP + T      DG   + +G V 
Sbjct: 345 IEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEFITKDGLHFEKQGNVL 404

Query: 624 --SQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
             + I+    +   +L NIV  ++  +  +  IS  V    E  L  W   LP + 
Sbjct: 405 SSAGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 10 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
           RVT+ACD CR KK +CDG++P C  C    +EC  +    R+
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 63/137 (45%), Gaps = 7/137 (5%)

Query: 471 LKEHKSNNSLFKILTYYHQLTYILPKNPVYDFATTS-IKSVQLLALLLFYHLNMGNIEQI 529
           ++ HKS N+  +   Y     Y +    + D      + S+Q + +L  +      +   
Sbjct: 342 MRNHKSTNNFLQDEGY----KYFVAARKLIDITNARDLNSIQTILMLFIFLQCSARLSTC 397

Query: 530 YELRGNIISMAHQLRLHRC--PSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLG 587
           Y   G  +  A +  LHR    + + TG+ S    +E   R+ LF+TIY LD++ +  LG
Sbjct: 398 YSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIYVNAMLG 457

Query: 588 VPRLLKDYEIECALPVD 604
           +PR +   + + +LP D
Sbjct: 458 LPRSISPNDFDQSLPFD 474

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 2  VKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          +K EP    PR+ +    H      RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 14 IKNEPS---PRQTE----HQIVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 5/98 (5%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L  +      +   Y   G  +  A +   HR       G  S    +E  
Sbjct: 352 LNSIQAILMLFIFLQCSARLSTCYAYIGVAMRSALREGYHR-----QVGPLSGFTPIEIE 406

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD 604
            R+ LF+TIY LD++ +  LG+PR +   + +  LP++
Sbjct: 407 MRKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIE 444

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 21/193 (10%)

Query: 492 YILPKNPVYDFA-TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
           Y L      DF+  T I S+Q + ++  +     N++  Y   G  +  A +  LHR  S
Sbjct: 258 YFLEAKKSLDFSNITEIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSS 317

Query: 551 AVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----NT 606
            V    G T   ++   ++ LFW++Y LD++ +  LG P  + + +I+   P+D    N 
Sbjct: 318 IV----GPT--PIQDETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENI 371

Query: 607 TTM-----DAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIH 661
           +TM     D    +S  +    +++ L + R  K++ ++     +R      SR   +  
Sbjct: 372 STMGIKFQDWRTISSCGMNNKHTKLILIMSRIYKLMYSL-----RRKPLEEDSRSQIVSL 426

Query: 662 ENALDNWRSRLPE 674
            + L+NW ++LP+
Sbjct: 427 NDQLENWYTQLPD 439

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
          +D+  N    +  R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 16 RDAGTNELKPTRGRAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 91/205 (44%), Gaps = 34/205 (16%)

Query: 510 VQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRR 569
           +Q    + ++ L++      Y + GN I +A  L +H+  +              ++NR 
Sbjct: 310 IQAFLYVAYFGLSVDKSAFAYVMVGNAIRIAFTLGIHKTSAT------------PKNNR- 356

Query: 570 LLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQISLT 629
            +FW  +  D   +++ G P L+ + EIE    + + ++ D  D  SI LE    +  ++
Sbjct: 357 -IFWLCFLYDRLLAIRFGFPLLINEIEIE----IPSCSSFDT-DFLSISLEKYHFEAQVS 410

Query: 630 LFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLD-------- 681
           L   AK+  NI+  I+ +N S+ +    A++ E  L +W   LP + +F  +        
Sbjct: 411 L---AKITTNIIKRIYTKNSSSFVHNCHAVLKE--LKDWFDGLPSELKFDYNNFSLETSR 465

Query: 682 --VNGTINLNDLDTENSDTIFLIVF 704
             VN  IN N L    + ++   VF
Sbjct: 466 PTVNLHINYNYLIILTTRSVVFYVF 490

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 25 NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVG--FECKVSDKLIRK 68
          N +  +AC+ C+ +K RC G  P C  C  +G    C+   +L +K
Sbjct: 11 NAKSKRACETCKRRKKRCSGGLP-CEYCVKIGNPQGCEYKTRLTKK 55

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON}
          Anc_6.279 YPL248C
          Length = 875

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 13 KQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          K++   +H +SS     QACD CR KK +C   KP C +CA  G+ C  S K  R    R
Sbjct: 5  KEEESRHHANSS---TDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTR 61

Query: 73 GYTESI 78
           +   +
Sbjct: 62 AHLTEV 67

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 82/177 (46%), Gaps = 11/177 (6%)

Query: 505 TSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLE 564
           TSI+++ +L L L +   + N    Y   G  +  A +  LHR     +    S +  L+
Sbjct: 468 TSIQTIIMLFLFLQFSARLSNC---YSYIGIALRNALREGLHR----FVNPKSSNLNPLD 520

Query: 565 QSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGT-SIKLEGTV 623
              R+ +F+TIY  D++ +  LG+P+ L   + +  LPV+ +      +G    K  G V
Sbjct: 521 IEMRKRVFYTIYKCDLYLNSMLGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNGEV 580

Query: 624 SQISLTLF--RFAKVLGNIVDSIFKRNMSTSI-SRQVALIHENALDNWRSRLPEQFQ 677
           S  ++  +  +   +L +I   ++    S +I S +     E  L+NW   LP+Q +
Sbjct: 581 SSAAIANYHTKLMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQLK 637

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    + C
Sbjct: 31 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 91/193 (47%), Gaps = 21/193 (10%)

Query: 492 YILPKNPVYDFA-TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
           Y L      DF+  T I S+Q + ++  +     N++  Y   G  +  A +  LHR  S
Sbjct: 270 YFLEAKNSLDFSNITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRRSS 329

Query: 551 AVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----NT 606
            V    G T   ++   ++ LFW++Y LD++ +  LG P  + + +I+   P+D    N 
Sbjct: 330 IV----GPT--PIQDETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENI 383

Query: 607 TTM-----DAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIH 661
           +T+     D    +S  +    +++ L + R  K++ ++     + +  T I   V+L  
Sbjct: 384 STIGIKFQDWRTISSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRTQI---VSL-- 438

Query: 662 ENALDNWRSRLPE 674
            + LDNW ++LP+
Sbjct: 439 NDQLDNWYAQLPD 451

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
          +D+  N    +  R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 29 RDAGTNELKPTKGRAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa]
          {ON} Anc_5.235
          Length = 890

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 21 PSSSNYRVTQ---ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          PSSS +  ++   AC RCRSKK +CD + P C +CA +   C   D    +  PR Y
Sbjct: 27 PSSSTFNTSKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 31  ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
           AC  C+ ++ RCDG  PQC  C   G +C   DK+  +  PR Y + +
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDYIDRL 113

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%)

Query: 528 QIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLG 587
           Q++ L G  +  A  L LHR P +  + +    Q + Q+ R  +FW  Y ++    + +G
Sbjct: 282 QLWLLAGVAVRTAVSLDLHRKPGSPRSMTHGLEQHVLQNLRSRVFWCAYSIERLIGMTVG 341

Query: 588 VPRLLKDYEIECALP 602
            P  + D +I+  LP
Sbjct: 342 RPFCISDVDIDAPLP 356

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 13 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 79/185 (42%), Gaps = 12/185 (6%)

Query: 504 TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLR--LHRCPSAVLTGSGSTMQ 561
           T  + S+Q + +L  +      +   Y   G  ++M   LR   HR        +   + 
Sbjct: 312 TRDLNSIQTVLMLFIFLQCSARLSSCYTYIG--VAMRSVLREGYHRASDP----NDPNIN 365

Query: 562 KLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSI-KLE 620
            +E   ++ LF+ +Y +D++ +  LG+PR L+  + +  LP++ +      +G    + +
Sbjct: 366 PIELEMKKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDENITAEGYFYERQK 425

Query: 621 GTVSQISLT--LFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQFQ 677
           G +S I+++    +   V   IV  ++  +  +  IS +     E  L  W   LP + +
Sbjct: 426 GELSSIAISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNLPVELR 485

Query: 678 FKLDV 682
              D 
Sbjct: 486 PTTDA 490

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 89/193 (46%), Gaps = 21/193 (10%)

Query: 492 YILPKNPVYDFA-TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
           Y L      DF+  T I S+Q + ++  +     N++  Y   G  +  A +  LHR  S
Sbjct: 282 YFLEAKKSLDFSNITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKDGLHRKSS 341

Query: 551 AVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD------ 604
            V    G T   +E   ++ LFW++Y LD++ +  LG P  + + +I+   P+D      
Sbjct: 342 IV----GPT--PIEDETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENI 395

Query: 605 NTTTMDAIDGTSIKLEGT---VSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIH 661
           +TT +   D  +I   G     +++ L + R  K++ ++     +R      SR   +  
Sbjct: 396 STTGIKFQDWRTISSCGMNNKHTKLILIMSRIYKLMYSL-----RRKPLEEDSRLQIVSL 450

Query: 662 ENALDNWRSRLPE 674
            + LD+W ++LP+
Sbjct: 451 NDQLDDWYTQLPD 463

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
          +D+  N    +  R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 40 RDAGTNELKPTRGRAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L  +      +   Y   G  +  A +   HR  S     S S    +E  
Sbjct: 346 LNSIQAILMLFIFLQCSARLSTCYTYIGVAMRSALRAGFHRKLS-----SSSGFSPIEIE 400

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----NTTTMDAI--DGTSIKLE 620
            R+ LF+TIY LDV+ +  LG+PR +   + +  LP+D    N T +  +  +  S+   
Sbjct: 401 MRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLPENQHSVLSS 460

Query: 621 GTVSQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
             +S     LF    +L  I+  ++  +  S  IS +     E  L NW   LP++ 
Sbjct: 461 TGISNEHTKLFL---ILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 514

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L+ +      +   Y   G  +  A +   HR  S       S    +E  
Sbjct: 343 LNSIQAILMLIIFLQCSARLSTCYTYIGVAMRSALRAGFHRKLSP-----NSGFSPIEIE 397

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----NTTTMDAI--DGTSIKLE 620
            R+ LF+TIY LDV+ +  LG+PR +   + +  LP+D    N T +  +  +  S+   
Sbjct: 398 MRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLPENQHSVLSS 457

Query: 621 GTVSQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
             +S     LF    +L  I+  ++  +  S  IS +     E  L NW   LP++ 
Sbjct: 458 TGISNEHTKLFL---ILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 511

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 13/176 (7%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L  +      +   Y   G  +  A +   HR       G+ S    +E  
Sbjct: 344 LNSIQAILMLFIFLQCSARLSTCYTYIGVAMRSALRAGFHR-----KLGTNSGFSPIEIE 398

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQI 626
            R+ LF+TIY LDV+ +  LG+PR +   + +  LP+D   + + I  T+   E   + +
Sbjct: 399 MRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLD--LSDENITETAYLPENQNAVL 456

Query: 627 SLTLF-----RFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
           S T       +   +L  I+  ++  +  S  IS +     E  L NW   LP++ 
Sbjct: 457 SSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 512

>KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.56
           YOR337W
          Length = 691

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 122/306 (39%), Gaps = 54/306 (17%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLM-VMCQMGLLIKLKEHKSNNSLFKILTYYHQL 490
           +  +SF+ G   +  NN  D  +    L+  MC +G        + +  L  +   Y++ 
Sbjct: 270 VHRESFLYGFFNHAKNNYEDSNYCSVELIYAMCAVG-------SRLSPDLQNMSEIYYEK 322

Query: 491 TYILPKNPVYDFATTS-IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCP 549
           + ++  N V+D  + S I +VQ L  L FY L  G+ +  +   G  + + H +     P
Sbjct: 323 SKMMLLNLVFDEDSISRITTVQALLCLAFYELGRGSYQLAWYFSGLAMRVGHDMGFQLDP 382

Query: 550 SAVLTG-SGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTT 608
               T  S   + K E   R  ++W  Y  D F  L LG             L V N+T 
Sbjct: 383 KDWYTDESSGKLTKSELEIRSRIYWGCYIADHFICLMLGR---------TATLSVSNSTI 433

Query: 609 MDA-----IDGT-SIKLEGT-VSQISL------TLFRFAKVLGNIV-----DSIFKRNMS 650
            ++     ++GT   +  G  V QISL       L RF ++  + +     D+I K    
Sbjct: 434 PESDELPEVEGTEEFRFVGKHVLQISLPLKNLIILSRFVQIFTSKIFIESDDTIEKVKYL 493

