Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039408.843ON54754726340.0
NCAS0A02540singletonON53948315970.0
NCAS0C004008.843ON51748415910.0
KNAG0J002608.843ON55047215900.0
NDAI0K004008.843ON55354315470.0
CAGL0M03003g8.843ON55848715270.0
KAFR0B03930singletonON55544915250.0
Skud_13.4518.843ON53953914830.0
YMR279C8.843ON54054114810.0
Suva_13.4678.843ON54353614800.0
NDAI0E002808.843ON54954714760.0
Smik_13.4928.843ON54355914620.0
YML116W (ATR1)8.843ON54248814410.0
Smik_13.188.843ON54548414250.0
Suva_13.278.843ON55348614240.0
NCAS0B002908.843ON54254014140.0
TBLA0D032708.843ON55054114150.0
KNAG0G034308.843ON54248614140.0
Skud_13.258.843ON53748214020.0
TPHA0C047908.843ON55652013840.0
CAGL0B02343g8.843ON53748613480.0
TDEL0B005508.843ON53748113411e-180
Kpol_541.168.843ON52848613331e-179
SAKL0D01386g8.843ON52148813221e-178
Kwal_27.102458.843ON51547813191e-177
KLTH0C03806g8.843ON52548713091e-176
TBLA0D03280singletonON58054012761e-170
KAFR0A028408.843ON52048012501e-167
TBLA0C01160singletonON60048110911e-142
YOR378Wna 1ON5155367111e-86
Smik_15.560na 1ON5164817085e-86
KLTH0C10560gna 1ON5154777042e-85
Skud_15.545na 1ON5164916999e-85
Suva_8.435na 1ON5154906981e-84
Kwal_23.6547na 1ON5114856893e-83
TDEL0G04950singletonON5124796806e-82
KLLA0B00352gna 1ON4984346656e-80
KNAG0D00130na 1ON5654724503e-48
SAKL0C06116gsingletonON1851903761e-41
KAFR0C04860na 1ON5344723852e-39
CAGL0L02519gna 1ON5294413366e-33
NCAS0A05720na 1ON5634783235e-31
NDAI0K02730singletonON6045322765e-25
KLLA0C18931gna 2ON5531131367e-08
AGR076C8.272ON6863441313e-07
SAKL0F00440gsingletonON5441221171e-05
NCAS0A078102.473ON5681501172e-05
Smik_13.2722.473ON5611831143e-05
NDAI0D010202.242ON5922441134e-05
Skud_6.16na 3ON5491851125e-05
Smik_6.24na 3ON5441241126e-05
Suva_10.11singletonON5401881126e-05
KLLA0E24113g8.570ON5752641118e-05
ABL040W2.473ON5671681118e-05
Kwal_34.15746na 2ON5181021109e-05
NDAI0H022002.473ON5711481082e-04
TBLA0F030408.272ON9061261082e-04
KLTH0H16214gsingletonON5511021063e-04
YMR088C (VBA1)2.473ON5621951063e-04
Skud_13.2442.473ON5621911063e-04
KAFR0J009302.242ON5661731036e-04
Suva_13.2652.473ON5611951037e-04
TDEL0F039908.272ON6313981000.002
Kpol_543.448.272ON64352970.004
KLTH0D16962gsingletonON571134950.006
ZYRO0C01430g8.272ON590413950.006
TDEL0D06610singletonON49791940.008
Kpol_1039.192.242ON573213940.009
KLLA0A04631g8.272ON579111940.009
SAKL0E02992g2.473ON570168940.009
SAKL0A08228gsingletonON569146920.014
SAKL0H16808g8.272ON65748920.014
KLTH0C10120gsingletonON651145920.015
NCAS0C03460na 4ON630133910.021
SAKL0E04246gna 5ON56585900.024
SAKL0C05588gsingletonON677186890.033
KNAG0E025602.473ON578139890.033
KLTH0H05456gna 6ON56884890.037
Kwal_14.1585na 6ON57084880.048
KLLA0F17776gna 5ON553104870.057
SAKL0E08756g2.242ON565142850.093
KLLA0F03311g2.242ON542111850.096
TBLA0B044808.570ON608145850.11
ZYRO0A00330gsingletonON576149850.11
Kwal_26.7984na 7ON612171840.12
SAKL0C02178gsingletonON56599840.12
TBLA0D029003.503ON691128840.13
Ecym_42988.272ON678139840.13
YGR224W (AZR1)na 4ON613133840.15
KLTH0B00132gsingletonON568147830.15
TBLA0G025502.242ON613207830.16
KNAG0I019102.242ON598144830.18
Smik_16.81na 4ON625244830.19
TPHA0A017508.272ON63667820.25
SAKL0D04510gna 8ON531157810.27
TPHA0D033103.503ON613133810.31
ABL210CsingletonON47878800.39
Kpol_1051.155.284ON501143790.46
Kpol_1017.33.503ON62195790.47
YKR105C (VBA5)singletonON582133790.51
SAKL0A00726gsingletonON598127790.52
TBLA0A08510singletonON633143790.57
NCAS0G029902.242ON581144780.62
KLTH0C10142gsingletonON573133780.64
TDEL0G03260singletonON612132780.69
ZYRO0G21890gsingletonON57684780.71
TDEL0D057103.503ON616100780.76
KLTH0G09372g2.242ON551142770.88
TPHA0I017608.570ON653142770.92
Kwal_26.6669singletonON590141771.0
Skud_7.560na 4ON642133761.2
KAFR0F040904.212ON58799751.5
YPR198W (SGE1)singletonON543146751.7
TDEL0B019008.446ON68756751.8
Kwal_56.237548.272ON58967741.8
TDEL0A024902.473ON554168741.9
NDAI0D016805.284ON516127742.0
YER061C (CEM1)7.242ON44232732.4
KLTH0B00594gsingletonON618133732.4
Kwal_26.77552.473ON55978732.4
Kwal_26.9616singletonON562134732.5
Kwal_23.48242.242ON55397732.9
TBLA0A014201.451ON572118732.9
TBLA0C01100na 9ON64995733.0
KLTH0B10142gsingletonON568147733.0
Kwal_26.92644.212ON61484723.2
AFR333WsingletonON500105723.3
CAGL0B02079gna 4ON624174723.3
ZYRO0G19646g3.503ON59493723.6
SAKL0D04070g3.245ON667197723.6
KLTH0D13442g4.212ON59284723.6
TPHA0G031502.473ON600192723.8
KLTH0F17798g5.675ON113175723.8
Suva_5.1717.242ON44232713.9
CAGL0J00363g5.284ON498127714.0
KLTH0D05434g2.473ON576100714.8
KAFR0J009402.243ON41141704.9
ZYRO0G21868gna 6ON620133715.0
ZYRO0G03234g2.473ON562154706.4
KLTH0D06710gna 7ON611171697.2
NDAI0G063108.22ON565197697.2
KLTH0G13464g8.272ON59348697.5
Kwal_14.728singletonON568133697.7
SAKL0F02178gna 10ON523114698.1
Skud_5.1767.242ON44228698.2
YBR293W (VBA2)na 11ON474154698.8
YAL067C (SEO1)singletonON593122689.3
TBLA0C046307.242ON45924689.3
Ecym_6024na 8ON48982689.5
Kpol_416.5singletonON60795689.5
TBLA0B00840singletonON63764689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03940
         (547 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...  1019   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   619   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      617   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   617   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               600   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   592   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   592   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   575   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   575   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   574   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      573   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   567   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   559   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   553   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   553   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      549   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   549   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   549   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   544   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   537   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   523   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   521   e-180
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   518   e-179
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   513   e-178
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   512   e-177
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   508   e-176
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   496   e-170
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   486   e-167
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   424   e-142
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   278   1e-86
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   277   5e-86
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   275   2e-85
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   273   9e-85
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   273   1e-84
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   270   3e-83
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   266   6e-82
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   260   6e-80
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   177   3e-48
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   149   1e-41
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     152   2e-39
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   134   6e-33
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            129   5e-31
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   110   5e-25
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    57   7e-08
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    55   3e-07
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    50   1e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    50   2e-05
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    49   3e-05
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    48   4e-05
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    48   5e-05
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    48   6e-05
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    48   6e-05
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    47   8e-05
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    47   8e-05
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    47   9e-05
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    46   2e-04
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    46   2e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    45   3e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    45   3e-04
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    45   3e-04
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    44   6e-04
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    44   7e-04
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    43   0.002
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    42   0.004
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    41   0.006
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    41   0.006
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    41   0.008
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    41   0.009
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    41   0.009
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    41   0.009
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    40   0.014
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    40   0.014
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    40   0.015
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    40   0.021
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    39   0.024
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    39   0.033
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    39   0.033
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    39   0.037
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    39   0.048
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    38   0.057
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    37   0.093
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    37   0.096
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    37   0.11 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    37   0.11 
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    37   0.12 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    37   0.12 
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    37   0.13 
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    37   0.13 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    37   0.15 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    37   0.15 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    37   0.16 
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    37   0.18 
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    37   0.19 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    36   0.25 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    36   0.27 
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    36   0.31 
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    35   0.39 
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    35   0.46 
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    35   0.47 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    35   0.51 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    35   0.52 
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             35   0.57 
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    35   0.62 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    35   0.64 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               35   0.69 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    35   0.71 
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    35   0.76 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    34   0.88 
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    34   0.92 
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    34   1.0  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    34   1.2  
KAFR0F04090 Chr6 complement(797919..799682) [1764 bp, 587 aa] {O...    33   1.5  
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    33   1.7  
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    33   1.8  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    33   1.8  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    33   1.9  
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    33   2.0  
YER061C Chr5 complement(278298..279626) [1329 bp, 442 aa] {ON}  ...    33   2.4  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    33   2.4  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    33   2.4  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    33   2.5  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    33   2.9  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    33   2.9  
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     33   3.0  
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    33   3.0  
Kwal_26.9264 s26 complement(1138989..1140833) [1845 bp, 614 aa] ...    32   3.2  
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    32   3.3  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    32   3.3  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    32   3.6  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    32   3.6  
KLTH0D13442g Chr4 complement(1094195..1095973) [1779 bp, 592 aa]...    32   3.6  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    32   3.8  
KLTH0F17798g Chr6 (1437309..1440704) [3396 bp, 1131 aa] {ON} sim...    32   3.8  
Suva_5.171 Chr5 complement(255450..256778) [1329 bp, 442 aa] {ON...    32   3.9  
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    32   4.0  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    32   4.8  
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...    32   4.9  
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    32   5.0  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    32   6.4  
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    31   7.2  
NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8...    31   7.2  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    31   7.5  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    31   7.7  
SAKL0F02178g Chr6 complement(187479..189050) [1572 bp, 523 aa] {...    31   8.1  
Skud_5.176 Chr5 complement(275089..276417) [1329 bp, 442 aa] {ON...    31   8.2  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    31   8.8  
YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}  SEO1...    31   9.3  
TBLA0C04630 Chr3 complement(1122840..1124219) [1380 bp, 459 aa] ...    31   9.3  
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    31   9.5  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    31   9.5  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    31   9.7  