Query: 651 TSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTI-FLIVFYFLAK 709
              + QV         NWR  LP+  ++  ++     L D D     TI +   +Y++ +
Sbjct: 494 NKFNGQVY--------NWRQSLPDLLKWSKEL-----LEDDDVSTDPTISYFWYYYYIVR 540

Query: 710 CMIHLP 715
              + P
Sbjct: 541 LTFNRP 546

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK-LIRKAYPRGYTESI 78
          AC+ CR ++ +C+   P C  C  +  +C ++++ L RK Y   Y +S+
Sbjct: 46 ACNNCRKRRKKCNLAYP-CDGCVRLKLKCNINEEDLRRKRYTNAYVKSL 93

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 34 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 65

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 9/180 (5%)

Query: 506 SIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQ 565
           S+ S+Q + ++  +      +   Y   G  +  A +  LHR       G  S    +E 
Sbjct: 374 SLDSIQAILMMFIFLQCSARLSTCYSYIGVAMRSALREGLHR-----QVGPNSGFNPIEI 428

Query: 566 SNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTV-- 623
             R+ LF+TIY LD++ +  LG+PR +   + +  LP++ +       G   + +  V  
Sbjct: 429 EMRKRLFYTIYKLDIYVNAMLGLPRSISANDFDQTLPLELSDENITEQGYFPENQNGVLS 488

Query: 624 -SQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQFQFKLD 681
            + I+    +   +L  IV  ++  +  +T IS +     E  L NW   LP +    L+
Sbjct: 489 STGIANEHTKLLMILDAIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNELAPNLE 548

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa]
          {ON} Anc_6.279
          Length = 960

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%)

Query: 30 QACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          QACD CR KK +C   KP+C++C   G+EC  S K  R    R +
Sbjct: 10 QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 79/177 (44%), Gaps = 15/177 (8%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L  +      +   Y   G  +  A +   HR  SA    SG T  ++E  
Sbjct: 343 LNSIQAILMLFIFLQCSARLSTCYTYIGVAMRSALRAGFHRKLSA---NSGFTPIEIEM- 398

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----NTTTMDAI--DGTSIKLE 620
            R+ LF+TIY LDV+ +  LG+PR +   + +  LP+D    N T +  +  +  ++   
Sbjct: 399 -RKRLFYTIYKLDVYINAMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSS 457

Query: 621 GTVSQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
             +S     LF    +L  I+  ++  +  +  IS +     E  L NW   LP++ 
Sbjct: 458 TGISNEHTKLFL---ILNEIISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKEL 511

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 9  RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 93/224 (41%), Gaps = 30/224 (13%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + LL  +      +   Y   G  +  A +  LHR      + + +   ++E  
Sbjct: 402 LNSIQTIVLLFLFLQCSARLSTSYSYIGVAMRSALREGLHRKIKPDPSKTKTNFIEIEM- 460

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DNTTTMDAI----DGTSIKL 619
            R+ LF+TIY +D++ +  LG+PR +   + +  LP+   D+  T DAI     G  +  
Sbjct: 461 -RKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDAIYPEEQGDVLSS 519

Query: 620 EGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFK 679
            G  +Q +  L    +++ ++       N+   IS Q+    E  L  W  +LP +    
Sbjct: 520 AGIANQHTKILMILDQIMADLYPIKKTNNL---ISHQMVTNLELKLRQWLDQLPPEL--- 573

Query: 680 LDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTKVDL 723
             + G   L D+             Y  A C++HL     ++ L
Sbjct: 574 --IPG---LKDVPER----------YLRANCLLHLSFLQVQIIL 602

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 128/318 (40%), Gaps = 40/318 (12%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLM-VMCQMGLLIKLKEHKSNNSLFKILTYYHQL 490
           +  +SF+ G   +  NN  D  +    L+  +C +G  +    H+ +        YY + 
Sbjct: 344 VHRESFLYGFFNHSKNNYEDSNYCSVELIYAVCAVGSRLTPDLHEYSE------IYYERS 397

Query: 491 TYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
              L +    + +T  I +VQ L  L FY L  GN +  +   G  I + + +     P 
Sbjct: 398 KKTLLQLVFDEQSTARITTVQALFCLAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLDPK 457

Query: 551 A-VLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTM 609
              +  S   + + E   R  ++W  Y  D F  L LG             L V N+T  
Sbjct: 458 VWYIDDSNLQLTQSELEIRSRIYWGCYIADHFICLMLGR---------TSTLSVSNSTMP 508

Query: 610 DA-----IDGT-SIKLEGT-VSQISLTLFRFAKVLGNIVDSIFKRNM---STSISRQVAL 659
           D+     ++GT   +  G  V QISL L     +L  +V  IF   +   S  I+++V  
Sbjct: 509 DSDELPEVNGTEEFRFIGRHVLQISLPLKNLI-ILSRLV-QIFTSKIFIESEDITQKVKY 566

Query: 660 IHE--NALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTI-FLIVFYFLAKCMIHLPV 716
           ++   + + NWR  LPE  Q+   +     + D D     TI +   +Y++ +   + P 
Sbjct: 567 LNTFNSQVYNWRQSLPEFLQWSKTL-----IEDDDVSTDPTISYFWYYYYIVRLTFNKPF 621

Query: 717 CSTKVDLEDKVTETGNDV 734
                + E  V E  +D+
Sbjct: 622 IEDSQESETVVIEIIDDL 639

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 18  VNHP-SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-YPRGYT 75
           +N P ++SN R   AC  CR+++ +CD   P C  C+ +   C V+D+ +RK  Y   Y 
Sbjct: 55  INTPDNASNTRKRLACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLRKKRYTNKYV 113

Query: 76  ESI 78
           +S+
Sbjct: 114 KSL 116

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 15 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 46

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           + S+Q + +L  +      +   Y   G  +  A +  LHR  S       S    +E  
Sbjct: 329 LNSIQTILMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRSVSP-----DSGFSPIEIE 383

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DNTTTMDAIDGTSIKLEGTV 623
            R+ LF+TIY LDV+ +  LG+PR +   + +  LP+   D   T +     + K + + 
Sbjct: 384 MRKRLFYTIYKLDVYVNAMLGLPRSISSNDFDQTLPIELSDENITEEGYFPENQKGKLSS 443

Query: 624 SQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
           ++I+    +   +L  IV  ++  R  +  I  +V    E  L  W   LP + 
Sbjct: 444 AEIANQHTKLIMILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL 497

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa]
          {ON} weakly similar to uniprot|P07272 Saccharomyces
          cerevisiae YLR014C PPR1 Zinc finger transcription
          factor containing a Zn(2)-Cys(6) binuclear cluster
          domain positively regulates transcription of genes
          involved in uracil biosynthesis activity may be
          modulated by interaction with Tup1p
          Length = 775

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 18 VNHPSSSN-YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          V   SS N YR   AC RCR +K +CD + P C++C      C   D   R+  PR Y 
Sbjct: 5  VTKESSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSYV 63

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 10 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 77/176 (43%), Gaps = 12/176 (6%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLR--LHRCPSAVLTGSGSTMQKLE 564
           + S+Q + +L  +      +   Y   G  ++M + LR  +HR     L         +E
Sbjct: 322 LNSIQAIVMLFIFLQCSARLSTCYTYIG--VAMRNALREGMHRN----LNTDTHGYSPIE 375

Query: 565 QSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTV- 623
              R+ LF+TIY +DV+ +  LG+PR +   + + ALP + T      DG   + +G V 
Sbjct: 376 IEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEYITEDGLHPEKQGDVL 435

Query: 624 --SQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
             + I+    +   +L NIV  ++  +  +  IS  V    E  L  W   LP + 
Sbjct: 436 SSAGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPEL 491

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {ON}
           weakly similar to uniprot|P39529 Saccharomyces
           cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 17/130 (13%)

Query: 484 LTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQL 543
           L Y+H+        P+ +    ++ SV+ L L+ FY   +  +  +Y   G  +S A   
Sbjct: 267 LKYFHE--------PIEE---PNLDSVRTLILIAFYSQGLNRMNSVYAYTGLALSTAVAQ 315

Query: 544 RLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV 603
            +HR        +     + EQ  R+ ++WT + +D   + +LG+P      +I+  LP 
Sbjct: 316 GIHR------QANNHQFPRAEQEARKKIWWTAFLMDTLWASRLGLPPHFNSCDIDIELPD 369

Query: 604 DNTTTMDAID 613
           ++ +T D  D
Sbjct: 370 ESMSTEDGFD 379

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQC 52
          R  +AC RC ++K +C G KP C  C
Sbjct: 12 RSKKACQRCSAQKVKCLGEKPPCRAC 37

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
          {ON} Anc_7.17
          Length = 1059

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 26 YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          YR++  C  CR  KT+CD  KP CS+C  +G  C
Sbjct: 47 YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CDG++P C  C    +EC
Sbjct: 32 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 75/175 (42%), Gaps = 13/175 (7%)

Query: 509 SVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNR 568
           S+Q + +L  +      +   Y   G  +  A +   HR       G  S +  LE   R
Sbjct: 377 SIQTVLMLFIFLQCSARLSTCYAYIGVAMRSALREGFHR-----KVGPESDLSPLEIEIR 431

Query: 569 RLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DNTTTMDAIDGTSIKLEGTVSQ 625
           + LF+TIY LDV+ +  LG+PR +   + +  LP+   D   T  A      + +G++S 
Sbjct: 432 KRLFYTIYKLDVYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAY--YPEREDGSLSS 489

Query: 626 ISLT--LFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQFQ 677
             +     R   +L  I+  ++  +  +  IS +     E  L +W + LP + +
Sbjct: 490 TGIANCHTRLIMILDTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPAELK 544

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 90/193 (46%), Gaps = 21/193 (10%)

Query: 492 YILPKNPVYDFA-TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
           Y L      DF+  T I S+Q + ++  +     N++  Y   G  +  A +  LHR  S
Sbjct: 291 YFLEAKRSLDFSNITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSS 350

Query: 551 AVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----NT 606
             +TG  +    ++   ++ LFW++Y LD++ +  LG P  + + +I+   P+D    N 
Sbjct: 351 --ITGPTA----IQDETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENI 404

Query: 607 TTM-----DAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIH 661
           +TM     D    +S  +    +++ L + R  K++ ++     +R      SR   +  
Sbjct: 405 STMGIKFQDWRMISSCGMNNEHTKLILIMSRIYKLMYSL-----RRKPLEEDSRLQIVSL 459

Query: 662 ENALDNWRSRLPE 674
            + L+NW ++LP+
Sbjct: 460 NDQLENWYAQLPD 472

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          +D+  N    +  R  +AC  CR +K RC G+ P C  C     EC
Sbjct: 49 RDAGTNELKPTRGRAHRACMACRKRKVRCSGQIP-CRFCHTNKLEC 93

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646
          bp, 881 aa] {ON} complement(81534..83840,83842..84180)
          [2646 nt, 882 aa]
          Length = 881

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)

Query: 24 SNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          SN    Q CD CR KK +C   KP+C +C    +EC  S K+ R    R +
Sbjct: 2  SNIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
          GAL4DNA-binding transcription factor required for the
          activation of the GAL genes in response to galactose;
          repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          + QACD CR KK +C   KP+C++C    +EC+ S K  R    R +
Sbjct: 7  IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
          (REAL)
          Length = 878

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          + QACD CR KK +C   KP+C++C    +EC+ S K  R    R +
Sbjct: 7  IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
           some similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 101/243 (41%), Gaps = 43/243 (17%)

Query: 468 LIKLKEHKSNNSLF--------KILTYYHQLTYILPKNPV--YDFATTSIKSVQLLALLL 517
           L++L  H +  SLF         +   YH+ T +L    V  YD A ++   + LL  + 
Sbjct: 243 LLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSELVKTYDCAASTSLILSLL-YMA 301

Query: 518 FYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYY 577
           ++ L++      + + G+ I     L LH+    ++             NR  +FW  + 
Sbjct: 302 YFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIV------------ENR--VFWLCFI 347

Query: 578 LDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVL 637
            D   +++ G P ++ +  I   L    T   D +   S+ +   VSQ+     R AK+ 
Sbjct: 348 YDRLLAVRFGFPLMIDERNINIPLL---TEVDDNLTAVSLDIYHFVSQV-----RLAKIT 399

Query: 638 GNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSD 697
             I+  I+ RN  + +    A++ +  L NW   LP + +F        + ND+ T  + 
Sbjct: 400 TQIITKIYTRNPYSFLHNCHAVLKQ--LKNWFESLPAELKF--------DYNDIKTATTR 449