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/547 (91%), Positives = 503/547 (91%)

Query: 1   MLKLYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXK 60
           MLKLYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQ               K
Sbjct: 1   MLKLYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSK 60

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT
Sbjct: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV
Sbjct: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF
Sbjct: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDW            MNFVWNQAPISGWSKA
Sbjct: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKA 300

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY
Sbjct: 301 YIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF
Sbjct: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS
Sbjct: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN
Sbjct: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540

Query: 541 EKKEDKC 547
           EKKEDKC
Sbjct: 541 EKKEDKC 547

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/483 (61%), Positives = 358/483 (74%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQ+P YF S ++EY FI TCM+ANLLNQAGQTQ LSTMNV+++S +SD   +TWLMASF 
Sbjct: 50  WQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFP 109

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFIL+SGRIGDIYGLK T IGG I   IWS+LCG + +T N TFFI+CRAFQGLG+
Sbjct: 110 LVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGI 169

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           +F+LPNVMGL+GNIY VG++RKNIVIS IG  AP G   G +WGGLIV  N  QWPWIF+
Sbjct: 170 SFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFY 229

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A A+   +NLIM +YS+PN +PTN++N  MDW             NFVWNQ P++GW KA
Sbjct: 230 AYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKA 289

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YELK   SPLLP EVTKN  I+TI+  LFLGWGAFGIWTFYY
Sbjct: 290 YIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYY 349

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           +AF LNLR +SP+W G T+F+FII+G++ A+ VAFTI KVGP++L   S++GFT G+++ 
Sbjct: 350 FAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLML 409

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVT   Q YWR +LGMQIIL  GMDLSFP SSIILSD LPMQYQGM+GSLVNT+ NYATS
Sbjct: 410 SVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATS 469

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           LCLGMGTT E Q N  G+D+LKGYR+ALY+A+GLG LG   +F  +   LW++ R R  +
Sbjct: 470 LCLGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRLAD 529

Query: 541 EKK 543
            K 
Sbjct: 530 LKS 532

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/484 (61%), Positives = 363/484 (75%), Gaps = 1/484 (0%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQ+  YF+S  +EY FI TCM ANLLNQAGQTQ LSTMNV+++S +SD   +TWLMASF 
Sbjct: 28  WQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFP 87

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFIL+SGRIGDIYGLK T IGG I   IW++LCG + YT + TFFI+CRAFQGLG+
Sbjct: 88  LVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGI 147

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           +F+LPN+MGLVGNIY VG++RKNIVIS IG  AP G   G +WGGLI   +  QWPWIF+
Sbjct: 148 SFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A A+A F+NLIM IYS+P +VPTN++N  MDW             NFVWNQ P++GW+K 
Sbjct: 208 AYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKP 267

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YELK   SPLLP EVTKN  I+TI+  LFLGWG+FGIWTFYY
Sbjct: 268 YIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYY 327

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           YAF LNLR++SPLWAG+THF+FII+GS+ A  V FTIN+VGP+VL   S++GFT G+++ 
Sbjct: 328 YAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLML 387

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVT   QTYWR ++GMQIIL+ GMDLSFP SSIILSD LPMQYQGM+GSLVNTI NY+TS
Sbjct: 388 SVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTS 447

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           LCLGMGTT E Q N  G+++L+GYR+ALY+A+GLG LG   +F  +  DLW R RK R +
Sbjct: 448 LCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLW-RKRKSRLD 506

Query: 541 EKKE 544
           + + 
Sbjct: 507 DIRS 510

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/472 (62%), Positives = 347/472 (73%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQ+PTYF + WQEY FI TCMLA LLNQAGQ Q  + MN+LAD+ NS    +TWLMASF 
Sbjct: 62  WQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFP 121

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFILVSGRIGDIYGLK T IGG ++  IWS++CG + YT N  FFI+CRAFQGLG+
Sbjct: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGI 181

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF+LPNVMGL+GNIY   ++RKN VISF+G  AP+G   GG+W GLI   N  QWPWIF+
Sbjct: 182 AFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFY 241

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A AI V IN++M IYSIP+ VPTNI+   MDW             NFVWNQ PI GW+K 
Sbjct: 242 AYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKG 301

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YE+K A+SPLLPPEV KNRHI  I++++F+GWG+FGIWTFYY
Sbjct: 302 YIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYY 361

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           YAF LNLRH+S +WAG T F+F+I+G++ A  VA TI +VGPSVL C S  GFT G I+ 
Sbjct: 362 YAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIML 421

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVT   Q+YW+ +LGMQIIL+ GMDLSFP SSIILSD LP QYQGM+GSLVNT+ NY+TS
Sbjct: 422 SVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTS 481

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWI 532
           LCLG+G+TAE Q N  G D LKGYRAALYV IGLGA G   +F Y+ E LWI
Sbjct: 482 LCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLWI 533

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/543 (54%), Positives = 369/543 (67%), Gaps = 11/543 (2%)

Query: 14  EEKNPIEDFQTTTVTAQTSLDVLSDSVK---KDQ------XXXXXXXXXXXXXXXKWQDP 64
           E K P+   +   + +Q+++D  S   K   K+Q                      WQ+P
Sbjct: 7   EIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNP 66

Query: 65  TYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASG 124
            YF SS++EY F+ TCM+ANLLNQAGQ+Q LS MNV++DS +S    +TWLMASF L SG
Sbjct: 67  DYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSG 126

Query: 125 SFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVL 184
           SFIL+SGR+GDIYGLK   IGG I   IWS++CG + Y  + TFFI+ RAFQGLG++F+L
Sbjct: 127 SFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFIL 186

Query: 185 PNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAI 244
           PNVMGLVGNIY VG++RKN+VIS IG MAP G  FG +WGGLIV  N  QWPWIF+A A+
Sbjct: 187 PNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAV 246

Query: 245 AVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXX 304
           A  + L+MG Y++P+++PTN+    MDW             NFVWNQ PI GW KAY   
Sbjct: 247 AAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIV 306

Query: 305 XXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFN 364
                         YE+K A+ PLLP  VT+N HI+TI+  LFLGWG+FGIWTFYY+AF 
Sbjct: 307 LLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQ 366

Query: 365 LNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTS 424
           LNLR +SP+W+G T FVFIIFG++ A TVA TI KVGP++L   S+IGFTCG+II SVT 
Sbjct: 367 LNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTP 426

Query: 425 PDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLG 484
             QTYWRN+ GMQIIL  GMDL FP SSIILSD LPMQYQGM+ SLVNTI NY+TSLCLG
Sbjct: 427 VHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLG 486

Query: 485 MGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544
           MGTT E Q N  G D+LKGYRAALY  +G+  LG   +F  +  D+W   ++  ++ K  
Sbjct: 487 MGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIW--SKRNAKDPKDL 544

Query: 545 DKC 547
            +C
Sbjct: 545 QRC 547

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/487 (58%), Positives = 361/487 (74%), Gaps = 1/487 (0%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           +Q+P YF++ ++E  FI +CM+A LLNQAGQTQ+LSTMNVLAD   S+ + + WLMASF 
Sbjct: 73  FQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFP 132

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFIL+SGR+GDIYGLK     G II  +WSI+CG++KYT +  FFI+CR+FQGLG+
Sbjct: 133 LVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGI 192

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF+LPN+MGLVGNIY VG++RKNIVIS IGCMAP G   G ++GGLIV  + +QWPW+F+
Sbjct: 193 AFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFY 252

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A  IA F+N+++ +YSIPN+VPTN+ NL MDW            +N VWNQAPI GW +A
Sbjct: 253 AFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEA 312

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YE+K A SPLLPP V +N+ I+ I+ +LF GWG+FGIWT+YY
Sbjct: 313 YIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYY 372

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           YAF LNLR ++PLWAG THF+F+I+G++ A  VA TI KVGP+VL C S + F CG+I+ 
Sbjct: 373 YAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIML 432

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVT   QTYWR ++GMQIIL+ GMDLSFP SSIILSD LPMQYQGM+GSLVNT+ NY+TS
Sbjct: 433 SVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTS 492

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           LCLGMG T E QYN  G D+LKGYR+ALY+AIGL + G   S  ++  D+ I  R R++ 
Sbjct: 493 LCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDI-IAKRHRKRI 551

Query: 541 EKKEDKC 547
           E + + C
Sbjct: 552 ESECESC 558

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/449 (62%), Positives = 338/449 (75%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQ+P+YF S W+EY FI TCML+NLLNQAGQTQ  STMNV+  + N+D ++KTWLMASF 
Sbjct: 69  WQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFP 128

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFILVSGRIGDIYGLK T IGG I+  IWS++CG + Y+ +VTFFIICRAFQGLG+
Sbjct: 129 LVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGI 188

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AFVLPNVMGLVGNIY VGS+RKNIVIS IG  AP G  FG  W GLI    + QWPWIF+
Sbjct: 189 AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A A A  +NL++ IYSIP+ VP N++   MDW             NFVWN+API GW KA
Sbjct: 249 AYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKA 308

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YE+K A+SPLLP  VT N +I+ I+ ++F+GWG+FGIWTFYY
Sbjct: 309 YIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYY 368

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           YAF LNLR ++PL AG++H +FI++G++ A TVAFTI +VGPSVL   S + FT G+I+ 
Sbjct: 369 YAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIML 428

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           S+T   QTYW+ + GMQIILA GMDLSFP SSIILSD LPM+YQGM+GSLVNTI NY+TS
Sbjct: 429 SITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTS 488

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALY 509
           LCLGMGTTAE+Q N  G D+LKGYRAALY
Sbjct: 489 LCLGMGTTAEIQVNKNGTDLLKGYRAALY 517

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/539 (52%), Positives = 369/539 (68%), Gaps = 19/539 (3%)

Query: 6   RKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPT 65
             K+  +EE+K  +   +  T  A +S    S+ +  D                 WQDPT
Sbjct: 19  NDKISMKEEDKVIVSTDEEVTTVASSSK---SNQISNDS---------------PWQDPT 60

Query: 66  YFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGS 125
           YF S  +E  FIGTCMLA LLNQAGQT  L  MNVL+ S  S+   + WLMASF LA+GS
Sbjct: 61  YFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGS 120

Query: 126 FILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185
           FIL+SGR+GDIYGLK   + G +I  +WSI+ G+SKY+ N +FFI CRAFQG+G+AF+LP
Sbjct: 121 FILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILP 180

Query: 186 NVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIA 245
           N+MGLVG++Y VGS+RKN+VIS IG   P G  FGG++GGLIV  + +QWPW+F+A  IA
Sbjct: 181 NIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIA 240

Query: 246 VFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXX 305
            FI+++M  YSIPN+VPTN++ L MDW             NFVWN+API+GW KAY    
Sbjct: 241 TFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVL 300

Query: 306 XXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNL 365
                        YE+K AE PLLP  VTKNRH++ I++++F+GWG+FGIWTFYY +F L
Sbjct: 301 LVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360

Query: 366 NLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSP 425
           NLRH+SP+W G T+FVF IFG++ A  VAF+I ++GP++L C + + F  G+I+FSV   
Sbjct: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420

Query: 426 DQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGM 485
           +Q+YW+ +  MQ +L  GMDLSFP SSIILSD LPMQYQGM+GSLVNT+ NY+ SLCLGM
Sbjct: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480

Query: 486 GTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544
           G T E Q N  GK+VL+GYRAA+Y+ IGL +LG   S +YM E +W   RK+ Q +  E
Sbjct: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVW-NERKKCQRKSLE 538

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/541 (53%), Positives = 367/541 (67%), Gaps = 4/541 (0%)

Query: 1   MLKLYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXK 60
           M  +++KK   Q  +    E  +  TV A+  + V+S   ++                  
Sbjct: 1   MFSIFKKKTSVQGTDS---EIDEKITVKAKDKV-VVSTEDEEVTTIVSSTKSTQVTNDSP 56

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQDPTYF S  +E  FI TCMLA LLNQAGQT  L  MNVL+ S NS+   + WLMASF 
Sbjct: 57  WQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFP 116

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           LA+GSFIL+SGR+GDIYGLK   I G +I  +WSI+ G+SKY+ +  FFI  RAFQG+G+
Sbjct: 117 LAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGI 176

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF+LPN+MGLVG++Y VGS RKNIVISFIG  AP G  FGG++GGLIV  + +QWPW+F+
Sbjct: 177 AFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFY 236

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A  IA F++L+M  YSIPN+VPTNI+ L MDW             NFVWNQAPI GW K 
Sbjct: 237 AFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKP 296

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YE K AE PLLP  +TKNRH++ I++++FLGWG+FGIWTFYY
Sbjct: 297 YIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYY 356

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
            +F LNLRH+SP+W G T+FVF+IFGS+ A  VAF+I ++GP++L C S + F  G+I+F
Sbjct: 357 VSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMF 416

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SV   +Q+YW+ +  MQ IL  GMDLSFP SSIILSD LPMQYQGM+GSLVNT+ NY+ S
Sbjct: 417 SVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 476

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           LCLGMG T E Q N  G D+LKGYRAA+Y+ +GL +LG   S +YM E+LW R+RK    
Sbjct: 477 LCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536

Query: 541 E 541
            
Sbjct: 537 S 537

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/536 (52%), Positives = 364/536 (67%), Gaps = 21/536 (3%)

Query: 8   KLKQQEEEKNPI--EDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPT 65
           K+  + E+K  +  ED   TTV +       S  V  D                 WQDPT
Sbjct: 21  KISMKAEDKVVVSSEDEDVTTVASSNK----STQVSNDS---------------PWQDPT 61

Query: 66  YFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGS 125
           YF S  +E  FI TCMLA LLNQAGQT  L+ MNVL+ S NS+   + WLMASF L +GS
Sbjct: 62  YFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGS 121

Query: 126 FILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185
           FIL+SGR+GDIYGLK   + G +   +WS++CG+SKY+ N  FFI CRAFQGLG+AF+LP
Sbjct: 122 FILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILP 181

Query: 186 NVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIA 245
           NVMGLVG++Y VGS RKN+VISFIG  AP G  FGG++GGLIV+ + +QWPW+F+A AIA
Sbjct: 182 NVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIA 241

Query: 246 VFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXX 305
            F+N+I+  YSIPN++PTN++   MDW             NFVWNQAP +GW  AY    
Sbjct: 242 FFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIAL 301

Query: 306 XXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNL 365
                        YE+K A+ PLLP  VTKNRH++ I++++FLGWG+FGIWTFYY +F L
Sbjct: 302 LIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361

Query: 366 NLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSP 425
           NLRH+SP+W G T+FVF+IFG++ A  VA +I +VGP+ L C + + F  G+I+FSV   
Sbjct: 362 NLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV 421

Query: 426 DQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGM 485
            Q++W+ + GMQ IL  GMDLSFP SSIILSD LPM+YQGM+GSLVNT+ NY+ SLCLGM
Sbjct: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481

Query: 486 GTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNE 541
           G T E Q N  GKD+LKGYR A+Y+ +GL +LG   SF+YM E  W   R R+++ 
Sbjct: 482 GATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDS 537

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/547 (51%), Positives = 363/547 (66%), Gaps = 2/547 (0%)

Query: 1   MLKLYRKKLKQQEEEKNPIEDFQTTTVTAQTS--LDVLSDSVKKDQXXXXXXXXXXXXXX 58
           MLK + +   +  EE+  I    ++ +  + S      ++ V +D+              
Sbjct: 1   MLKHFHRHNSKNVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDH 60

Query: 59  XKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMAS 118
            KWQ+P YF++ WQEY FI +CM++ LLNQA   QTLS MN++ DS  S+G  +TWL+AS
Sbjct: 61  SKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIAS 120

Query: 119 FTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGL 178
           F L SGSFIL+SGRIGDIYGLK T IGG + F IWS++ G + Y+ N  FFII RAFQGL
Sbjct: 121 FPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGL 180

Query: 179 GVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWI 238
           G+AF+LPNVMG+VGNIY   + RKNIVIS IG  AP+G   G ++ GLI   N  QWPW 
Sbjct: 181 GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWA 240

Query: 239 FFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWS 298
           F+A AIA  INL + IYSIPN++PTNI+   MDW            +NFVWNQ PI GW 
Sbjct: 241 FYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQ 300

Query: 299 KAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTF 358
           KAY                 YE+K A+SP+LP EVTKNRHI+ I+ +LFLGWG+FGI++F
Sbjct: 301 KAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSF 360

Query: 359 YYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNI 418
           YY++F LNLRH+S LWAG+T+F+F I+G++ A+ V   I ++  SV+   S I F  G I
Sbjct: 361 YYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLI 420

Query: 419 IFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYA 478
           + SVT  DQTY+R +LG  IIL+ GMD+SFP ++IILSD L MQYQGM+GSL NT+ NY+
Sbjct: 421 MLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYS 480

Query: 479 TSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRR 538
            SLCLGMGTT E Q N  GK++LKGYRAA Y+ +GL  LG   S  YMAE LW + ++R 
Sbjct: 481 MSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERL 540

Query: 539 QNEKKED 545
            + +  D
Sbjct: 541 SSNRDHD 547

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/559 (52%), Positives = 379/559 (67%), Gaps = 37/559 (6%)

Query: 1   MLKLYRKKLKQQ-------------EEEKNPI--EDFQTTTVTAQTSLDVLSDSVKKDQX 45
           ML +++KK+  Q              ++K  I  ED + TTVT+       S+ V  D  
Sbjct: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNE----SNQVTNDS- 55

Query: 46  XXXXXXXXXXXXXXKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSL 105
                          WQDP YF S  +E  FI TCMLA LLNQAGQT  L  MNVL+ S 
Sbjct: 56  --------------PWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSF 101

Query: 106 NSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTEN 165
           NS+   + WLMASF LA+GSFIL+SGR+GDIYGLK   + G +I  IWSI+ G+SKY+ +
Sbjct: 102 NSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNS 161

Query: 166 VTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGG 225
             FFI CRAFQGLG+AF+LPN+MGLVG++Y VGS+RKN+VIS IG  AP G  FGG++GG
Sbjct: 162 DAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGG 221

Query: 226 LIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXM 285
           LIV  + +QWPW+F+A +IA FI+L+M  YSIPN+VPTN++ L MDW             
Sbjct: 222 LIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILF 281

Query: 286 NFVWNQAPISGWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIIS 345
           NFVWNQAPI+GW +AY                 YE+K AE PLLP  VTKNRH++ I+++
Sbjct: 282 NFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLA 341

Query: 346 LFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVL 405
           +FLGWG+FGIWTFYY +F LNLRH+SP+W G T+FVF+IFGS+ A  VAF+I ++GP++L
Sbjct: 342 VFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAIL 401

Query: 406 FCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQG 465
            C + + F  G+I+FSV   +Q+YW+ +  MQ IL  GMDLSFP SSIILSD LPMQYQG
Sbjct: 402 LCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQG 461

Query: 466 MSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSY 525
           M+GSLVNT+ NY+ SLCLGMG T E Q N  G+++LKGYRAA+Y+ IGL +LG   S +Y
Sbjct: 462 MAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTY 521

Query: 526 MAEDLWIRYRKRRQNEKKE 544
           M E+ W    K +++EKK 
Sbjct: 522 MLENFW---NKHKESEKKR 537

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/488 (54%), Positives = 345/488 (70%), Gaps = 3/488 (0%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           KWQ+P YFK +WQEY FI TCM++ LLNQAG TQTLS MN+L+DS  S+G +K+WLMASF
Sbjct: 55  KWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASF 114

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFIL+SGR+GDIYGLK   + G ++  IWS++CG++KY+ + TFFII RAFQGLG
Sbjct: 115 PLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLG 174

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AFVLPNV+G++GNIY  G+ RKNIVISF+G MAP+G T G ++ GLI   +  QWPW F
Sbjct: 175 IAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAF 234

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A +IA FIN ++ IY+IP+ +PTNI++  MDW            +NFVWNQAPISGW++
Sbjct: 235 YAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQ 294

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE++ A++PLLP  V K+RH++ I+++LF GWG+FGI+TFY
Sbjct: 295 AYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFY 354

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y+ F LN+R ++ LWAG T+F+F+I+G + A+ V FTI  V PSV    S + F  G+I+
Sbjct: 355 YFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIM 414

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SVT   +TY+R  LG  IIL+ GMDLSFP SSII SD LPM+YQGM+GSLVNT+ NY+ 
Sbjct: 415 ASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSM 474

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLGMG T E Q N+ GK +LKGYR A Y+ IGL +L    S  YM E      + RR 
Sbjct: 475 SLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF---IKGRRA 531

Query: 540 NEKKEDKC 547
               E  C
Sbjct: 532 RAAAEYDC 539

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/484 (54%), Positives = 342/484 (70%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           KWQ+P YFK +WQEY FI TCM++ LLNQAG TQTLS MN+L+DS  S+G +K+WLMASF
Sbjct: 58  KWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASF 117

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFIL+SGR+GDIYGLK   + G ++  IWS++CG++ Y+ + TFFIICRAFQGLG
Sbjct: 118 PLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLG 177

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AFVLPNV+G++GNIY  G+ RKNIVISF+G MAP+G T G ++ GLI   N +QWPW F
Sbjct: 178 IAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAF 237