Query: 698 TIF 700
           + F
Sbjct: 450 STF 452

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 101/243 (41%), Gaps = 43/243 (17%)

Query: 468 LIKLKEHKSNNSLF--------KILTYYHQLTYILPKNPV--YDFATTSIKSVQLLALLL 517
           L++L  H +  SLF         +   YH+ T +L    V  YD A ++   + LL  + 
Sbjct: 243 LLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSELVKTYDCAASTSLILSLL-YMA 301

Query: 518 FYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYY 577
           ++ L++      + + G+ I     L LH+    ++             NR  +FW  + 
Sbjct: 302 YFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIV------------ENR--VFWLCFI 347

Query: 578 LDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVL 637
            D   +++ G P ++ +  I   L    T   D +   S+ +   VSQ+     R AK+ 
Sbjct: 348 YDRLLAVRFGFPLMIDERNINIPLL---TEVDDNLTAVSLDIYHFVSQV-----RLAKIT 399

Query: 638 GNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSD 697
             I+  I+ RN  + +    A++ +  L NW   LP + +F        + ND+ T  + 
Sbjct: 400 TQIITKIYTRNPYSFLHNCHAVLKQ--LKNWFESLPAELKF--------DYNDIKTATTR 449

Query: 698 TIF 700
           + F
Sbjct: 450 STF 452

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa]
          {ON} similar to uniprot|P04386 Saccharomyces cerevisiae
          YPL248C GAL4 DNA-binding transcription factor required
          for the activation of the GAL genes in response to
          galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          V QACD CR +K RC    P+CS+C    +EC  S K +R    R
Sbjct: 5  VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIR 67
          +VT+ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15 KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 54/118 (45%), Gaps = 4/118 (3%)

Query: 563 LEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DNTTTMDAIDGTSIKL 619
           LE   R+ LF+TIY LDV+ +  LG+P  L   + +  LP+   D   T   I+      
Sbjct: 399 LEIEMRKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDLPDEALTEQGINYDQNPY 458

Query: 620 EGTVSQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQF 676
             + + I+    +   +LG+I+  ++  + ++  IS +     E  L  W   LP + 
Sbjct: 459 SLSSTGIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPREL 516

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa]
          {ON} similar to uniprot|P07272 Saccharomyces cerevisiae
          YLR014C PPR1 Zinc finger transcription factor
          containing a Zn(2)-Cys(6) binuclear cluster domain
          positively regulates transcription of genes involved in
          uracil biosynthesis activity may be modulated by
          interaction with Tup1p
          Length = 898

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          R   AC+RCR+KKT+CD   P C++CA++G  C   D    +   R Y 
Sbjct: 48 RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSYV 96

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa]
          {ON} YLR014C (REAL)
          Length = 906

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 11 PRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAY 70
          P+K DS    P+    +   AC RCR KK +CD   P C +CA +   C   D    K  
Sbjct: 17 PKKGDS----PNIGISKSRTACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDV 72

Query: 71 PRGY 74
          PR Y
Sbjct: 73 PRSY 76

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          RV +AC+ C+ +K +CDG +P C+ C   G ECK     +R+ Y R
Sbjct: 12 RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
          YOR363C
          Length = 948

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIR 67
          R++  C  CR+ K +CD  KPQC +C  +G EC V D +I+
Sbjct: 24 RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC-VYDTIIQ 63

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 97/225 (43%), Gaps = 33/225 (14%)

Query: 559 TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIK 618
           T+ K E  + R L+WT+Y  +   S + G+P    DY I  ALP D       ID  +I 
Sbjct: 501 TLTKYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPAD-------IDDETI- 552

Query: 619 LEGTVSQISLTLFRFAKVLGN----------IVDSIFKRNMSTSISRQVALIHENALDNW 668
            EG  +Q    +FR A+++ N          I+  +++R   T+I   + ++ +  L+ W
Sbjct: 553 -EGKNNQY---VFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLLE-W 607

Query: 669 RSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVT 728
           R+ L +  Q    V+ T    D       T  +   YF    +   P+      ++ K  
Sbjct: 608 RNNLSDSLQ----VDFTQKDEDFKISRLSTN-MFTEYFQGINLAIRPLLFHFASIQLKRF 662

Query: 729 ETGNDVIYNDRFSTSY-----VSLQQSTNTMLNALRMIRDKYLPM 768
           +T N  I    +ST+       SL  S NT+ +   ++++  L M
Sbjct: 663 KTSNTFINLQNYSTTISSLLTCSLHASVNTIRSLWSLLQNNMLAM 707

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 27 RVTQACDRCRSKKTRCD--GRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          + ++ACD+CR KKTRCD    +P CS C  +G  C      +++   +GYT
Sbjct: 30 KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGYT 80

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON}
          Anc_5.235
          Length = 889

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%)

Query: 13 KQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          K D+D+    +   +   AC RCR KK +CD   P CS+CA +   C   D    +  PR
Sbjct: 3  KDDTDMKLNRTGMSKPKTACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPR 62

Query: 73 GY 74
           Y
Sbjct: 63 SY 64

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 91/235 (38%), Gaps = 35/235 (14%)

Query: 452 YKFFGCFLMVMCQMGLLIKLKEHKSNNSLFKILTYYHQLTYILPKNPVYDFATTS-IKSV 510
           Y F      +   M +LI         S+  ++TY  +  Y  P      F TT  ++++
Sbjct: 366 YYFLNMVFSIGLGMQVLIA--------SVKTVVTYKRRAYYYSPSV----FITTDRLEAL 413

Query: 511 QLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRL 570
               L + Y L   N+  ++   G ++ +   L LH         +   +       RR 
Sbjct: 414 TGTVLTVEYALMRPNVPGVWYAMGTVLRLTVDLGLH------TEKTNHNLDPYIIDLRRR 467

Query: 571 LFWTIYYLDVFSSLQLGVPRLLKDYEIECALP--VDNTTTM---DAIDGTS--IKLEGTV 623
           +FWT+Y LD       G P  + +  I   LP  +D+   +    A+   S  I  E T 
Sbjct: 468 MFWTVYSLDRQICSYFGRPFGIPEENISTRLPSLLDDAYIVPNNHAVTDYSNVINSEPTT 527

Query: 624 SQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENA-LDNWRSRLPEQFQ 677
             ++ ++    K+  +IV  ++        +    L  EN   DNWR+ + E+ +
Sbjct: 528 KVVAHSMIEVRKIQADIVRILY--------APHAELPRENEDFDNWRASIDERLE 574

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa]
          {ON} Anc_6.279
          Length = 935

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 30 QACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          QACD CR KK +C   KP+C++C    +EC  S K  R    R +
Sbjct: 11 QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRK--PQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          +V++ACD+CR KK +CD  +  P CS C  VG  C      +++   +GYT+
Sbjct: 31 KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGYTK 82

>TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa]
           {ON} Anc_1.128 YJL206C
          Length = 657

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 17/182 (9%)

Query: 505 TSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLE 564
           +S+  +Q L +L  Y+ ++ +++  Y   G  +  +  LRL+       +   + +  LE
Sbjct: 187 SSLIDIQTLFMLSMYYQSIAHLKNSYSFIGIALRSSILLRLNN-----ESNRKTDLITLE 241

Query: 565 QSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DNTTTMDAIDGTSIKLEG 621
              R  LFWTIY +D++ +  L +P  L    I    P+   DN    D+ID  + +   
Sbjct: 242 TEKR--LFWTIYKVDLYLNCILELPLTLSLRNINQLFPIDVDDNLIHKDSIDLIN-QPPD 298

Query: 622 TVSQISLTLF--RFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFK 679
            +S I L  +  R   ++  I DS +  N ST  S+ V+ + E +L  W++ LP   Q K
Sbjct: 299 KISSIGLNNYHTRLIIIMSQIHDSFY--NTSTP-SKNVSQLKE-SLQAWKTSLPNFLQLK 354

Query: 680 LD 681
            D
Sbjct: 355 FD 356

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON}
          similar to uniprot|P07272 Saccharomyces cerevisiae
          YLR014C PPR1 Zinc finger transcription factor
          containing a Zn(2)-Cys(6) binuclear cluster domain
          positively regulates transcription of genes involved in
          uracil biosynthesis activity may be modulated by
          interaction with Tup1p
          Length = 906

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          R   AC RCR KK +CD + P CS+CA+    C   D    +  PR Y
Sbjct: 38 RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 3  KKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
          K  PG    +K       PS+   +V +ACD CR +K +C+G KP C  C   G EC  +
Sbjct: 9  KSNPGEVKAQK-------PSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYT 60

Query: 63 D 63
          D
Sbjct: 61 D 61

>YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1
           enhancer activator required for full levels of Ty
           enhancer-mediated transcription; C6 zinc cluster
           DNA-binding protein
          Length = 759

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 132/321 (41%), Gaps = 46/321 (14%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLM-VMCQMG--LLIKLKEHKSNNSLFKILTYYH 488
           +  +SF+ G   +  NN  D  +    L+  MC +G  L   L+E+           YY 
Sbjct: 344 VHRESFLYGFFNHSKNNYEDSSYCSVELIYAMCAVGSRLTPDLQEYSE--------VYYQ 395

Query: 489 QLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRC 548
           +    L +    + +T  I +VQ L  L FY L  GN +  +   G  I + + +     
Sbjct: 396 RSKKTLLQLVFDEQSTARITTVQALFCLAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLD 455

Query: 549 PSAVLTGSGS---TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDN 605
           P        +   T  +LE  +R  ++W  Y  D F  L LG             L V N
Sbjct: 456 PKVWYVDDNNLQLTQSELEIRSR--IYWGCYIADHFICLMLGR---------TSTLSVSN 504

Query: 606 TTTMDA-----IDGT-SIKLEGT-VSQISLTLFRFAKVLGNIVDSIFKRNM---STSISR 655
           +T  ++     ++GT   +  G  V QISL L     +L  +V  IF   +   S  I+R
Sbjct: 505 STMPESDELPEVNGTEEFRFIGRHVLQISLPLKNLI-ILSRLV-QIFTSKIFIESEDIAR 562

Query: 656 QVALIHE--NALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIH 713
           ++  ++   + + NWR  LPE  Q+   +   I  +D+ T+ + + F    Y++ +   +
Sbjct: 563 KLKYLNTFNSQVYNWRQSLPEFLQWSKTL---IENDDVSTDPTISYFWYC-YYIVRLTFN 618

Query: 714 LPVCSTKVDLEDKVTETGNDV 734
            P      + E  V E  +D+
Sbjct: 619 KPFIEDSQESETVVIEIIDDL 639

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-YPRGYTESI 78
           R   AC  CR+++ +CD   P C  C+ +   C V+D+ +RK  Y   Y +S+
Sbjct: 65  RKRLACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLRKKRYTNKYVKSL 116

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RVT+ACD CR KK +CD R P C  C    +EC
Sbjct: 13 RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 69/156 (44%), Gaps = 22/156 (14%)

Query: 563 LEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGT 622
           LEQ  R+ LF+T+Y ++VF +  LG+P  L   + + +LP++ +    +  G   + +  
Sbjct: 357 LEQEMRKRLFYTLYKMEVFVNTMLGLPSSLSKDDYDQSLPLEISDKYISDSGIHAEQQRD 416

Query: 623 V---SQISLTLFRFAKVLGNIVDSIFK-RNMSTSISRQVALIHENALDNWRSRLPEQFQF 678
           +   S ++    +   ++  I   ++  +     IS +V    E  L +W  +LP +   
Sbjct: 417 ILSSSGVANQHTKLIMIMEEIAAQLYPVKRTGKFISHKVISALELKLRSWLDQLPAEL-- 474

Query: 679 KLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHL 714
              V G   L D+             Y++A  M+HL
Sbjct: 475 ---VPG---LKDVPER----------YYMANRMLHL 494

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
          to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
          DNA-binding transcription factor required for the
          activation of the GAL genes in response to galactose
          repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          +  ACD CR KK RC   +P+C++C   G+EC  S K  R    R +   +
Sbjct: 7  IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAHMTKV 57

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 63/137 (45%), Gaps = 11/137 (8%)

Query: 491 TYILPKNPVYDFA-TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCP 549
           +Y L    + D    T + S+Q + +L  +    GN+++ Y   G  +  A    LHR  
Sbjct: 169 SYFLAAKSMLDVTNITDVYSIQTMFMLTMFLQCSGNLKRCYSYMGIALRAAIAEGLHRKS 228