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A +IA  IN  + IY+IPN++PTNI++  MDW            +NFVWNQAPISGWS+
Sbjct: 238 YAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQ 297

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE+  A+SPLLP  V K+ H++ I+++LF GWG+FGI+TFY
Sbjct: 298 AYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFY 357

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y+ F LN+RH++ LWAG T+F+F+I+G + A+ V FTI  V PSV    S + F  G+I+
Sbjct: 358 YFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIM 417

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SVT   +TY+R  LG  IIL+ GMDLSFP SSII SD LPM+YQGM+GSLVNT+ NY+ 
Sbjct: 418 ASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSM 477

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLGMG T E Q +  GK +LKGYR A Y+ IGL +L    S  YM E     ++ +  
Sbjct: 478 SLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAA 537

Query: 540 NEKK 543
            E  
Sbjct: 538 TEND 541

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/486 (53%), Positives = 342/486 (70%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           KWQ+P YFK  WQEY FI TCM++ LLNQ+G TQTLS MN+LADS  SD  +++WLMASF
Sbjct: 66  KWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASF 125

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFIL+SGR+GDI+GLK   + G ++  IWS++CG++KY+ + TFFI+ RAFQGLG
Sbjct: 126 PLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLG 185

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AFVLPNV+G++GN+Y  G+ RKNIVISFIG MAP+G T G  + GLI   N +QWPW F
Sbjct: 186 IAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAF 245

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A  I   INLI+ IY+IPN++PTN++   MDW            +N VWNQAPISGW++
Sbjct: 246 YAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQ 305

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE+  A+SPLLP  V K+RH++ I++SLF GWG+FGI+TFY
Sbjct: 306 AYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFY 365

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y+ F LN+RH++PLWAG ++F+F+I+G + A+ V F+I +V PSV    + + F  G+I+
Sbjct: 366 YFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIM 425

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SVT   +TY+R  +G  IIL+ GMDLSFP SSII SD LPM+YQGM+GSLVNT+ NY+ 
Sbjct: 426 ASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSM 485

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLGMG T E+Q +  GK +LKGYR A Y+ IGL +L    S  YM E     +R +  
Sbjct: 486 SLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAV 545

Query: 540 NEKKED 545
            E K  
Sbjct: 546 AEDKRS 551

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/540 (51%), Positives = 363/540 (67%), Gaps = 8/540 (1%)

Query: 1   MLKLYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXK 60
           M +++ +K  + EE    I +   +++T +TS+    D +++ +               K
Sbjct: 1   MFRIFNRKSHRSEE----IMESAASSITEETSIIKHGD-IEEIEKDVISQTETPQLEHSK 55

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQ+P YF++ WQEY FI +CM++ LLNQA   QTLS MN++ DS NS+G  +TWL+ASF 
Sbjct: 56  WQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFP 115

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFIL+SGRIGDIYGLK T +GG I F IWSI+ G++KY+ + TFFI+ RAFQGL +
Sbjct: 116 LVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSI 175

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF+LPNVMG+VGNIY   S RKNIVIS IG  AP+G  FG ++ GLI   + DQWPW F+
Sbjct: 176 AFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A AIA   NL + IYSIPN VPTN++   MDW            +NFVWNQ PI GW  A
Sbjct: 236 AFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTA 295

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 YE+K AESPLLP EVTKNRHI+ I+ +LFLGWG+FGI++FYY
Sbjct: 296 YIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYY 355

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           ++F LNLRH+S LWAG+T+F+F I+G++ A+ V   I K+  + +  +S + F  G I+ 
Sbjct: 356 FSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIML 415

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVT  DQTY+R +LG  IIL+ GMD+SFP ++IILSD L MQYQGM+GSL NT+ NY+ S
Sbjct: 416 SVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMS 475

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           LCLGMGTT E Q N  G D+LKGYR A Y+ IGL  LG   +  Y+ E LW    KR+Q+
Sbjct: 476 LCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILW---GKRKQH 532

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/541 (51%), Positives = 356/541 (65%), Gaps = 20/541 (3%)

Query: 11  QQEEEKNPIEDFQTTTVTAQTSLD-----VLS-DSVKKDQXXXXXXXXXXXXXXXKWQDP 64
             E+ KNP E      + +++SL+     VLS D+   D+                +Q+P
Sbjct: 20  NNEDCKNP-EQQSLKNIDSRSSLNSSLTQVLSTDTADNDESS-------------SYQNP 65

Query: 65  TYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASG 124
            YFK+ +QE+ FI + M+  LL+QAG TQTLS MNVLA  L+S  + + WLM+SF LA G
Sbjct: 66  DYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALG 125

Query: 125 SFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVL 184
           SFILVSGR+GDIYGLK   +GG II  +WSI+CG+S Y  N  FFI  RAFQGLG+AF L
Sbjct: 126 SFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFAL 185

Query: 185 PNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAI 244
           PN++GL+G IY  G  RKN++IS IG M+P G T GG++ GL V  +K  WPW F+A  +
Sbjct: 186 PNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGL 245

Query: 245 AVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXX 304
             F+NLI+  Y IPN +PTNI+ LKMDW            +NFV+NQAPI GW  AY   
Sbjct: 246 ISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIV 305

Query: 305 XXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFN 364
                         YE+K A++PL+P  ++ NR ++ I+ SLF GWG+FGIWTFYY++F 
Sbjct: 306 LLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFE 365

Query: 365 LNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTS 424
           LNLRH+SPLWAGS++F+F+I GS  AI    TI K+ PSVLFC S +GF  GNIIF+ T 
Sbjct: 366 LNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATP 425

Query: 425 PDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLG 484
            +QT++RN LG   +L LGMD SFP SSIILSD LPMQYQGM+GSLVNT+ NY+TS+CLG
Sbjct: 426 VNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLG 485

Query: 485 MGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544
           M  T E+++N+ GKD+L GYRAA+Y AIGL  L    S  YM E LW       +  K+ 
Sbjct: 486 MAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQT 545

Query: 545 D 545
           D
Sbjct: 546 D 546

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/486 (53%), Positives = 337/486 (69%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           KWQD TYF++ WQEY F+GTCM++ LLNQA   QTLS MN+L  S +S+   +TWLMASF
Sbjct: 55  KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASF 114

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFIL+SGR+GDIYGLK + +GGNI F IW+++ G + YT + TFFI+ R+FQGLG
Sbjct: 115 PLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLG 174

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           VAF+LPNVMG VGNIY   + RKNIVIS IG  APVG   G  + GLI   N D WPW F
Sbjct: 175 VAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSF 234

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A AIA  + L+  +YSIPNH+PTN++   MDW            +NFVWNQ PI GW K
Sbjct: 235 YAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGK 294

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE+  A SPLLP  +T+NRH+V I+++LFLGWG+FGI++FY
Sbjct: 295 AYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFY 354

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y+AF LNLRH+S +WAG T+F+F I+G + ++ V  +I K+  S++   S I F  G I+
Sbjct: 355 YFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIM 414

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SVT   QTY+R +LG  IIL+ GMD+SFP ++IILSD LP QYQGM+GSL NT+ NY+ 
Sbjct: 415 LSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSM 474

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLGMG+T E Q N  GKD+LKGYRAA Y+ IG+ +L    S  YM E LWI  ++R +
Sbjct: 475 SLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERME 534

Query: 540 NEKKED 545
           +  + +
Sbjct: 535 STSETN 540

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 335/482 (69%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           +WQ+P YFK+SW EY FI TCM++ LLNQAG TQTLS MN++A+S  S+  ++TWLMASF
Sbjct: 56  RWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASF 115

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFIL+SGR+GDIYGLK     G ++  IWS++CG++KY+ + TFFII RAFQGLG
Sbjct: 116 PLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLG 175

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AFVLPNV+G++GNIY  G+ RKNIVIS +G MAPVG T G ++ GLI   N  QWPW F
Sbjct: 176 IAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAF 235

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A  I   INL + +YSIPN++PTNI +  MDW            MNFVWNQAPISGW +
Sbjct: 236 YAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQ 295

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE + A+SPLLP  V K+RH++ I+++LF GWG+FGI+TFY
Sbjct: 296 AYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFY 355

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y+ F LN+RH+S +WAG T+F+F+I+G + A+ V   I KV PSV   LS + F  G+I+
Sbjct: 356 YFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIM 415

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SVT   +TY+R  LG  IIL+ GMD SFP SSII SD LPM+YQGM+GSLVNT+ NY+ 
Sbjct: 416 ASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSM 475

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLGMG T E   +  GK VLKGYR A Y+ IGL +L    S  YM E +   ++ + +
Sbjct: 476 SLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535

Query: 540 NE 541
             
Sbjct: 536 GR 537

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/520 (49%), Positives = 336/520 (64%)

Query: 20  EDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPTYFKSSWQEYTFIGT 79
            D   +TV +   +D     V  D                  Q P YF S   E+ FI T
Sbjct: 24  SDSDNSTVNSSQKIDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFT 83

Query: 80  CMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGL 139
           C++  LLNQAG TQ++S MN++A+   S+ + + WL ASF L SGSFILV GR GDIYGL
Sbjct: 84  CLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGL 143

Query: 140 KATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGS 199
           K   + G  I  IWSI+CG++ YT +  FFI+ +AFQGLGV+F+LPN++GLVG IY  GS
Sbjct: 144 KKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGS 203

Query: 200 MRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPN 259
           M+KNI ISFIG MAP+G TFGG++ G++V  +   WPW F+A AI  F+  +   + +P+
Sbjct: 204 MKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPD 263

Query: 260 HVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXXXXXXXXXXXXXXXY 319
           +VPTN  NLKMDW             +FVWNQAP+ GW KAY                 Y
Sbjct: 264 NVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIY 323

Query: 320 ELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTH 379
           E+  AE PLLP  +T NRHI+ I++++F+GWG FGIW+FYY++F+LNLRHFSP+W G  +
Sbjct: 324 EINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAY 383

Query: 380 FVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQII 439
           F FI+ G   A  V F I  + PS++  +S  GFT GN+IF+VT  DQTYWRN+ GM ++
Sbjct: 384 FAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLL 443

Query: 440 LALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKD 499
           L LGMDLSFP SSIILSD LP +YQGM+GSLVNT+ NY+ S CLG+ TT E Q N+ G D
Sbjct: 444 LPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDD 503

Query: 500 VLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           +LKGYRAA Y  +G+G LG + +  YM E  W  Y+++ +
Sbjct: 504 LLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/486 (51%), Positives = 333/486 (68%), Gaps = 5/486 (1%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           KWQ+P YF S+ +EY F+ +C ++ LLNQAG  QT   MN++ADSL+S    + WLMA+F
Sbjct: 49  KWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAF 108

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFIL+SGRIGDIYGLK T + G +   +WS++CG++KY  + +FFI+ RAFQGLG
Sbjct: 109 PLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           ++ +LPN++G+VG+IY  GS RKN+VIS IGCMAP+G T G ++ GLI   + +QWPW F
Sbjct: 169 ISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAF 228