Query: 550 SAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVD----N 605
           S +    G T   +E  +++ LFWT+Y +D++ +  +G+P+ +    +   LP D    N
Sbjct: 229 SLM----GPT--PIEDESKKRLFWTVYKVDIYMNCIMGLPQSISQKTVNMELPKDLDDEN 282

Query: 606 TTTMDAIDGTSIKLEGT 622
            T    ID    KL  T
Sbjct: 283 ITNQGCIDQPWGKLSST 299

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK 64
          RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23 RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 15 DSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          D   N       RV++ACD CR +K RCDGR+P C  C    + C
Sbjct: 15 DQSTNRLQPKRLRVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 504 TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKL 563
            T + ++Q + +L  +      +   Y   G  +  A    LH      ++ +G +  + 
Sbjct: 335 ATDVYAIQTVFMLTIFLQCSAKLTTCYSYIGVALRAAITQGLH----TKVSTAGKSPVEA 390

Query: 564 EQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEI 597
           E   R  LFWTIY +DV+ +  LG+PR + + ++
Sbjct: 391 ETCKR--LFWTIYKMDVYMNCILGLPRSISEEDV 422

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
          (REAL)
          Length = 1046

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 2  VKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          ++ E  S+ P  ++S+  H    N R++  C  CR  KT+CD  KP+CS+C   G +C
Sbjct: 38 LEAEHSSTSPAPENSET-HNRKRN-RISFVCQACRKSKTKCDREKPECSRCIKHGLKC 93

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 7  GSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          G   P K  +D        YR++  C  CR  K +CD  KP CS+C+    EC
Sbjct: 15 GPQSPSKSINDSQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON}
           (22248..24344) [2097 nt, 699 aa]
          Length = 698

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 122/318 (38%), Gaps = 40/318 (12%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLM-VMCQMGLLIKLKEHKSNNSLFKILTYYHQL 490
           +  +SF+ G   +  NN RD ++    L+  +C +G   +L E   + S      YY + 
Sbjct: 271 VHRESFLYGFFNHAENNYRDSQYCSTELIYAVCAIG--SRLSEDLQDLSE----VYYEKC 324

Query: 491 TYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
              L +    + +   I +VQ L  L FY L  GN +  +   G  I + + +     P 
Sbjct: 325 KKALLEIVFDETSVACITTVQALFCLAFYELGKGNNQLAWYFSGLAIRVGYDMGFQLDPQ 384

Query: 551 AVLT-GSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTM 609
              T  S   +   E   R  ++W  Y  D F  L LG            +L V N+T  
Sbjct: 385 VWFTDDSNLKLTNSELEIRSRIYWGCYIADHFICLMLGRTS---------SLSVSNSTIP 435

Query: 610 DAIDGTSIKLEGT---------VSQISL---TLFRFAKVLGNIVDSIFKRNMSTSISRQV 657
           ++ +   +  EGT         V QISL    L   ++++      IF     T      
Sbjct: 436 ESDELPEV--EGTEEFRFASRHVLQISLPLKNLIILSRIVQVFTSKIFIETDDTEQKVLY 493

Query: 658 ALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTI-FLIVFYFLAKCMIHLPV 716
                + + NWR  LP+  ++  D+     L D +     T+ +   +Y++ +   + P 
Sbjct: 494 LTKFNSHVSNWRQSLPDFLKWSKDI-----LKDENVSTDPTLSYFWYYYYIVRLTFNKPF 548

Query: 717 CSTKVDLEDKVTETGNDV 734
               ++    V E  +D+
Sbjct: 549 IEDCLEARIVVIEIIDDL 566

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD-KLIRKAYPRGYTESI 78
          AC  CR ++ +CD   P C  C  +   C V+D  L +K Y   Y +S+
Sbjct: 10 ACSNCRRRRKKCDLGYP-CGTCERLKLVCNVNDVDLRKKRYSASYVKSL 57

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          AC RCRSKKT+CD + P C +C  +   C   D    +  PR Y
Sbjct: 45 ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON}
          Anc_6.279
          Length = 890

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          + QACD CR KK +C    P+CS+C   G +C  S K+ R    R
Sbjct: 16 IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 126/319 (39%), Gaps = 42/319 (13%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLM-VMCQMG--LLIKLKEHKSNNSLFKILTYYH 488
           +  +SF+ G   +  NN  D  +    L+  MC +G  L   L+E+           YY 
Sbjct: 344 VHRESFLYGFFNHSKNNYEDSNYCSVELIYAMCAVGSRLTPDLQEYSE--------LYYQ 395

Query: 489 QLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRC 548
           +    L +    + +T  I +VQ L  L FY L  GN +  +   G  I + + +     
Sbjct: 396 RSKKTLLQLVFDEQSTARITTVQALFCLAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLD 455

Query: 549 PSAVLTGSGS---TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDN 605
           P        +   T  +LE  +R  ++W  Y  D F  L LG             L V N
Sbjct: 456 PKVWYVDDNNLQLTQSELEIRSR--IYWGCYIADHFICLMLGR---------TSTLSVSN 504

Query: 606 TTTMDA-----IDGT-SIKLEGT-VSQISL---TLFRFAKVLGNIVDSIFKRNMSTSISR 655
           +T  ++     ++GT   +  GT V QISL    L   ++++      IF  +   +   
Sbjct: 505 STMPESDELPEVNGTEEFRFIGTHVLQISLPLKNLIILSRLVQIFTSKIFIESEDIAQKL 564

Query: 656 QVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLP 715
           +      + + NWR  LPE  Q+       I  +D+ T+ + + F    Y++ +   + P
Sbjct: 565 KCLNTFNSQVYNWRQSLPEFLQWS---KALIENDDVSTDPTISYFWYC-YYIVRLTFNKP 620

Query: 716 VCSTKVDLEDKVTETGNDV 734
                 + E  V E  +D+
Sbjct: 621 FIEDSQESETVVIEIIDDL 639

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 13  KQDSDVNHPSSSNY-RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-Y 70
           +  + VN P   N  R   AC  CR+++ +CD   P C  C+ +   C V+D+ +RK  Y
Sbjct: 50  RSGTAVNTPVDGNSNRKRLACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLRKKRY 108

Query: 71  PRGYTESI 78
              Y +S+
Sbjct: 109 TNKYVKSL 116

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 970

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query: 1  MVKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          MVK E  SS    ++S      S   R++  C  CR  KT+CD  KP+CS+CA    +C
Sbjct: 1  MVKLEDMSSGQLSEESPDRKYVSKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKC 59

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R+T+ACD CR KK +CD R P C  C    +EC
Sbjct: 17 RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 84/195 (43%), Gaps = 19/195 (9%)

Query: 492 YILPKNPVYDFA-TTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHR--C 548
           Y L    + D A T S++++Q L LL  +          Y      +  A +  LHR   
Sbjct: 292 YFLAAKNLIDIANTQSLEAIQTLCLLFMFAQCSARPSAGYMYLSLAMKSALREGLHRNLT 351

Query: 549 PSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV---DN 605
           P A ++ S      +E   R+ +F+TIY +DV  +  LG+PR +   + +  LP+   D+
Sbjct: 352 PEASMSFS-----PIEIEMRKRVFYTIYRMDVMLNTMLGLPRSISKEDFDQELPLTISDS 406

Query: 606 TTTMDAI---DGTSI-KLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIH 661
             T + I    G+ I    G  +Q +    +   ++  I ++++   +   +S  V    
Sbjct: 407 CITEEGILRNKGSDILGSTGVTNQHT----KLVMIMDEIANTLYSPRLDNVVSHSVISDL 462

Query: 662 ENALDNWRSRLPEQF 676
           E  L  W  +LP + 
Sbjct: 463 ELKLRAWLDQLPPEL 477

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON}
          Anc_5.235 YLR014C
          Length = 862

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 2  VKKEPGSSDPRKQDSDVNHPSSSNYRVTQ---ACDRCRSKKTRCDGRKPQCSQCAAVGFE 58
          +  E GSS  R        PSS+   +T+   AC RCR KK +CD   P C +CA V   
Sbjct: 5  ISSEDGSSKKR--------PSSAVAGITKSISACKRCRLKKIKCDQEFPSCLKCARVKVP 56

Query: 59 CKVSDKLIRKAYPRGYT 75
          C   D    +  PR Y 
Sbjct: 57 CVSLDPATGRDVPRSYV 73

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON}
          Anc_5.235 YLR014C
          Length = 864

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          AC RCR+KK +CD   P C +CA V   C   D    +  PR Y 
Sbjct: 33 ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSYV 77

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 90/214 (42%), Gaps = 30/214 (14%)

Query: 515 LLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWT 574
           LL  Y +   ++  ++ L G+++ +   L LH   S +L    S      +  RR LFW+
Sbjct: 423 LLADYSIMRPSVPGVWYLMGSVLRLTVDLGLH---SEIL---NSNYDPFTREIRRRLFWS 476

Query: 575 IYYLDVFSSLQLGVPRLLKDYEIECALP--VDNTTTM-------DAIDGTSIKLEGTVSQ 625
           +Y LD       G P  + +  I    P  +D++  +       D  D TS      V  
Sbjct: 477 VYALDRQVCSYFGRPFGIPEENITTRYPSILDDSVIVAKNFVLDDYSDATSQCASSKV-- 534

Query: 626 ISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHE------NALDNWRS-RLPEQFQF 678
           I++ +F+  K+  +IV  ++  N  + + R  +   +      N LD W S  +P+ F  
Sbjct: 535 IAMAMFKVRKIQADIVKILYAPN--SELPRGFSDFEQWRDSARNKLDKWYSIEVPKSFD- 591

Query: 679 KLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMI 712
            ++    I   DL+   S    LI++    KC +
Sbjct: 592 AMNCKFNIFFFDLNYHYSK---LILYGLAPKCPV 622

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
          + SD+  P  +  +    C  CRS+K +CD  +P C +C   GFEC   D  +R + P
Sbjct: 4  EKSDIRKPRRA--KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 7  GSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLI 66
          GSS  RK    V  P+    +   AC  CR +K +C G+ P CS C A    C+  DK  
Sbjct: 3  GSSSVRKWADGVQKPAHRRRKTVLACTNCRRRKIKCTGKWP-CSNCEAYSCVCEYVDKAA 61

Query: 67 RKAYPRGYTESI 78
          +  +  G   S+
Sbjct: 62 QVKFAGGSGNSV 73

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R    CD CR +K +CD  KP CS+CA  G EC
Sbjct: 10 RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa]
          {ON} YLR014C (REAL)
          Length = 903

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 12 RKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
          RK DS    P+ +  +   AC RCR KK +CD   P C +CA +   C   D    K  P
Sbjct: 17 RKGDS----PNIAISKSRTACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVP 72

Query: 72 RGYT 75
          R Y 
Sbjct: 73 RSYV 76

>Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W
           (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 255]
           FULL
          Length = 628

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 501 DFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTM 560
           D+ T ++  +++  LL  Y   +  ++  Y   G  +  A+ L LH  P+   T + S  
Sbjct: 253 DYDTVTVSFIEVHVLLSLYLTTLNKLKHAYIYSGTALRSAYLLNLH-VPA---TYNDSKY 308

Query: 561 QKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEI-ECALPVDN 605
             +E+   + L+WT+Y LD+F S  LG P  + +  + E   PV+ 
Sbjct: 309 TAVERERMKRLWWTVYNLDIFVSSILGFPMAIHENMVGEVGYPVEG 354

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
          RV++ACD CR+KK +C+G +P CS C     EC  +  + R+
Sbjct: 22 RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON}
          Anc_6.279 YPL248C
          Length = 993

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          V QACD CR KK RC    P+C++C    +EC  S +  R    R +   +
Sbjct: 8  VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAHLTEV 58

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa]
          {ON} Anc_6.279 YPL248C
          Length = 1154

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 30 QACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          QACD CR KK +C   KP+C++C    +EC  S +  R    R +
Sbjct: 16 QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 66/128 (51%), Gaps = 16/128 (12%)

Query: 480 LFKILTYYHQLTYILPKNPVYDFATT-SIKSVQLLALL--LFYHLNMGNIEQIYELRGNI 536
           LF+ +  YH+ T +L    +Y+F    S+K +    L+  +  + N+  I Q+  L    
Sbjct: 335 LFQEMCAYHEATDLLYT--LYNFPNRYSLKMLTGFVLINSIIENPNITTIAQLPRL---- 388

Query: 537 ISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYE 596
              A ++ L R P++     G T   L QS RR+LFW I+ LD  +SL   +P L+K  E
Sbjct: 389 ---AQRVMLTRDPTSY---HGITDPTLVQS-RRILFWQIFQLDTLTSLHNNLPPLIKLDE 441