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           ++ AI   IN ++ I+ IPN +PTN++  KMDW            +NFVWNQAPI GW  
Sbjct: 229 YSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDS 288

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAE-SPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTF 358
           AY                 YEL     +PLLP EV K+   + ++ +LF GWG+FGI++F
Sbjct: 289 AYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSF 348

Query: 359 YYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNI 418
           YY+ F LNLRH++PLWAG T+F+F+I+G + A+ V FTI KV PS++  LS + F CG+I
Sbjct: 349 YYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSI 408

Query: 419 IFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYA 478
           I SVT   QTY+RN LGM IIL+ GMDLSFP SSI+LSD LP+QYQGM+GSLVNT+ NY+
Sbjct: 409 IMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYS 468

Query: 479 TSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRR 538
            S CLG+    E   NN GKDVLKGYR A Y+ IGL ++    S + M  ++     + R
Sbjct: 469 MSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEI----IQGR 524

Query: 539 QNEKKE 544
           +NEK  
Sbjct: 525 KNEKDS 530

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  521 bits (1341), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 250/481 (51%), Positives = 324/481 (67%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           WQDP YFK  W E  F+ +CM+  LLNQAG T TLSTM VL   L+S  A  +WLMASF 
Sbjct: 51  WQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFP 110

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L SGSFIL+SGR+GDIYGLK   + G I   IWS++CG+S ++ N TFFI  RAFQGLG+
Sbjct: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGI 170

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           +FVLPN++G+VGNIY  G+ RKNIVIS IG  AP+G TFGG++ G++V      WPW F+
Sbjct: 171 SFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFY 230

Query: 241 ATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
           A  IA F+  I+  + IPN +P N+    MDW             NFVWNQ+ + GW+  
Sbjct: 231 AYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATG 290

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYY 360
           Y                 +E+K A+ PLLP EVT++R I+ I+ SL  GWG+FGIW FYY
Sbjct: 291 YIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYY 350

Query: 361 YAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
           + F L LR++SP+WAG T F+  I G + A+TV F+I +VGP+VL   S I FTCG+II 
Sbjct: 351 FQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIIL 410

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
           SVT   +TY+R+ LG  +IL+ GMDLSFP +SIILSD L MQYQGM+GSLVNT+ NY+ S
Sbjct: 411 SVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMS 470

Query: 481 LCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQN 540
           L LG+G T E Q N  G  +L+G+RAALY AIG+G+LG   S  ++ +   +R + R++N
Sbjct: 471 LFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKEN 530

Query: 541 E 541
           E
Sbjct: 531 E 531

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  518 bits (1333), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 251/486 (51%), Positives = 329/486 (67%), Gaps = 2/486 (0%)

Query: 62  QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTL 121
           ++P YF S+ QEY FI +CML+ LLN AG TQTLS MNVL   L+S  + K WL+ASF L
Sbjct: 43  RNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPL 102

Query: 122 ASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVA 181
            SGSFILVSGR+GDIYGLK   I G +I  IWS++ G+S Y+ +  FFII RAFQGLG++
Sbjct: 103 VSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGIS 162

Query: 182 FVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFA 241
            VLPNV+GL+G IY  G+++KN+VIS +G M+P+G T GG++ GL+   ++  WPW F+A
Sbjct: 163 LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYA 222

Query: 242 TAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAY 301
             +A FIN  +  YSIPN++PTN+  L MDW             NFVWNQAP  GW+ AY
Sbjct: 223 YTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAY 282

Query: 302 XXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYY 361
                            YEL+ AE+PLLP E+ +NR ++ I+ ++  GWG+FGIWTFYY+
Sbjct: 283 LIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYF 342

Query: 362 AFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFS 421
           +F LNLR++SPLWAG ++F+F+I G++TAI+  F + K+ P+VL   S +GF  G IIFS
Sbjct: 343 SFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFS 402

Query: 422 VTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSL 481
           VT   QTY+RN LG  IIL LGMDLSFP SSIILSD LP Q+QGM+GSLVNT+ NY+ SL
Sbjct: 403 VTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSL 462

Query: 482 CLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNE 541
            LG+  T E   N  G D+L+GYR ALY  I    +    +  YM E ++  Y+ R+  E
Sbjct: 463 FLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRK--E 520

Query: 542 KKEDKC 547
           K  + C
Sbjct: 521 KDCENC 526

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  513 bits (1322), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/488 (51%), Positives = 332/488 (68%), Gaps = 7/488 (1%)

Query: 60  KW---QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLM 116
           KW   QDPTYF + W+EY FI   M++ LLNQAG TQTLS +N+L+ + +S  + +TWLM
Sbjct: 37  KWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLM 96

Query: 117 ASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQ 176
           ASF L SGSFILVSG+IGDIYGLK T + G ++  IWS++CG++ YT +V FFII RAFQ
Sbjct: 97  ASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQ 156

Query: 177 GLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWP 236
           GLG+AF+LPN+MG+VGNIY  G+ RKN+VIS IG  AP+G T G ++ GLI  +  ++W 
Sbjct: 157 GLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLI-GTLSERWA 215

Query: 237 WIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISG 296
           W F+A  I   IN+ + I+ IPN +PTN+    MDW             NFVWNQ PI G
Sbjct: 216 WTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVG 275

Query: 297 WSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIW 356
           W  AY                 YE K A  PL+P     N  ++  ++++F GWG+FGIW
Sbjct: 276 WDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIW 335

Query: 357 TFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCG 416
           TFYY+ F LNLR ++PLWAG ++F+F+I+G + AI+V +TI ++ PS++  LS + F CG
Sbjct: 336 TFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCG 395

Query: 417 NIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITN 476
            I+ SVT  DQTY+R  LGM IIL+ GMDLSFP SSIILSD LPM+ QGM+GSLV+T+ N
Sbjct: 396 CIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMIN 455

Query: 477 YATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRK 536
           Y+ S+CLG+  T E Q N  G D+LKGYRAALY+ IGL +LG   S  +M E+     R 
Sbjct: 456 YSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLEN---YLRM 512

Query: 537 RRQNEKKE 544
           RR+N K+E
Sbjct: 513 RRRNVKEE 520

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  512 bits (1319), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 250/478 (52%), Positives = 328/478 (68%), Gaps = 1/478 (0%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           + Q+P YF   W+EY F+ + ML+ LLNQA  TQT    +VL+  LN+  + + WLMASF
Sbjct: 37  RLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASF 96

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFILVSG++GDIYGLK T +GG ++  IWS++CG+S Y  NV FF++ R+FQGLG
Sbjct: 97  PLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AFVLPNVMG+VGNIY   +  KN+V S IG  AP+G T G ++ GLI  +  D W W F
Sbjct: 157 IAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLI-GARTDLWGWTF 215

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A AI   +N ++ ++ IPN++PTN+   KMDW             NFVWNQAPI+GW  
Sbjct: 216 YAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGS 275

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE++ A+ PLLP  V  NR ++ I+ SLF GWG+FGIWTFY
Sbjct: 276 AYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFY 335

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y +F LNLRH+SPLWAG T+F+F I+G + ++ V +TI+K GP+V+  LS + F CG I+
Sbjct: 336 YMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIM 395

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            +VT   QTY+R +LG+ IIL+ GMDLSFP +SIILSD LP QYQGM+GSLV+T+ +Y+ 
Sbjct: 396 LAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSM 455

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKR 537
           SLCLG+  TAE Q N  G D+LKGY+AALYV IGL +LG   S ++M ED W   RKR
Sbjct: 456 SLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  508 bits (1309), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 248/487 (50%), Positives = 322/487 (66%), Gaps = 1/487 (0%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           + Q+P YF   W+EY F+ + ML+ LLNQA   Q     ++L++ L +  + + WLMASF
Sbjct: 37  RLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASF 96

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L SGSFILVSG++GDIYGLK T +GG  +  IWS++CG+S Y  NV FFI+ R+FQGLG
Sbjct: 97  PLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLG 156

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AFVLPNV G+VGNIY   +  KN+V S IG  AP+G T G ++ GLI  +  + W W F
Sbjct: 157 IAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLI-GTESEAWAWTF 215

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A  I   +N ++  Y IP+++PTN++  KMDW             NFVWNQAP  GW  
Sbjct: 216 YAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDS 275

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 +E + A+ PLLP  V  NR ++ I+ SLFLGWG+FGIWT+Y
Sbjct: 276 AYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYY 335

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y AF LNLRH++PLWAG ++F+F IFG++ A  V  TI+K GP+++   S I F  G I+
Sbjct: 336 YMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIM 395

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SVT  DQTY+R SLG  +IL+ GMDLSFP SSIILSD LP QYQGM+GSLVNT+ NY+ 
Sbjct: 396 LSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSM 455

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLG+  TAE Q N  G D+LKGYRAALYV IGL ++G   S +Y  ED W R R+R  
Sbjct: 456 SLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSV 515

Query: 540 NEKKEDK 546
             K ++K
Sbjct: 516 RIKLDEK 522

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  496 bits (1276), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 249/540 (46%), Positives = 343/540 (63%), Gaps = 7/540 (1%)

Query: 6   RKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPT 65
           +++    + +KN  +D QT T   +    + S S   D                K   P 
Sbjct: 37  KERKDYFQLKKNYSQDSQTNTSMNEVIGSISSVSNDSD------INSENLQSENKVLSPK 90

Query: 66  YFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGS 125
           YFK+   EY FI +CM++  ++QAG TQ LS MN+LA+ LN++ + + WLMASFTL+ GS
Sbjct: 91  YFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGS 150

Query: 126 FILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185
           FILVSGR+GDIYGLK   +GG  I  IWS++CG S Y+ N  FFI  RAFQGLG+AFVLP
Sbjct: 151 FILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLP 210

Query: 186 NVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIA 245
           N +GL+G IY  GSM+KN++I  +G M+P+G T GG++ G+I   +  QWPW F++  I 
Sbjct: 211 NSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIV 270

Query: 246 VFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXX 305
            F N+I+  YSIPN++PTNIYNL MDW            +NFV+NQAPI GW  AY    
Sbjct: 271 SFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVL 330

Query: 306 XXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNL 365
                        YE+K A++PL+P  ++ NR ++ I+ +LF GWGAFG WTFYY++F L
Sbjct: 331 LVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVL 390

Query: 366 NLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSP 425
           N+R ++  WAG ++F+FI+ G   A    F + KV PSV+  +S IGF  G ++ +VT  
Sbjct: 391 NVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPI 450

Query: 426 DQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGM 485
            Q+Y++N LG+  +L +G+DLSFP +SIILSD LP+QYQGM+GSLV TITNY+TS+CLGM
Sbjct: 451 HQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGM 510