Query: 597 IECALPVD 604
            + ALPV+
Sbjct: 442 FDTALPVE 449

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 9  SDPR-KQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          S+PR   D  ++       R++  C  CR  KT+CD ++P C++C   G +C
Sbjct: 28 SEPRYTNDEKLHRIRKKRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
          (REAL)
          Length = 1040

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 2  VKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          ++ E  S+ P  ++S+  H    N R++  C  CR  KT+CD  KP+C +C   G +C
Sbjct: 38 LEAEHSSTSPAPENSET-HNRKRN-RISFVCQACRKSKTKCDREKPECGRCIKHGLKC 93

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 994

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          R++  C  CR  KTRCD  KP C++C  +  EC V D + +++ PR
Sbjct: 22 RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
          YPL248C (REAL)
          Length = 895

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%)

Query: 30 QACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          QACD CR KK +C   KP+CS+C    +EC  S K  R    R
Sbjct: 9  QACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 130/319 (40%), Gaps = 42/319 (13%)

Query: 435 IQCQSFIQG---NQSNNLRDYKFFGCFLM-VMCQMGLLIKLKEHKSNNSLFKILTYYHQL 490
           +  +SF+ G   +  NN  D  +    L+  MC +G  +    H+ +        +Y Q 
Sbjct: 344 VHRESFLYGFFNHSKNNYEDSNYCSVELIYAMCAVGSRLTPDLHEYSE------IFYQQS 397

Query: 491 TYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
              L +    + +T  I +VQ L  L FY L  GN +  +   G  I + + +     P 
Sbjct: 398 KKTLLQLVFDEQSTARITTVQALFCLAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLDPK 457

Query: 551 AVLTGSGS---TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTT 607
                  +   T  +LE  +R  ++W  Y  D F  L LG             L V N+T
Sbjct: 458 VWYVDDNNFQLTQSELEIRSR--IYWGCYIADHFICLMLGR---------TSTLSVSNST 506

Query: 608 TMDA-----IDGT-SIKLEGT-VSQISLTLFRFAKVLGNIVDSIFKRNM---STSISRQV 657
             ++     ++GT   +  G  V QISL L     +L  +V  IF   +   S  I++++
Sbjct: 507 MPESDELPEVNGTEEFRFIGRHVLQISLPLKNLI-ILSRLV-QIFTSKIFIESEDIAQKL 564

Query: 658 ALIHE--NALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLP 715
             ++   + + NWR  LPE  Q+       I  +D+ T+ + + F    Y++ +   + P
Sbjct: 565 NYLNTFNSQVYNWRQSLPEFLQWS---KALIENDDVSTDPTISYFWYC-YYIVRLTFNKP 620

Query: 716 VCSTKVDLEDKVTETGNDV 734
                 + E  V E  +D+
Sbjct: 621 FIEDSRESETVVIEIIDDL 639

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 20  HPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-YPRGYTESI 78
           H SS+  R+  AC  CR+++ +CD   P C  C+ +   C V+D+ +RK  Y   Y +S+
Sbjct: 60  HGSSTRKRL--ACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLRKKRYTNKYVKSL 116

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
          similar to uniprot|P52960 Saccharomyces cerevisiae
          YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
          transcriptional activator of peroxisome proliferation
          may form heterodimer with Oaf1 to activate
          oleate-inducible gene expression activator of
          peroxisome proliferation
          Length = 847

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 24 SNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          S  R++  C  CR +K +CD  +P+C +CA +G EC
Sbjct: 24 SRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLEC 59

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
          (REAL)
          Length = 1045

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 2  VKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          ++ E  S+ P  ++S++ +   +  R++  C  CR  KT+CD  KP+C +C   G +C
Sbjct: 38 LEGEHSSTSPAPENSEMQNRKRN--RISFVCQACRKSKTKCDREKPECGRCTKHGLKC 93

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
          OAF1Oleate-activated transcription factor, acts alone
          and as a heterodimer with Pip2p; activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 1047

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 2  VKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          ++ E  S+ P  ++S+  H    N R+   C  CR  KT+CD  KP+C +C   G +C
Sbjct: 38 LEAEHSSTSPAPENSET-HNRKRN-RILFVCQACRKSKTKCDREKPECGRCVKHGLKC 93

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 559 TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIK 618
           T+ + E  + R L+WT+Y  +   S + G+P    DY I  ALP D       ID  +I+
Sbjct: 504 TLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPAD-------IDDETIE 556

Query: 619 LEGTVSQISLTLFRFAKVLGN----------IVDSIFKRNMSTSISRQVALIHENALDNW 668
            +      S  +FR A+++ N          I+  +++R   T+I   + ++ +  L+ W
Sbjct: 557 EKN-----SHYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLLE-W 610

Query: 669 RSRLPEQFQ 677
           R+ L +  Q
Sbjct: 611 RNNLSDSLQ 619

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQ---CSQCAAVGFEC--KVSDKLIRK 68
           RV++ACD CR +K RCD   PQ   CS C      C  K  D+++RK
Sbjct: 128 RVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRK 174

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 14 QDSDVNHPSSSNYRVT-QACDRCRSKKTRCDGRKPQCSQCAAVGF-ECKVSDKL 65
          + S VN P     R T ++C  CR +K +CD  KP CS C A  F EC  SD +
Sbjct: 16 ESSAVNKPPRKKRRSTIKSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAI 69

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar
          to uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate-activated transcription factor acts alone and as
          a heterodimer with Pip2p activates genes involved in
          beta-oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 1035

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 3  KKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
          + +  SS    Q+ D ++      R++  C  CR  KT+CD  KP+C +C   G  C V 
Sbjct: 31 RNDASSSQDGSQNGDESNSIKKRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VY 89

Query: 63 DKLIRKAYPR 72
          D + ++A PR
Sbjct: 90 D-VEKQAAPR 98

>AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR278C
          Length = 1106

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 91/182 (50%), Gaps = 25/182 (13%)

Query: 503 ATTSIKSVQLLALLLFYHLNMG-NIEQIYELRGNIISMA-HQLRLHRCPSAVLTGSGSTM 560
           A T ++ V+LL LL+FY + +  +   +YE+  +++++  ++L LH+      T  G++ 
Sbjct: 367 ALTPVQEVELLTLLVFYTIRIDRDSAALYEIIEDVVAICKNKLNLHQ-----HTPYGNSD 421

Query: 561 QKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTM--DAIDGTSIK 618
           +K        LFW +Y L+    + +G P ++K+ EI   L  ++  ++    I G+++ 
Sbjct: 422 RKFR------LFWCVYLLERMICVAVGKPYVIKESEIGLPLFQEDEPSLVNHDISGSAVT 475

Query: 619 LEGTVSQ-ISLTLF--RFAKVLGNIVDSIFKRNMSTSISR-----QVALIHE--NALDNW 668
               ++Q I L     RF +VLG I     +    + + R     Q++L+ E    L+ W
Sbjct: 476 GVHFINQAIKLRRIESRFVEVLGIIPQVEDQWQQCSQLPRSKLQEQLSLVKEFFRELEIW 535

Query: 669 RS 670
           RS
Sbjct: 536 RS 537

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 29 TQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          +++C  C+ +K RCD + P C+ C   G  C
Sbjct: 38 SRSCLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTES 77
          RV++ACD CR  KT+CDG +P CS+C      C  S+  I      GY ES
Sbjct: 17 RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSNSNI------GYAES 60

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 78/182 (42%), Gaps = 11/182 (6%)

Query: 507 IKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQS 566
           ++S+Q + +L  +     N+   Y   G  +  A +   HR        S   +  LEQ 
Sbjct: 258 VESLQAIFMLTIFLQCSANLSSGYTYIGIALRTAIKQNFHR------KTSLQNLNLLEQE 311

Query: 567 NRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQI 626
             + LFWTIY  D++ +  LG+P  L +  I+   P D        +   ++  G +S +
Sbjct: 312 TIKKLFWTIYKTDIYMNCILGLPNSLDESLIDQEFPSDIDDDRILENRLLVQPSGKLSSV 371

Query: 627 SL--TLFRFAKVLGNIVDSIFKRNMS-TSISRQVALIHENALDNWRSRLPEQFQFKLDVN 683
            +     +   ++ N    ++  +++ TSIS       E  L NW  RLP  FQ K + +
Sbjct: 372 GMNNEHTKLILIMNNAHKILYPMSLTVTSISHSEISKLEGELSNWLERLP--FQLKPEFS 429

Query: 684 GT 685
            T
Sbjct: 430 PT 431

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 26 YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
          ++V  AC  C+ +K RCDG+ P C+ C     +C+
Sbjct: 30 HKVKHACSSCKERKVRCDGQSP-CASCINARVKCE 63

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa]
          {ON} Anc_6.279 YPL248C
          Length = 1033

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%)

Query: 23 SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          SS   + QACD CR KK +C    P+C QC    + C  S K+ R    R
Sbjct: 2  SSPEAIEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63
          P    +R T  C  CR +KT+CD  KP CS C  +G  C  S+
Sbjct: 10 PVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSE 52

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
          PPR1Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain, positively
          regulates transcription of URA1, URA3, URA4, and URA10,
          which are involved in de novo pyrimidine biosynthesis,
          in response to pyrimidine starvation; activity may be
          modulated by interaction with Tup1p
          Length = 904

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 22/45 (48%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          AC RCR KK +CD   P C +CA +   C   D    K  PR Y 
Sbjct: 33 ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYV 77

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
          (REAL)
          Length = 546

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 19 NHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK 64
          N PS    RV +AC  CR +K +C+G+ P C  C + G+ C   DK
Sbjct: 7  NIPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa]
          {ON} Anc_6.279 YPL248C
          Length = 834

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          + QACD CR KK RC   KP C +C      C  S +  R    R +   +
Sbjct: 1  MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAHLTEV 51

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
          RV++ACD CR+KK +CDG  P CS C  V  EC  +  + ++  P
Sbjct: 9  RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa]
          {ON} weakly similar to uniprot|P04386 Saccharomyces
          cerevisiae YPL248C GAL4 DNA-binding transcription
          factor required for the activation of the GAL genes in
          response to galactose repressed by Gal80p and activated
          by Gal3p
          Length = 749

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 30 QACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
          QACD CR KK +C    P CS C    ++C  S K +R    R +
Sbjct: 9  QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
          Ashbya gossypii ADR403C
          Length = 978

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 1  MVKKEPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          M K E  S +    +S      S   R++  C  CR  KT+CD  KP+CS+CA    +C
Sbjct: 1  MAKPEDMSGEQFSAESPERKYVSKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 14/135 (10%)

Query: 492 YILPKNPVYDFATT-SIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPS 550
           Y L    + D A    I ++Q + +L  +     N++  Y   G  +  A    LHR  S
Sbjct: 274 YFLTAKSLVDIANVNEIYAMQTMFMLTMFLQCSANLKTCYSYIGIALRAAISEGLHRKNS 333

Query: 551 AVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMD 610
            +    G T   +E   ++ LFW++Y +D++ +  LG+PR L +  I   LP D      
Sbjct: 334 LI----GPT--PIEDETKKRLFWSVYKVDLYMNCILGLPRTLSESAINQELPRD------ 381

Query: 611 AIDGTSIKLEGTVSQ 625
            +D   I  +G ++Q
Sbjct: 382 -VDDEKITTKGILAQ 395

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 1/35 (2%)

Query: 22  SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVG 56
           ++S  RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 120 TTSKGRVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 18 VNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRG 73
          V H +    +V++ACD CR +K +C G +P C+ C     EC  S   +    PR 
Sbjct: 3  VKHATRPRSKVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS---VSAPTPRA 54

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

Query: 486 YYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRL 545
           YY+   Y L      D    +I+ ++LL + L   L          +    I+ A Q+  
Sbjct: 542 YYNSTLYHL------DDHFNTIEYLELLIVFLKQQLVASEFYGFERVLDVAINYAIQMGF 595

Query: 546 HRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALP 602
            R    V       +Q+ +   RR L+W +Y ++    ++ G P ++ + +I C LP
Sbjct: 596 SRWEFYV------GLQEYQAEKRRQLWWKLYMIEKLHCMKRGFPSVINEDKINCLLP 646

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 20 HPSSSNYRVTQ---ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
           PSS    +T+   AC RCR+KK +CD   P C +CA     C   D    +  PR Y 
Sbjct: 18 RPSSVVVGITKSISACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSYV 76