Query: 486 GTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLW-IRYRKRRQNEKKE 544
             + E  +N+ G+++LKGYR A+  A  L  LG   S  YM  +L  IR   +  N+ K 
Sbjct: 511 AGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNKPKH 570

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  486 bits (1250), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 249/480 (51%), Positives = 324/480 (67%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           KWQDP YFK+S+QEY F+G+CM   LLNQA   QTLS MNVL+DS NS  + +TWL+ASF
Sbjct: 36  KWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASF 95

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L +GSFIL+SGRIGDIYGLK T IGG I   IWS++CG + Y+++ TF II RAFQGLG
Sbjct: 96  PLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLG 155

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           +AF LPNV+G +GNIY+VGS+RKN+VIS I   APVG   GG + GLIV  +  QWPW F
Sbjct: 156 IAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSF 215

Query: 240 FATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSK 299
           +A AIA   NL++ IYSIP+++PTN+   KMDW             NF WNQ PI GW  
Sbjct: 216 YAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDI 275

Query: 300 AYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY 359
           AY                 YE+  A SPL+  E+T +R+++  I +LFLGWG++GIW+FY
Sbjct: 276 AYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFY 335

Query: 360 YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNII 419
           Y++F LNLRH+SP+WAG ++F+F IFG L +  V  +I K+   V+   S + F  G  +
Sbjct: 336 YFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTL 395

Query: 420 FSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYAT 479
            SV   DQ+Y++ +L    IL +G+D SFP ++IILSD LPM+YQGM+GSL  T+ NY+ 
Sbjct: 396 LSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSM 455

Query: 480 SLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539
           SLCLGMG T E Q N  G+DVLKGYR+A Y+ IGL  LG   +   + + L  +YR +  
Sbjct: 456 SLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLLACILVIDKLVAKYRNKNS 515

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  424 bits (1091), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/481 (43%), Positives = 293/481 (60%), Gaps = 1/481 (0%)

Query: 62  QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTL 121
           + P  FK+ +QE+ F+   ++   L+Q G TQ LSTMN+LA+ L++    + WLMA+F L
Sbjct: 111 RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPL 170

Query: 122 ASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVA 181
             G  IL+SGR+GDI+GLK   + G II  IW+++CG S Y  +   FI+ R FQGLG+A
Sbjct: 171 GLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLA 230

Query: 182 FVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFA 241
             LPN+  L+G IY     +KN++   IG M+P+G T GG++ GL V  N   WPW F++
Sbjct: 231 CALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYS 290

Query: 242 TAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAY 301
            AI  F+N I+  + IPN +  N   LKMDW            +NFV+NQ PI GWS AY
Sbjct: 291 FAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAY 350

Query: 302 XXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYY 361
                            YEL  A  PL+P  +  N  ++ I+++LF GWG F IWTFYY+
Sbjct: 351 LIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYF 410

Query: 362 AFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFS 421
           AF LNLRH+SPLWA S++FV II G++  I     + ++ P +L   S +GF  GNI+F+
Sbjct: 411 AFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFA 470

Query: 422 VTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSL 481
           VT   QT++RN  G   +  LGM  SFP +S++ ++ LP  Y+ M+GSLVN   NYATS+
Sbjct: 471 VTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSI 530

Query: 482 CLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWI-RYRKRRQN 540
           C+GM  +A V +NN G+D+L G+RAA Y+AIGL       S  YM   +W  R +K ++N
Sbjct: 531 CVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKEN 590

Query: 541 E 541
           +
Sbjct: 591 K 591

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  278 bits (711), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 176/536 (32%), Positives = 274/536 (51%), Gaps = 39/536 (7%)

Query: 23  QTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPTYFKSSWQEYTFIGTCML 82
            T++   Q +LD  ++++KK+                  QD    KS   E  F+G    
Sbjct: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDI---------QDERP-KSLLWESAFVGVLCS 51

Query: 83  ANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSGRIGDIYGLKA 141
           A L+ QAG  Q+L+ ++++ +S  +  A + +W  ++++L  G+FIL++GR+GDI+G K 
Sbjct: 52  AQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK 111

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
            F+ G   + +WS+L G S Y+  + FF  CRAFQG+G AF+LPN + ++G  Y  G  R
Sbjct: 112 FFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-R 169

Query: 202 KNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ---WPWIFFATAIAVFINLIMGIYSIP 258
           KN+V S  G  AP     GG + G +  S   Q   WPW ++   IA F+  + G + IP
Sbjct: 170 KNMVFSLFGASAP-----GGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIP 224

Query: 259 NHVP-----TNIYNL--KMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXXXXXXXX 311
            H P      + + L  ++D+             NF WNQ P+ GW   Y          
Sbjct: 225 -HTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTF 283

Query: 312 XXXXXXXYELKKAESPLLP-PEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHF 370
                   E  +A  PLLP   ++ +   V   I+   GW +FGIW FY + F  + R  
Sbjct: 284 FLVIFAYIE-SRAAFPLLPFAALSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQ 340

Query: 371 SPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYW 430
           +PL + +      I G   A+T  F ++   PS +   +   FT G I+ +     QTYW
Sbjct: 341 TPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYW 400

Query: 431 RNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAE 490
             +    I++  GMD+SFP ++I+LSD +P ++QG++ SLVNT+ NY+ S+ LG+  T E
Sbjct: 401 AQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIE 460

Query: 491 VQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRY--RKRRQNEKKE 544
            + N+GG   LKGYR + Y+ IGL  LG   + +Y     W  +   K+R +EK+ 
Sbjct: 461 SRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYA----WSTFMKSKKRISEKQH 512

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  277 bits (708), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 161/481 (33%), Positives = 250/481 (51%), Gaps = 19/481 (3%)

Query: 73  EYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSG 131
           E  F+G    A L+ QAG  Q+L+ ++++ DS  +    + +W  ++++L  G+FIL++G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 132 RIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLV 191
           R+GDI+G K  F+ G   + +WS+L G S Y+  + FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 192 GNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLI 251
           G  Y  G  RKN+V S  G  AP G   G ++  ++       WPW ++   IA F+  +
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218

Query: 252 MGIYSIPNHVPTNIYNL-------KMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXX 304
            G Y IP H P    ++       ++D+             NF WNQ P+ GW   Y   
Sbjct: 219 AGYYLIP-HTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 277

Query: 305 XXXXXXXXXXXXXXYELKKAESPLLP-PEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAF 363
                          E  +A  PLLP   ++ +   V   I+   GW +FGIW FY + F
Sbjct: 278 LLIVGTVFLIIFAFIE-SRAAFPLLPFAALSSDTAFVLSCIAA--GWASFGIWIFYTWQF 334

Query: 364 NLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVT 423
             + R  +PL + +      I G   A+   F ++   PS +   +   FT G I+ +  
Sbjct: 335 MEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATA 394

Query: 424 SPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCL 483
              QTYW  +    I++  GMD+SFP ++I+LSD +P ++QG++ SLVNT+ NY+ S+ L
Sbjct: 395 PVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGL 454

Query: 484 GMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKK 543
           G+  T E   N+GG +VLKGYR + Y+ IGL   G   + +Y          K+R +EK+
Sbjct: 455 GIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTF--MKSKKRVSEKQ 512

Query: 544 E 544
            
Sbjct: 513 H 513

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  275 bits (704), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/477 (33%), Positives = 247/477 (51%), Gaps = 14/477 (2%)

Query: 73  EYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSG 131
           E  F+G    A L+ QAG  Q+++ ++++ DS  +    + +W  A+++L  G+FIL++G
Sbjct: 45  EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 132 RIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLV 191
           R+GD+YG K  FI G   + +WS+L G S Y+  + FF  CRAFQG+G A +LPN + ++
Sbjct: 105 RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGIGPALLLPNAIAIL 163

Query: 192 GNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLI 251
           G  Y  G  RK +++S  G  AP G   G ++  +        WPW ++A  I  F   +
Sbjct: 164 GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIF--GQLTWWPWAYWAMGIVCFFLAV 220

Query: 252 MGIYSIPN----HVPTNIYNL-KMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXXX 306
            GI  IP      + T++    ++D             +NF WNQ P+ GW   Y     
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 307 XXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLN 366
                        E  +A  PLLP     +     ++  +  GW +FGIW +Y++ F   
Sbjct: 281 IVSAVFLCVFAFIE-SRAPHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 367 LRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPD 426
           LR  SPL   +      I G   A+T  F I +V  S++   +   FT G I+ +     
Sbjct: 339 LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 427 QTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMG 486
           Q YW  +    I++  GMD+SFP ++I+LSD +P ++QG++ SLVN + NY+ S+ LG+ 
Sbjct: 399 QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 487 TTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKK 543
            T E + NNGG ++LKGYR A Y+ IGL   GF    ++M E    +  K+  +EK 
Sbjct: 459 GTVEGRVNNGGANLLKGYRGAWYMGIGLS--GFGILIAFMYEYHTFKKSKKMPSEKP 513

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  273 bits (699), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 163/491 (33%), Positives = 252/491 (51%), Gaps = 18/491 (3%)

Query: 62  QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFT 120
           QD T     W E  F+G    A L+ QAG  Q+L+ ++++  S  +    + +W  ++++
Sbjct: 33  QDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYS 91

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L  G+FIL++GR+GDI+G K  F+ G   + +WS+L G S Y+  + FF  CRAFQG+G 
Sbjct: 92  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGP 150

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF+LPN + ++G  Y  G  RKN+V S  G  AP G   G ++  L+       WPW ++
Sbjct: 151 AFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYW 207

Query: 241 ATAIAVFINLIMGIYSIPN------HVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPI 294
              IA F   I G + IP+      H  +     ++D+             NF WNQ P+
Sbjct: 208 IMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPV 267

Query: 295 SGWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLP-PEVTKNRHIVTIIISLFLGWGAF 353
            GW   Y                  E  +A  PLLP   ++ +   V   I+   GW +F
Sbjct: 268 VGWQTPYTYILLIVGTVFLAIFAFIE-SRAAFPLLPFAALSSDTAFVLSCIAA--GWASF 324

Query: 354 GIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGF 413
           GIW FY + F  + R  +PL + +      + G   A+T  + +++  PS +   +   F
Sbjct: 325 GIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAF 384

Query: 414 TCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNT 473
           T G I+ +     QTYW  +    I++  GMD+SFP ++I+LSD +P ++QG++ SLVNT
Sbjct: 385 TAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNT 444

Query: 474 ITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIR 533
           + NY+ S+ LG+  T E   N+GG   LKGYR + Y+ IGL  LG   +  Y       +
Sbjct: 445 VVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTF--K 502

Query: 534 YRKRRQNEKKE 544
             K+R +EK+ 
Sbjct: 503 KSKKRTSEKQH 513

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  273 bits (698), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/490 (33%), Positives = 260/490 (53%), Gaps = 18/490 (3%)