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
          RDR1Transcriptional repressor involved in the control
          of multidrug resistance; negatively regulates
          expression of the PDR5 gene; member of the Gal4p family
          of zinc cluster proteins
          Length = 546

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          RV +AC  CR +K +C+G+ P C  C A G+ C   D  +  A P+
Sbjct: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
           {ON} some similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015w PUT3 positive activator of the
           proline utilisation pathway
          Length = 824

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 98/227 (43%), Gaps = 30/227 (13%)

Query: 555 GSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDG 614
             G ++ + E  ++R L+WT+Y  +   S + G+P  L D  I   LP D  T   +ID 
Sbjct: 420 AQGDSISRAELEHKRRLWWTVYMFERMLSSKAGLPLSLSDATISTELPSDQ-TLHPSIDE 478

Query: 615 TSI--KLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRL 672
             I    E  V+ IS+      ++   I+  +++R  +++I   +  I ++ L+ WR+ L
Sbjct: 479 NYIFSPAENIVNCISI-----VRINAQILKKMYQRQPNSNILPILKSIIQSLLE-WRNTL 532

Query: 673 PEQFQFKLDVNGTINLNDLDTENSDTIFL---------IVFYFLAKCMIHLPVCSTKVDL 723
            +  Q     N  + +  L T N  T F          ++F+F +  +      +T VDL
Sbjct: 533 SDSLQTDF-TNSKLEITRLGT-NIFTEFFQGINLAIRPLLFHFTSIQLKKFKASNTYVDL 590

Query: 724 EDKVTETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPF 770
               T            S    SLQ S NT + ALR I D+ L   F
Sbjct: 591 AKYSTTIS---------SLLNCSLQASVNT-IRALRTIMDQNLVAVF 627

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 13 KQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63
          +Q+  V  P     +V QACD CR +K +C G++P CS C A   +C  S+
Sbjct: 7  QQEHKVTKP---RIKVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIR 67
           R++  C  CR  KT+CD  KP CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          V  ACD CR ++ +CDG+KP CS+C    FEC     L RK  P+
Sbjct: 4  VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPL-RKRGPK 46

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa]
          {ON} YLR014C (REAL)
          Length = 899

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 22/45 (48%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          AC RCR KK +CD   P C +CA +   C   D    K  PR Y 
Sbjct: 33 ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSYV 77

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 8  SSDPRKQDSDV--NHPSSSNYRVTQACDRCRSKKTRCDGR--KPQCSQCAAVGFECKVSD 63
          S+ P   DS    +H      + ++ACD+CR KK +CD +  K  CS C   G  C    
Sbjct: 21 SNSPEDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSFER 80

Query: 64 KLIRKAYPRGYTES 77
            +++   +GYT S
Sbjct: 81 VPLKRGPSKGYTRS 94

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 30  QACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGY 74
           QACD CR KK +C    P C+ C     +C  S +++R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 52/116 (44%), Gaps = 11/116 (9%)

Query: 513 LALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHR-CPSAVLTGSGSTMQKLEQSNRRLL 571
           L LL  Y   M      + L G    MA  L LHR  P++ +          +Q  RR+L
Sbjct: 473 LILLTHYVQKMHKPNTAWSLIGLCSHMATSLGLHRDLPNSTIH---------DQQLRRVL 523

Query: 572 FWTIYYLDVFSSLQLGVPRLLKDYE-IECALPVDNTTTMDAIDGTSIKLEGTVSQI 626
           +WTIY      SL+ G P LL + + I+  LP  + T  +    +SI  E   SQI
Sbjct: 524 WWTIYCTGCDLSLETGRPSLLPNLQAIDIPLPASSATIKEPSIYSSIIQESQWSQI 579

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
          (PPR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
          FULL
          Length = 881

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          R   AC RCR +K +CD + P CS+C +    C   D    +  PR Y 
Sbjct: 44 RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSYV 92

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
          YOR363C
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R++  C  CR  KT+CD  KP+CS+CA     C
Sbjct: 24 RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 27 RVTQACDRCRSKKTRCD--GRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTES 77
          + ++ACD+CR KKTRCD     P C+ C  +   C      +++   +GYT +
Sbjct: 34 KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGYTRA 86

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 8  SSDPRKQDSDV--NHPSSSNYRVTQACDRCRSKKTRCDGR--KPQCSQCAAVGFECKVSD 63
          S+ P   DS    +H      + ++ACD+CR KK +CD +  K  CS C   G  C    
Sbjct: 21 SNSPDDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDR 80

Query: 64 KLIRKAYPRGYTES 77
            +++   +GYT S
Sbjct: 81 VPLKRGPSKGYTRS 94

>NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {ON}
           Anc_8.283
          Length = 710

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 109/283 (38%), Gaps = 37/283 (13%)

Query: 447 NNLRDYKFFGCFLMVMCQMGLLIKLKEHKSNNSLFKILTYYHQLT--------YILPKNP 498
           NN +DY      +  +  +G   K+   K+++ LF     Y+Q +        + L +N 
Sbjct: 232 NNTKDYYCSEELIYAIAALG--SKISNSKTDSKLFSNSFSYYQHSKKIVLEKIFHLQRNN 289

Query: 499 VYDFATTSIK--SVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGS 556
             D +T+S K   +Q L  L FY +  G     + L G    +AH++ LH  P A     
Sbjct: 290 NLDSSTSSSKLAIIQTLLCLSFYDIGNGENPMAWYLSGLAFRIAHEIGLHLNPKAWTHVY 349

Query: 557 GSTMQKLEQSNRRLLFWTIYYLDVFSSLQLG-----------VPRLLKDYEIECALPVDN 605
              +  L+   R  ++W  Y  D   S+  G           +P   +   IE  L  D 
Sbjct: 350 EDELTMLDIKVRSRIYWGCYIADHLISILFGRSTTLRLSNSTIPETDELPNIENGLE-DY 408

Query: 606 TTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENAL 665
               +A+  TS  L+  +      L R  +V       IF ++ S     +        +
Sbjct: 409 IYDQNAVSTTSNPLKKLI-----VLSRITEVFAG---KIFVQSESFRQKSEFLNRFNKEM 460

Query: 666 DNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLA 708
            NWR  LP   ++ L      NL ++   N  T ++ + Y++ 
Sbjct: 461 KNWRKTLPLDLRWSLS-----NLKEMKQFNPSTTYIWLHYYIV 498

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 13 KQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-YP 71
          K ++D  + + S  ++  AC  CR  + +CD   P CS C      C  ++K +R   Y 
Sbjct: 28 KTNNDTKNATKSQRKI--ACQHCRKIRRKCDMINP-CSNCIKFDTTCVYAEKDMRTTRYS 84

Query: 72 RGYTESI 78
            Y +++
Sbjct: 85 NSYVKAL 91

>KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa]
          {ON} Anc_7.512 YLR451W
          Length = 846

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 31 ACDRCRSKKTRCDG--RKPQ-CSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
          AC  CR +K++CD   R P+ CS+CA  G  C V  K  R+ Y R   E+I
Sbjct: 38 ACVECRQQKSKCDAHERAPEPCSKCAKKGVPC-VLKKDFRRTYKRARNEAI 87

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 866

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
          R   AC RCR +K +CD + P CS+C      C   D    +  PR Y 
Sbjct: 33 RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSYV 81

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 63/169 (37%), Gaps = 20/169 (11%)

Query: 515 LLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWT 574
           L+  Y +   N+  ++   G+ + +A  L LH                  +  RR LFW 
Sbjct: 396 LIAKYSIMRPNVPGVWYTMGSALRLAVDLGLH------AEKLNKNYDPFTRDLRRRLFWC 449

Query: 575 IYYLDVFSSLQLGVPRLLKDYEIECALP--VDN---TTTMDAIDGTSIKLEGTVSQ--IS 627
            Y LD       G P  + D  I    P  +D+   T T D I+  S+      S   IS
Sbjct: 450 TYSLDRQICAFFGRPFGIPDDNISTEFPSSLDDALITNTADNIEDYSLVKSSMASYKCIS 509

Query: 628 LTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQF 676
           L  FR  K+   IV  ++    S     +       +LD WR  + E+ 
Sbjct: 510 LAFFRIRKIQAQIVQELYAHRTSLPDGFE-------SLDEWRELMNEEL 551

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 16  SDVNHPSSSNYRVTQACDRCRSKKTRCDGRK----PQCSQCAAVGFEC 59
           S+V+       RV +ACDRCR +K +CD  K     +CS C   G EC
Sbjct: 107 SNVSTTKVQKRRVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa]
          {ON} Anc_7.389 YBL066C
          Length = 1077

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDG--RKPQ-CSQCAAVGFECKV 61
          P+++N+R   +C  CR +K RC+   ++PQ C++CA +  +C +
Sbjct: 20 PAATNHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 26 YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          + + +ACD CR KK +C   +P+C +C   G++C  S ++ R    R
Sbjct: 2  FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
          R    C  CR++K +CD ++P+C +C  +G EC   D  ++ A P
Sbjct: 15 RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIECGGYDIKLQWANP 59

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
          {ON} weakly similar to uniprot|P12383 Saccharomyces
          cerevisiae YGL013C PDR1 Zinc cluster protein that is a
          master regulator involved in recruiting other zinc
          cluster proteins to pleiotropic drug response elements
          (PDREs) to fine tune the regulation of multidrug
          resistance genes
          Length = 1082

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
          +DS+ N       +V++ACD CR KK +C G  P C  C   G EC  S
Sbjct: 37 RDSNGNGTGKPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGF-ECKVSDKLI 66
          RV ++C  CR +K++CD  KP CS C   G  EC+  D+ I
Sbjct: 21 RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTI 61

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%)

Query: 19 NHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          N   S   +    C  CRS+K +CD R+P C +C   G  C   D  +R + P  + E
Sbjct: 27 NGTKSKRGKTFTGCWTCRSRKVKCDLRRPHCQRCEKSGLVCGGYDIKLRWSKPLQFDE 84

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa]
          {ON} Anc_7.17 YOR363C
          Length = 989

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R++  C  CR  KT+CD  KP+C +C   G +C
Sbjct: 40 RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 18  VNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
           V+ P S N +V+ AC+ C  KK +CD   P C+ C   G +CK
Sbjct: 62  VDRPRSFNIKVSPACEACNVKKIKCDRGFPVCNTCLKRGTQCK 104

>CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa]
          {ON} similar to uniprot|Q12340 Saccharomyces cerevisiae
          YOR172w
          Length = 987

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 2  VKKEPGSSDPRKQD--SDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCA 53
          V++EP  S PR  D  SD   P    ++  ++C  CR +K +CD +KP+CS CA
Sbjct: 7  VEEEPVQS-PRDNDKNSDCKRPKK-RFKPLKSCAFCRKRKLKCDKQKPRCSSCA 58

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 6  PGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQ--CSQCAAVGFECKVSD 63
          P   DP    S   H      + ++ACD+CR KK +CD +  +  CS C   G  C    
Sbjct: 24 PEDMDPAAATS---HAMKKRTKASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSFER 80

Query: 64 KLIRKAYPRGYTES 77
            +++   +GYT S
Sbjct: 81 VPLKRGPSKGYTRS 94

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          P S   R++  CD CR +K +C+ +KP CS+C     +C
Sbjct: 4  PKSKKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
          P+    +    C  CRS+K +CD R+P C +C   G  C   D  +R   P
Sbjct: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGF-ECKVSDKLIRKAYPRGYTES 77
          +V ++C  CR +K +CD +KP+CS CAA    EC   +K   +  P  +  S
Sbjct: 14 KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDPDVFLSS 65

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
          to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
          weakly similar to YAL051W uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 975

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 5  EPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          EP   +  ++D   N  +    R++  C  CR  KT+CD  KP+C +C     +C
Sbjct: 9  EPADDEKSREDQTSNG-ACKRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKC 62

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 7/50 (14%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
          RV++ACD CR  KT+CDG +P C +C +    C  S+  I      GY+E
Sbjct: 6  RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSNSSI------GYSE 48

>SAKL0F16522g Chr6 (1361716..1363842) [2127 bp, 708 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 708

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 24/173 (13%)

Query: 509 SVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNR 568
           ++Q    L +Y L++      Y + GN I M   L  H+        + +T Q     NR
Sbjct: 310 TIQSFLYLAYYSLSLDKRRLAYIMVGNAIRMVFMLGFHK-------KTTTTKQ-----NR 357

Query: 569 RLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQISL 628
             +FW  +  D   S++ G P ++ + +I   +P+ N  + D +  TS+ +    SQ+ L
Sbjct: 358 --IFWMCFIYDRLISVRFGFPLMINEADIN--VPLFNEKSSD-LQLTSLDIYHFNSQVKL 412

Query: 629 TLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLD 681
                A++   I+  I+ RN    I     ++ +  L  W   LP + +   D
Sbjct: 413 -----ARITTQIIRKIYTRNSFAFIQSCHTVLRQ--LKTWYDDLPPELKLDYD 458

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 20  HPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
           H +    R++  C  CR  KT+C+  KP CS+C  +G  C
Sbjct: 62  HITKKRNRISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 513 LALLLFYHLNMGNIEQI-YELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLL 571
           + LL  ++L + +     Y   G  +     L +H      +     T+ + E  +RR L
Sbjct: 589 VTLLYAFYLQVADCTATSYFFLGEALRACLLLGMH------VDAQSDTLSRCEVEHRRRL 642

Query: 572 FWTIYYLDVFSSLQLGVPRLLKDYEIECALP--VDNTTTMDAIDGTSIKLEGTVSQISLT 629
           +WT+Y  +   S + G+P    D  I   LP  ++     D +      +E      S+ 
Sbjct: 643 WWTVYMFERMLSSKAGLPLSFTDNTISTELPSNINCAQDNDILAKYYYYVEAAYIGESV- 701

Query: 630 LFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQ 677
             +  ++ G I+  +++R  S++I   +  I +  L NW+S +PE  Q
Sbjct: 702 --KIVQINGQILSKLYQRQPSSNILPILKDILKQLL-NWKSNVPESLQ 746

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63
          ++T+AC RCR +  +C G  P C +C      CK S+
Sbjct: 54 KITRACIRCRERHIKCPGNDP-CQKCLEANHICKFSE 89

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 1022

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 15 DSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          + D +  S    R++  C  CR  KT+CD  KP CS+C   G  C
Sbjct: 6  EGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC 50

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 19  NHPSSSNYRVTQACDRCRSKKTRCDGRKP----QCSQCAAVGFEC 59
           ++P S+  RV++ACD CR +K +CD ++     +CS C     EC
Sbjct: 240 DNPRSAKKRVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 22  SSSNYRVTQA---CDRCRSKKTRCDG--RKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
           SSSN R T+A   CD+CR KK +CD    +  C+ C   G +C      +++   +GY++
Sbjct: 50  SSSNKRRTKASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGPSKGYSK 109

Query: 77  S 77
           S
Sbjct: 110 S 110

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 875

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          P++   +++  C  CR  KT+CD  KP CS+CA +G  C
Sbjct: 13 PNTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          R++  C  CR  K +CD  KP+C++C   G +C   ++  R+  PR
Sbjct: 45 RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 11 PRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIR 67
          PRK  SD         +    C  CRS+K +CD  KP C +C   G EC   D  +R
Sbjct: 3  PRKS-SDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLR 58

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 28 VTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA 69
          V  ACD CR ++ +CDG+KP CS+C    F+C     L ++ 
Sbjct: 4  VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRG 44

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
          {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
          lactis KLLA0A03421g and weakly similar to YAL051W
          uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate- activated transcription factor acts alone and
          as a heterodimer with Pip2p activates genes involved in
          beta- oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 946

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          +++  C  CR  KT+CD +KP CS+C  +G +C
Sbjct: 24 KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
          (REAL)
          Length = 542

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63
          RV +AC  CR +K +C+G+ P C  C A G+ C  +D
Sbjct: 15 RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON}
          conserved hypothetical protein
          Length = 639

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
          R    C +C+S K +CD  KP C  C   GF+C  S  L     P
Sbjct: 12 RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTLKWGGRP 56

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 27  RVTQACDRCRSKKTRCD--GRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
           + ++ACD+CR KK +CD    K  CS C   G +C      +++   +GYT
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGYT 120

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 18  VNHPSSSNYRVTQACDRCRSKKTRCDG---RKPQCSQCAAVGFECKVSDKLIRKA 69
           +NHP     R ++ACD CR +K +CD    R  +CS C     EC  S++  RK 
Sbjct: 91  LNHPPKK--RASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRKG 143

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECK 60
          R    C  CRS+K +CD +KPQC +C     +C+
Sbjct: 11 RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 24 SNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
          S  RV++ACD CRSKK +C+G +  CS C   G  C  +  + ++
Sbjct: 8  SRRRVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 14/121 (11%)

Query: 477 NNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNI 536
           NN L K + +Y Q+ +I    PV D     IK +Q +  L  Y       + IY +    
Sbjct: 338 NNMLLKTVYFYQQI-FI---KPVDD----PIKCIQAVFFLCVYMEASPVPQSIYMILATA 389

Query: 537 ISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYE 596
           I +A  + LHR     L G    ++  E       +W  Y  D + +L+ G P L+ + +
Sbjct: 390 IRLAQDIGLHR--RENLLG----LEPKELRRHLTTWWFCYKYDRYITLRAGKPSLIHEKD 443

Query: 597 I 597
           +
Sbjct: 444 V 444

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
          (REAL)
          Length = 775

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 30 QACDRCRSKKTRCDGRKPQCSQCA---------AVGFE 58
          ++C+ CR +K RCDG++P+CS C          A+GFE
Sbjct: 10 RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIR 67
           C  CRS+K +CD R+P C +C   G EC   D  +R
Sbjct: 20 GCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLR 56

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R+   C  CR+KK +CD +KP C +C   G  C
Sbjct: 9  RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          ++ +AC  CR +K +CD  KP+C QC++    C
Sbjct: 9  KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R T  C  CR++K RC+  +P CS+C  +G  C
Sbjct: 10 RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
          regulatory element binding protein, induces
          transcription of sterol biosynthetic genes and of
          DAN/TIR gene products; Ecm22p homolog; relocates from
          intracellular membranes to perinuclear foci on sterol
          depletion
          Length = 913

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
           CD C+ ++ +CD  KP C +C  +  EC+ +   +RK   RG T
Sbjct: 50 GCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLRKG--RGAT 92

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 27 RVTQACDRCRSKKTRCDGRKP---QCSQCAAVGFEC 59
          R T+ACD CR +K RCD   P   +CS C     EC
Sbjct: 36 RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
          QD+ +  P++   +V++ACD CR +K +C G+ P C  C A    C  S    RK
Sbjct: 29 QDTKIKKPAA---KVSKACDNCRKRKIKCTGKMP-CPTCEAYQCPCIYSAPKPRK 79

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 22 SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
          + S+ +V++ACD CR +K +C G++P CS C A    C+ S
Sbjct: 18 TKSSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 27  RVTQACDRCRSKKTRCD-------GRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTES 77
           +V++ACD+CR KK +CD            C+ C  +G +C      +++   +GYT S
Sbjct: 112 KVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGPSKGYTRS 169

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
           C  CRS+K +CD  KP C +C   G EC   D  +R + P
Sbjct: 22 GCWTCRSRKVKCDLGKPTCQRCDKSGLECGGYDIKLRWSQP 62

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 11/51 (21%)

Query: 6  PGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVG 56
          PG +  RK++           R+  +C  CR +K RCD  KP C+QC   G
Sbjct: 4  PGGTAKRKRN-----------RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R +  C  C+++K RCD  +P CS+C  +G +C
Sbjct: 26 RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 20 HPSSSNYRVTQACDRCRSKKTRCDGRKPQ--CSQCAAVGFECKVSDKLIRKAYPRGYTES 77
          H      + ++ACD+CR KK +CD +  +  C+ C   G  C      +++   +GYT S
Sbjct: 35 HAMKKRTKASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGYTRS 94

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R +  C  CR +K +CD ++P+CS+C   G  C
Sbjct: 14 RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPC 46

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
          (REAL)
          Length = 545

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK 64
          RV +AC  CR +K +C+G+ P C  C A G+ C  +++
Sbjct: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 24  SNYRVTQACDRCRSKKTRCDGRKPQ---CSQCAAVGFEC--KVSDKLIRK 68
           S  RV++ACD CR +K RCD   PQ   CS C      C  K  D++++K
Sbjct: 128 SKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVCTFKHRDEILQK 177

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 94/225 (41%), Gaps = 33/225 (14%)

Query: 559 TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIK 618
           T+ + E  + R L+WT+Y  +   S + G+P    DY I   LP D       ID  S +
Sbjct: 506 TLSRFEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTELPAD-------IDDKSSR 558

Query: 619 LEGTVSQISLTLFRFAKVLGN----------IVDSIFKRNMSTSISRQVALIHENALDNW 668
                S+ +  +FR A+++ N          I+  +++R   T+I   + ++ +  L  W
Sbjct: 559 -----SKNNHYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIMITLKVVIKQLLQ-W 612

Query: 669 RSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVT 728
           R+ L +  Q    V+ T    D       T  +   YF    +   P+      ++ K  
Sbjct: 613 RNNLSDFLQ----VDFTQKDEDFRISRLSTN-MFTEYFQGINLAIRPLLFHFASIQLKRF 667

Query: 729 ETGNDVIYNDRFSTSY-----VSLQQSTNTMLNALRMIRDKYLPM 768
           +T N  I    +ST+       SL  S NT+ +   ++++  L M
Sbjct: 668 KTSNTFINLQNYSTTVSSLLTCSLHASVNTVRSLWSLLQNNMLAM 712

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVS 62
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 21  PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVG 56
           P     R+  +C  CR +K +CD ++P C+QC   G
Sbjct: 107 PKRKRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          P S N + T++C  C+ +K +CD + P CS C   G+EC
Sbjct: 2  PKSRN-KPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC 39

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 31  ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESI 78
            CD C+ ++ +CD  KP C +C  +  EC  S    RKA  +G + S+
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA--KGSSTSV 102

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 80/190 (42%), Gaps = 37/190 (19%)

Query: 510 VQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRR 569
           VQ      +Y L++        L G  I M   L  H+ P+              + NR 
Sbjct: 275 VQSFLYAAYYALSLDKSSLASILVGCAIRMMFGLGFHKHPTTA------------KENR- 321

Query: 570 LLFWTIYYLDVFSSLQLGVPRLLKDYEIEC-ALPVDNTTTMDAIDGTSIKLEGT--VSQI 626
            +FW  Y  D   +++ G P  L D +++  +LP+     +D     S+ LE    VSQ+
Sbjct: 322 -IFWLCYIYDRLVAVRFGFPLNLDDLDVDVLSLPL-----VDEKGYYSVSLETCHFVSQV 375

Query: 627 SLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTI 686
            L     A++   I+ SI+ +N  + I    A++ E  L  W   LP+        N  +
Sbjct: 376 KL-----ARITTRILRSIYTKNSISFIQNCNAVLKE--LKTWFDDLPQ--------NLIL 420

Query: 687 NLNDLDTENS 696
           +L+D + ENS
Sbjct: 421 DLDDFNIENS 430

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVG 56
          RV++ACD C+ +K RC G  P C  C  +G
Sbjct: 5  RVSKACDVCKHRKKRCTGELP-CDYCTRIG 33

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
          similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 880

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 17 DVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          + N  +   Y+++  C  CR  KT+CD +KP C++C  +   C
Sbjct: 6  EANLKAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC 48

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 14 QDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
          ++  +  PS+   +VT+ACD CR +K +C G+ P C+ C A    C  S +  RK
Sbjct: 48 KEKKIRKPSN---KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 27  RVTQACDRCRSKKTRCDGRKP---QCSQCAAVGFEC 59
           R  +AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
          extends into a gap in the genome sequence
          Length = 729

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 12/56 (21%)

Query: 5  EPGSSDPRKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGF-EC 59
          +P + D RK+   +           + C  CR +K RCD  +P CS C A GF EC
Sbjct: 9  DPATQDTRKKRKHI-----------RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa]
          {ON} Anc_7.17
          Length = 1161

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R++  C  CR  KT+CD  KP C++C     +C
Sbjct: 64 RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 27  RVTQACDRCRSKKTRCDGRKP---QCSQCAAVGFEC 59
           RV++ACD CR +K +CD  KP   +CS C     EC
Sbjct: 134 RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 86/224 (38%), Gaps = 46/224 (20%)

Query: 478 NSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNII 537
           N+L   + Y+H++T +             IK +Q + LL  Y     ++E  Y +    +
Sbjct: 476 NTLLNSIYYFHKITIL----------CDGIKPIQGMLLLYQYMRTNLSVEIGYSIFATAV 525

Query: 538 SMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYE- 596
             A  + LH         +   +   E   RR+L+W  Y  D F SL+L  P L+ + + 
Sbjct: 526 RFAQDMSLHN------LDTYKRLSYKECLKRRILWWHCYTTDKFLSLKLCKPSLINERDM 579