Query: 62  QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFT 120
           QD T     W E  F+G    A L+ QAG  Q+++ ++++ DS  +    + +W  +S++
Sbjct: 33  QDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYS 91

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           L  G+FIL++GR+GDI+G +  FI G   + +WS+L G S Y+  + FF  CRAFQG+G 
Sbjct: 92  LTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGP 150

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF+LPN + ++G  Y  G  RKN+V S  G  AP G   G ++  ++       WPW ++
Sbjct: 151 AFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYW 207

Query: 241 ATAIAVFINLIMGIYSIPN-HVPTN---IYNL--KMDWXXXXXXXXXXXXMNFVWNQAPI 294
              IA F+  + G + IP+  +P+     +N+  ++D+             NF WNQ P+
Sbjct: 208 IMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPV 267

Query: 295 SGWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLP-PEVTKNRHIVTIIISLFLGWGAF 353
            GW   Y                  E  +A  PLLP   ++ +   V   I+   GW +F
Sbjct: 268 VGWETPYTYVLLIVGTVFLGVFVFIE-SRAAYPLLPFAALSSDAAFVLGCIAA--GWSSF 324

Query: 354 GIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGF 413
           GIW FY + F    R  SPL + +      I G   A+T  F ++    S +   +   F
Sbjct: 325 GIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAF 384

Query: 414 TCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNT 473
           T G I+ +     QTYW  +    I++  GMD+SFP ++I+LS+ +P ++QG++ SLVNT
Sbjct: 385 TVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNT 444

Query: 474 ITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIR 533
           + NY+ S+ LG+  T E Q N+GG + LKGYR + Y+ IGL  LG  F  +  A   +++
Sbjct: 445 VVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLSGLGI-FVAAVYASSTFLK 503

Query: 534 YRKRRQNEKK 543
             K++ +EK+
Sbjct: 504 -SKKKASEKQ 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  270 bits (689), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 157/485 (32%), Positives = 251/485 (51%), Gaps = 13/485 (2%)

Query: 68  KSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLN-SDGAAKTWLMASFTLASGSF 126
           +S  +E  F+G    A L+ QAG  Q+++ + ++ +S   S+    +W  A+++L  G+F
Sbjct: 34  QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTF 93

Query: 127 ILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPN 186
           IL++GR+GD++G K  F+ G + + +WS+L G S Y+ N  FF  CRA QG+G AF+LPN
Sbjct: 94  ILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPN 152

Query: 187 VMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAV 246
            + ++G  Y  G  RK +V S  G  AP G   G ++  +   S    WPW ++A   A 
Sbjct: 153 SIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTAC 209

Query: 247 FINLIMGIYSIPNHVPTNI-----YNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAY 301
            +  + GI  IP   P  I        ++D             +NF WNQ P+ GW   Y
Sbjct: 210 LVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPY 269

Query: 302 XXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYY 361
                             E  +A  PLLP     +  +  ++  +  GW +FGIW FY++
Sbjct: 270 TYALLIVGFVFLLVFSLIE-SRARFPLLP-FAALSTDLAYVLGCIAAGWSSFGIWIFYFW 327

Query: 362 AFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFS 421
            F  + R  SPL   +      I G   A+T  + ++ V    +  ++ I FT G ++ +
Sbjct: 328 QFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVA 387

Query: 422 VTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSL 481
               +QTYW  +    II+  GMD+SFP ++I++S+ +P ++QG++ SLVNT+ NY+ SL
Sbjct: 388 TAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISL 447

Query: 482 CLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNE 541
            LG   T E + NN G + L+GYR A Y+ IGL  LG   +  Y    L  ++++ + +E
Sbjct: 448 ALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTL-KKFKEEQLSE 506

Query: 542 KKEDK 546
           K  + 
Sbjct: 507 KSSNN 511

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  266 bits (680), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 163/479 (34%), Positives = 258/479 (53%), Gaps = 9/479 (1%)

Query: 61  WQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFT 120
           W   + F    +EY F+ T ++A   NQAG T  L  +NVL+DS +       +L+ S+ 
Sbjct: 38  WLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYP 92

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
           +  GSF+L+ GR+G+++G K T +GG II  + S+L G+S+Y+++  F++ICRAFQG+G+
Sbjct: 93  MVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGM 152

Query: 181 AFVLPNVMGLVGNIYN--VGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWI 238
           A +LPN        Y     + RK I+ + IGC A  G   G    G+ V  ++  W W 
Sbjct: 153 ALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWA 212

Query: 239 FFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPISGWS 298
           ++   IA  + L +  YS+P+++                       +N   N A ++  +
Sbjct: 213 YYTYTIAATLTLALSYYSVPDNITKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSN 272

Query: 299 KAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTF 358
            ++                 +ELK +E P+   E+  N  +  ++ S+F GWG +GIW+ 
Sbjct: 273 WSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSG 332

Query: 359 YYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNI 418
           Y++ F LNLR++SPL AGST+   +I G +  I ++  + + GP +    SS+GFTC  I
Sbjct: 333 YFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSII 392

Query: 419 IFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYA 478
           I SVT   Q+Y+R++LG  I LALG+D SFP S+IIL + LP +Y  M+  L N I NYA
Sbjct: 393 ILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYA 452

Query: 479 TSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKR 537
            S   G+  +A    ++   +++K YR   Y AIGL A+G   +   +A    + YR +
Sbjct: 453 ISFWPGICNSALRSLSS--IELIKYYRYVYYFAIGLSAIGLFAAGIQLARASIMYYRGK 509

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  260 bits (665), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 146/434 (33%), Positives = 226/434 (52%), Gaps = 12/434 (2%)

Query: 83  ANLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSGRIGDIYGLKA 141
           A L+ QAG  Q++  + ++ DS       + +W  ++F+L  G+FIL++GR+GD +G K 
Sbjct: 39  AQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKK 98

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
            F+ G + + +WSIL G S Y+  + FF  CRAFQG+G AF LPN + ++   Y  G  +
Sbjct: 99  FFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-K 156

Query: 202 KNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHV 261
           +N++ S  G  AP G   G ++  L+  S    WPW ++   I  F+  + G   IP+H 
Sbjct: 157 QNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP 214

Query: 262 PTNIYNL-----KMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXXXXXXXXXXXXX 316
           P +         ++D              NF WNQ P+ GW  +Y               
Sbjct: 215 PIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF 274

Query: 317 XXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAG 376
              E  +A+ PLLP     +  I  ++  +  GW +FGIW +Y +    NLR   PL + 
Sbjct: 275 GFIE-SRAKHPLLPVRKLSSDTIF-VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSS 332

Query: 377 STHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGM 436
           +      I G   A++  F + +  PS +  ++ I FT G+I+ +     QTYW  +   
Sbjct: 333 AQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVS 392

Query: 437 QIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNG 496
            I++  GMD+SFP ++IILS  +P  +QG++ SLVNTI NY+ S+ LG   T E Q ++G
Sbjct: 393 IIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDG 452

Query: 497 GKDVLKGYRAALYV 510
             D+LKGYR A Y+
Sbjct: 453 EDDLLKGYRGAYYM 466

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  177 bits (450), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 127/472 (26%), Positives = 217/472 (45%), Gaps = 25/472 (5%)

Query: 62  QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLN-SDGAAKTWLMASFT 120
           ++ T   S   E  F+     + +L  AG  Q +  M+V+ +    +  +   W    + 
Sbjct: 67  EEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYA 126

Query: 121 LASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGV 180
              GSF+L++G++GD+ G K+ F+ G     +WS+L G S+Y  +  FF  CRA QG+G 
Sbjct: 127 TTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGA 186

Query: 181 AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           AF   + + ++G  Y     RKN + SF G     G   G ++  L   +    W W ++
Sbjct: 187 AFTFTSALSILGKSYP-PCKRKNFIFSFFGACGSFGVVLGMVFSALF--TQLAHWSWAYW 243

Query: 241 ATAIAVFINLIMGIYSIP-----NHVPTNIYNLKMDWXXXXXXXXXXXXMNFVWNQAPIS 295
           + AIA  + +I+ I+ IP      H  +N++    D+             +  WNQAP  
Sbjct: 244 SMAIACVVIIILSIFFIPGDVVEKHETSNVF--YFDYLGAFLFVTGLVLFSVAWNQAPTY 301

Query: 296 GWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLP-PEVTKNRHIVTIIISLFLGWGAFG 354
           G+ + Y                  E  K + PLLP   ++ N   + +++++F  + +F 
Sbjct: 302 GFGRTYVYVLLIVSVVILALAMYVE-TKVDDPLLPWTHISANT--LKVLLAIFFAYASFT 358

Query: 355 IWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTIN-KVGPSVLFCLSSIGF 413
           +W  Y + FNL  +  + L A +      + G   A+  A  +N  V   +   +S + F
Sbjct: 359 MWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAF 418

Query: 414 TCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNT 473
               I+ +     QTYW       I+++ G+D+SFP ++++LS+ +P +++G+  SLV  
Sbjct: 419 LVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGA 478

Query: 474 ITNYATSLCLGMGTTAEV-QYN------NGGKDVLKGYRAALYVAIGLGALG 518
           + NYAT+  LG  T A V +Y       + G    K      YV IG   LG
Sbjct: 479 VLNYATA--LGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLG 528

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  149 bits (376), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 113/190 (59%), Gaps = 34/190 (17%)

Query: 81  MLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLK 140
           M++ LLNQ G TQTL  +NVL+    S  A +T L+AS  L SGSFILVSG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 141 ATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSM 200
            T + G     +WS +CG+++Y  +V FF+I RAFQGLG+AFVLPNVMG V N+Y  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 201 RKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNH 260
           RKN+V                                  +A  +AV +N+ + ++++P +
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 261 VPTNIYNLKM 270
           +PTN+    M
Sbjct: 147 IPTNVRGQAM 156

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 132/472 (27%), Positives = 218/472 (46%), Gaps = 26/472 (5%)

Query: 90  GQTQTLSTMNVLAD--SLNSDGAAKT-WLMASFTLASGSFILVSGRIGDIYGLKATFIGG 146
           G  Q +  M  +A   SL  D   +  W  A++   + +F++++G++GDI G K  FI G
Sbjct: 65  GAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFG 124

Query: 147 NIIFCIWSILCGVSKYTE-NVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIV 205
                +WS+L G SKY + N  FF  CR  QG+G AF+ P  + L+G  Y     RKN V
Sbjct: 125 YAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYP-PCKRKNYV 183

Query: 206 ISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIP-NHVPTN 264
            SF G   P G   G ++  L   +    W W +++ A+   I  I+    IP ++ P  
Sbjct: 184 FSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVTCLIITILSYIFIPKDNTPKR 241

Query: 265 IYN--LKMDWXXXXXXXXXXXXMNFVWNQAPISGWSKAYXXXXXXXXXXXXXXXXXYELK 322
             +     D+             + VWNQAP+S +   Y                  +  
Sbjct: 242 ERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIID-S 300