Query: 597 -----------IECALPVDNTTTMDAIDGTSI------KLEGTVS----QISLTLFRFAK 635
                      I+  L     T  +AID  +       KLE   S     IS    + A+
Sbjct: 580 TVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCSFLPVFISYYTTKLAR 639

Query: 636 VLGNIVDSIFK------RNMSTSISRQVALIHENALDNWRSRLP 673
           +   I  S F       +   T I R + +  +N+L +W   LP
Sbjct: 640 ISSKIYYSFFTPTSLKGQTFDTMIDRVLEI--KNSLSDWEKYLP 681

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63
          +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32 KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
          {ON} YAL051W (REAL)
          Length = 1000

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          R++  C  CR  KT+CD  KP+C +C      C + D + R+A PR
Sbjct: 20 RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPR 63

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
          complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
          R++  C +CR  KTRCD  +P C++C      C    +L +K
Sbjct: 34 RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON}
          Anc_2.547
          Length = 924

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 22 SSSNYRVTQACDRCRSKKTRCDGRKP--QCSQCAAVGFECKVSDKLIRKAYPRGYTES 77
          S    +V++ACD+C  ++ RC+  K    C+ C  +G  C  +   +++   +GYT+S
Sbjct: 41 SKKRSKVSRACDQCHKRRIRCNYNKVTNMCAGCKRIGEHCLFTRIPLKRGPVKGYTKS 98

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
          activator of peroxisome proliferation, contains
          Zn(2)-Cys(6) cluster domain, forms heterodimer with
          Oaf1p, binds oleate response elements (OREs), activates
          beta-oxidation genes
          Length = 996

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          R++  C  CR  KT+CD  KP+C +C      C + D + R+A PR
Sbjct: 20 RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPR 63

>ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
           Mutants are defective in Ty1 Enhancer- mediated
           Activation Ty1 enhancer activator and to YLR098C
           uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
           Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain DNA-binding transcriptional
           activator or CHA1
          Length = 764

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 110/287 (38%), Gaps = 38/287 (13%)

Query: 486 YYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRL 545
           YY +    L K    D +   I +VQ L  L FY L  G+ +  +   G  I + + +  
Sbjct: 371 YYERSKTALLKLVFDDHSVARITTVQALFCLAFYELGKGDTQLAWYFSGLAIRVGYDMGF 430

Query: 546 HRCPSAVLTG-----SGST-MQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIEC 599
              P   +T      +G T + K E   R  ++W  +  D   SL LG            
Sbjct: 431 QLDPEVWITADDDIVTGRTKLTKSELRIRSRIYWGCFVADHLISLLLGRTT--------- 481

Query: 600 ALPVDNTTTMDAIDGTSIKLEGT---------VSQISLTL---FRFAKVLGNIVDSIFKR 647
           +L V N+T  ++ +   I  EG          V Q+SL L      ++++      IF  
Sbjct: 482 SLSVSNSTIPESDELPEI--EGVEDFRFASQHVLQVSLPLKNMIILSRIVQIFTTQIFIE 539

Query: 648 NMSTSISRQVALIHEN-ALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTI-FLIVFY 705
            + T   +   LI  N  + NWR  LP+  ++  +      L D D     TI +    Y
Sbjct: 540 TLETK-HKVAHLIRFNLKVFNWRQLLPDFLKWSKE-----KLRDHDISTDPTISYFWYLY 593

Query: 706 FLAKCMIHLPVCSTKVDLEDKVTETGNDV-IYNDRFSTSYVSLQQST 751
           ++     + P      + +  V E  +DV +  D F   +   Q+++
Sbjct: 594 YIVLLTFNKPFIEDCEESKTVVGELVDDVKMLFDGFRIKFGGFQKAS 640

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 31  ACDRCRSKKTRCDGRKPQCSQCAAVGFECKV-SDKLIRKAYPRGYTESI 78
           AC  CR ++ +CD   P C  C  +   C +  + L +K Y   Y +S+
Sbjct: 72  ACSNCRRRRKKCDLNFP-CGNCIKLKLTCNINGEDLRKKRYSASYVKSL 119

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTE 76
           C  CR++K +CD  +P C++C   G +C   D  +R + P  + E
Sbjct: 21 GCWTCRARKVKCDLTRPSCTRCERSGLKCGGYDIKLRWSKPVWFNE 66

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 aa]
           {ON} YKL015W (REAL)
          Length = 981

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 92/225 (40%), Gaps = 33/225 (14%)

Query: 559 TMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIK 618
           T+ + E  + R L+WT+Y  +   S + G+P    DY I  ALP D            I 
Sbjct: 503 TLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPAD------------ID 550

Query: 619 LEGTVSQISLTLFRFAKVLGN----------IVDSIFKRNMSTSISRQVALIHENALDNW 668
            E    + +  +FR A+++ N          I+  +++R   T+I   + ++ +  L  W
Sbjct: 551 DEKPEHKDNHYVFRRAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLL-QW 609

Query: 669 RSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVT 728
           R+ L +  Q    V+ T    D       T  +   YF    +   P+      ++ K  
Sbjct: 610 RNNLSDFLQ----VDFTQKDEDFKISRLSTN-MFTEYFQGINLAVRPLLFHFASIQLKRF 664

Query: 729 ETGNDVIYNDRFSTSY-----VSLQQSTNTMLNALRMIRDKYLPM 768
           +T N  I    +ST+       SL  S NT+ +   ++++  L M
Sbjct: 665 KTSNTFINLQNYSTTISSLLTCSLHASVNTIRSLWSLLQNNMLAM 709

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 8  SSDPRKQDSDVNHPSSSNY--RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKL 65
          S++  +Q +    P  +N+  R  Q CDRCR  K +C G   QC+ C      C     L
Sbjct: 17 STNSSEQPAQSGPPDPANWESRRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMATL 76

Query: 66 IRKAYPR 72
           R+  P+
Sbjct: 77 KRRRKPK 83

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 12  RKQDSDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGF-ECKVSD 63
           R++ S ++        + + C  CR KK +CD R+P CS C A  F EC   D
Sbjct: 62  RQRASQISGTRKKRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 27 RVTQACDRCRSKKTRCDGRKP---QCSQCAAVGFEC--KVSDKLIRK 68
          RV++ACDRCR +K +CD   P   +CS C      C     +++IR+
Sbjct: 29 RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHYHEEMIRR 75

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
           CD C+ ++ +CD  KP C +C  +  EC  +   +RK   RG T
Sbjct: 50 GCDNCKRRRVKCDEGKPACKKCTNMKLECVYTPIHLRKG--RGAT 92

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R++  C  CR  KT+CD  KP C++C      C
Sbjct: 41 RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRK 68
           RV++ACD CR+KK RC+G +P C  C      C  +  + R+
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72
          R++  C  CR +K +CD ++P C QCA  G  C V D + R+  PR
Sbjct: 20 RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 27  RVTQACDRCRSKKTRCDGRKPQ--CSQCAAVGFECKVSDKLIRKAYPRGYTES 77
           + ++ACD+CR KK +CD  + +  CS C     +C      +++   +GYT S
Sbjct: 86  KASRACDQCRKKKIKCDFTEAKNICSNCQRNAEKCTFERVPLKRGPSKGYTRS 138

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK 64
          +V++ACD CR +K +C+G+ P C+ C     EC  S +
Sbjct: 41 KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 19 NHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKL 65
          N  S +  RV +AC+ C+ +K +CDG KP C  C+    EC+   K+
Sbjct: 19 NENSKTRLRVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKV 64

>KAFR0D02090 Chr4 complement(421242..421646) [405 bp, 134 aa] {ON}
           Anc_5.676 YKR083C
          Length = 134

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 96  CDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQNDVTTIPNSL 155
            DL+EQ +S   + ++ K     TD   ++LN  SD    I+G  N  R NDV +I NS+
Sbjct: 2   ADLREQLLSKERELAALKKIAALTDTMKLQLNELSDEVKQIEG--NAQRVNDVMSIWNSV 59

Query: 156 PLNISQTNLYLLNQTQKKAEL 176
             +IS+ +L LL   +K  E+
Sbjct: 60  TRSISEASLGLLRYVEKDYEV 80

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 24 SNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          S++RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 16 SSHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

>KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} similar
          to uniprot|Q754A1 Ashbya gossypii AFR171W AFR171Wp and
          weakly similar to YDR034C uniprot|P40971 Saccharomyces
          cerevisiae YDR034C LYS14 Transcriptional activator
          involved in regulation of genes of the lysine
          biosynthesis pathway requires 2-aminoadipate
          semialdehyde as co-inducer
          Length = 673

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 11 PRKQDSDVNHPSSSNYRVTQ-ACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          P    S+V  P+    + ++  C  C+ KK +CD  KP C QC  +  EC
Sbjct: 6  PDTAVSNVTEPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC 55

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
           C+ C+ +K +CD +KP+C QC+ +G +C
Sbjct: 20 GCNECKKRKVKCDEQKPECWQCSHLGKKC 48

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
          YER184C (REAL)
          Length = 793

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 25 NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          N RV++AC+RC  KK +CD +KP C  CA    +C
Sbjct: 11 NSRVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16 RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 569 RLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALP 602
           RL++W  Y+ D + SL  G   L+ D +I C LP
Sbjct: 382 RLIWWECYWWDKWFSLSAGKSPLIDDAKITCLLP 415

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
           CD C+ ++ +CD  KP C +C  +  EC  +   +RK   RG T
Sbjct: 50 GCDNCKRRRVKCDEGKPACKKCTNMKLECLYTPIHLRKG--RGAT 92

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63
          +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8  KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYP 71
           C  CRS+K +CD ++P C +C   G +C   D  +R + P
Sbjct: 27 GCWTCRSRKVKCDLQRPNCGRCEKSGLDCGGYDIKLRWSNP 67

>Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON}
          YBR240C (REAL)
          Length = 450

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLI 66
          PS +  R    C  CR KK RCD  +P CS CA  G  C    +L+
Sbjct: 18 PSPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDRCSYDIRLM 63

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
          (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC 59
          R++  C  CR  KT+CD  KP CS+C   G  C
Sbjct: 24 RLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC 56

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
          Ashbya gossypii AGR061C
          Length = 627

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKA-YPRGYTESI 78
          ++  AC  CR ++ +CD + P C  C   G EC   D+ +RK  Y  GY +S+
Sbjct: 9  KLKLACQSCRKRRRKCDLQMP-CLNCQKFGVECLPIDQDLRKKRYTTGYVQSL 60

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 93/222 (41%), Gaps = 24/222 (10%)

Query: 475 KSNNSLFKILTYYHQLTYILPKNPVYDF-ATTSIKS---------VQLLALLLFYHLNMG 524
           +S++ L+   T Y+ L+ +   N V+   A T I S         VQ L  L FY +  G
Sbjct: 251 QSSDDLYAKSTEYYNLSKLKVLNKVFHLEANTYIGSYSSSSKLAIVQTLLCLAFYDIGNG 310

Query: 525 NIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSL 584
                +   G    +AH++ LH  P A  +     +  L+   R  ++W  Y  D   ++
Sbjct: 311 ENPLAWYESGLAFRIAHEIGLHLNPEAWDSVYADKLSHLDIEVRSRIYWGCYIADHLIAV 370

Query: 585 QLGVPRLLKDYEIEC----ALPVDNTTTMDAI--DGTSIKLEGTVSQISLTLFRFAKVLG 638
             G    L+           LP   T   D     G S+ +   + ++ + L R  +V  
Sbjct: 371 LFGRSHTLRLSNSTIPETDELPNIETGIEDYQYEPGVSLHMAKPLKKL-IVLSRITEVFA 429

Query: 639 NIVDSIFKRNMSTSISRQVALIHENALD--NWRSRLPEQFQF 678
           +    IF +  + S++++   + +  L+  NWR  LPE+F++
Sbjct: 430 S---KIFIK--AGSMAQRSEYLRKFNLEFYNWRMNLPEEFRW 466

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 31 ACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75
           CD C+ ++ +CD  KP C +C  +  EC  +   +RK   RG T
Sbjct: 50 GCDNCKRRRVKCDEGKPACKKCTNMKLECLYTPIHLRKG--RGAT 92

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,603,923
Number of extensions: 5810895
Number of successful extensions: 30172
Number of sequences better than 10.0: 824
Number of HSP's gapped: 30431
Number of HSP's successfully gapped: 966
Length of query: 1246
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1125
Effective length of database: 39,606,813
Effective search space: 44557664625
Effective search space used: 44557664625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)