Query: 323 KAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVF 382
           + + PL+P + +   +++  +I +F G+  F IW FY + F L  ++ S L A +     
Sbjct: 301 RVKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPL 359

Query: 383 IIFGSLTAITVAFTINKVGPSVLFCLSSI-GFTCGNIIFSVTSPDQTYWRNSLGMQIILA 441
            I G   A      +NK  P  L  L+++  F    I+ S  +  +TYW N+    +I+A
Sbjct: 360 GISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIA 419

Query: 442 LGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGT------TAEVQYNN 495
           +G+D++FP ++++LS+ +  + QG++ +L  T  NY T+L  G+ T        +    +
Sbjct: 420 IGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLARS 479

Query: 496 GGKDVLKGYRAALYVAIGLGALGFAFS-FSYMAEDLWIRYRKRRQNEKKEDK 546
            G+ V      A YVAIG   +    + F  + E     Y K R ++ +E K
Sbjct: 480 DGRFV-HAVHIAGYVAIGTAGIAVVVAIFGSITE-----YYKERMDDLREKK 525

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  134 bits (336), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 110/441 (24%), Positives = 198/441 (44%), Gaps = 23/441 (5%)

Query: 67  FKSSWQEYTFIGTCMLAN-LLNQAGQTQTLSTMNVLADSLN---SDGAAKTWLMASFTLA 122
              +W    F+   ++++ L+   G  Q +     L +      + G    W  AS+ L 
Sbjct: 31  LPKTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLG 90

Query: 123 SGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTE-NVTFFIICRAFQGLGVA 181
           S   +L++G++GD+ G K   + G I   IWS++ G S Y   N  F+   RA QG+G  
Sbjct: 91  SAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSG 150

Query: 182 FVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFA 241
           F++PN + ++G  Y    ++K I+ S  G M   G   G  +  L     K  W W ++A
Sbjct: 151 FIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTK--WAWNYWA 208

Query: 242 TAIAVFINLIMGIYSIPN----HVPTN--IYNLKMDWXXXXXXXXXXXXMNFVWNQAPIS 295
            A    +  +  I  IP     H P +  +Y  + D+             +  + QA   
Sbjct: 209 LACVCVLYTVGAILFIPPDNIVHKPNSKPLYK-RFDYLGAITGVSGLVLFDVAFTQASAL 267

Query: 296 GWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGI 355
           GWS  +                  + +  + PL+P +  +   +V I+I ++ G+ +F I
Sbjct: 268 GWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLRA-DVVVILICVYFGFLSFVI 325

Query: 356 WTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFT---INKVGPSVLFCLSSIG 412
           W  +++ F   + + SPL   +   V +  GS+ A     T   +N   P+++  +S + 
Sbjct: 326 WANWFWQFYELVHNDSPLRIAA-KLVPLAIGSIPAAIFTVTCLQLNIKAPTMM-VISMVC 383

Query: 413 FTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVN 472
           F   NI+ +  +P+ TYW       II    +D++ P ++++ SD +  + QG++ SL+ 
Sbjct: 384 FLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLII 443

Query: 473 TITNYATSLCLGMGTTAEVQY 493
           T+ +YA S  +G   TA V +
Sbjct: 444 TVISYAIS--IGPSYTAMVMW 462

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  129 bits (323), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 118/478 (24%), Positives = 214/478 (44%), Gaps = 25/478 (5%)

Query: 63  DPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLAD--SLNSDGAAKT-WLMASF 119
           +P    S  +E  FI     +  ++ A  +Q +  M+ +     L +D + +  W  A+F
Sbjct: 61  NPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAF 120

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTE--NVTFFIICRAFQG 177
            +  G+FI+ +G++ D+ G K  FI G   + +WS+L G+S+Y      TFF   R  QG
Sbjct: 121 AITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQG 180

Query: 178 LGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPW 237
           +G A + P+ + L+G  Y   S +KNIV S  G   P+G   GG++  +   +    W W
Sbjct: 181 IGAAALFPSSLALLGKYYP-PSCKKNIVFSLYGFCVPLGVVVGGVFSAIF--TQLAHWSW 237

Query: 238 IFFATAI-AVFINLIMGIYSIPNHVPTN---------IYNLKMDWXXXXXXXXXXXXMNF 287
            +++ AI + F  LI   Y  P+ +  +          +  K D+               
Sbjct: 238 NYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAV 297

Query: 288 VWNQAPISGWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTIIISLF 347
            WNQA    +                      E    + P++P      + I  +++ +F
Sbjct: 298 CWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIPARKIHPQTIKALLV-VF 355

Query: 348 LGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFC 407
             + +F IW FY + +   +R+ + L   +      I G + A+     I+   P  +  
Sbjct: 356 FSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRL 415

Query: 408 LS-SIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGM 466
           L+ +  F   +I+F   S  ++YW       II+++G+D+SFP ++++LS+ +P + +G+
Sbjct: 416 LAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGI 475

Query: 467 SGSLVNTITNYATSLCLGMGTTA---EVQYNNGGKDVLKGYRA-ALYVAIGLGALGFA 520
           S +LV T  NY T +   +  T    +        D+ +  +A  +  A+G+GA G A
Sbjct: 476 SAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIA 533

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  110 bits (276), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 114/532 (21%), Positives = 216/532 (40%), Gaps = 83/532 (15%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKT---WLM 116
           K Q PT   S   +  FI     +  +  A  +Q +  M+ L+        +     W+ 
Sbjct: 60  KLQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVN 117

Query: 117 ASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYT-ENVTFFIICRAF 175
           ASF +  G+FI+++G++ DI   +  FI G + F +W+++ G + Y  +N+ F  ICR  
Sbjct: 118 ASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGC 177

Query: 176 QGLGVAFVLPNVMGLVGNIYNVGSM----------------------------------- 200
           QG+G A + P+ + L+   Y V                                      
Sbjct: 178 QGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDS 237

Query: 201 -----------RKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFIN 249
                       K+I  S  G  AP+G   GG++  +   +    WPW +++ +I   + 
Sbjct: 238 SIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSMSIVTTLL 295

Query: 250 LIMGIYSIPNHVP-----TNIYNLK----MDWXXXXXXXXXXXXMNFVWNQAPISGWSKA 300
            I+  + +   +P     +N  +LK     D+                W+QA +  +   
Sbjct: 296 SILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTI 355

Query: 301 YXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRHIVTI--IISLFLGWGAFGIWTF 358
           +                 +E     +P++P    +  H  TI  ++ +F  + +F  W F
Sbjct: 356 HVYLTLLFSLVSFIAMIIWEYY-FNNPIIP---IRQIHPGTIKALLVVFFSYISFTQWLF 411

Query: 359 YYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAIT--VAFTINKVGPSVLFCLSSIGFTCG 416
           Y +     ++  SP+  GS  F+ +    + + T  +   + +V   +     +  F   
Sbjct: 412 YTWKLFTEVKDNSPI-LGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLS 470

Query: 417 NIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITN 476
           +I+      D +YW       I +++G+D+SFP ++++L++ +P + QG+  +LV ++ N
Sbjct: 471 HILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLN 530

Query: 477 YATSLCLGMGTTAEVQYN--------NGGKDVLKGYRAALYVAIGLGALGFA 520
           Y T++   +  T  +QY         +  K  LKG   A   A+G+G  G A
Sbjct: 531 YGTAIGPPIAQTI-IQYQCESCMSDPHDKKAFLKGIHIA--GAVGVGCSGIA 579

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           W + S+ +    FI   GR+GDI G        ++IF I+S+LC V     N   F + R
Sbjct: 62  WALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAV---VPNFIAFTVFR 118

Query: 174 AFQGLGVAFVLPNVMGLVGNIYNVGSMRK--NIVISFIGCMAPVGQTFGGMWG 224
           AFQG+  A ++P    LV  ++   ++++  +I+ S I  MA VG   GG +G
Sbjct: 119 AFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFG 171

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 78/344 (22%), Positives = 135/344 (39%), Gaps = 43/344 (12%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172
           +W+  ++ L+S +F  + G++ DI+G +   +  N++FC+ +++CG+SK   N+   ++ 
Sbjct: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK---NLWVLVLG 234

Query: 173 RAFQGLGVAFVLPNVMGLVGNIYNVGS--MRKNIVISFIGCMAPVGQTFGGMWGGLIVDS 230
           R   G+G   +         +I  + S  + + I   F G    +G   GG+ GGL  D 
Sbjct: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFG----LGTACGGLVGGLFADR 290

Query: 231 NKD-------QWPWIFFA-TAIAVFINLIMGIYSIPNHVPTNI---YNLKM-DWXXXXXX 278
                     Q P    + TAI +F+ L   + +       +I     L+M DW      
Sbjct: 291 AVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTL 350

Query: 279 XXXXXXMNFVWNQAPISGWSKAYXXXXXXXXXXXXXXXXXYELKKAESPLLPPEVTKNRH 338
                    V +   + G    +                 +EL  A  P+LP    +NR 
Sbjct: 351 VVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRS 407

Query: 339 IVTIIIS---LFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGST---HFVFIIFGSLTAIT 392
           ++   +S     +G    G +   YYA  LN+    P   G      F    FGSL A  
Sbjct: 408 VLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPTDIGKRIVPSFFSTAFGSLGA-- 462

Query: 393 VAFTINKVGPS----VLFCLSSIGFTCGNIIFSVTSPDQTYWRN 432
             + + + G      + FCL  +    G +  S  +P  + WR 
Sbjct: 463 -GYYMKRTGKYYWFLLAFCLVGV---LGQVQISYVTPSISTWRQ 502

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 70  SWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILV 129
           S+  Y  +   M++   +    T  LS    + ++   +    +W + ++ +    FI  
Sbjct: 20  SFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAF 79

Query: 130 SGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMG 189
            GR+GDI G    F+    +F I S++C V     N   F + RA QG+  A ++P+   
Sbjct: 80  LGRVGDIIGNSVLFVSSCFLFSILSLICAV---VNNFGTFAVFRALQGIAAAGIVPSGYA 136

Query: 190 LV 191
           L+
Sbjct: 137 LI 138

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 71/182 (39%), Gaps = 13/182 (7%)

Query: 320 ELKKAESP-----------LLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLR 368
            LK A +P           L+P +V   ++ + I +++F  +G      +    +   + 
Sbjct: 284 NLKSASNPKVYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVS 343

Query: 369 HFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTS--PD 426
             SPL A       ++   +  + +A   + + P     L       G+II        D
Sbjct: 344 KNSPLLAAVKLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITD 403

Query: 427 QTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMG 486
             YW+     Q ++A G  + FP S  IL    P +Y+G++  ++ T   +   +   + 
Sbjct: 404 NLYWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVM 463

Query: 487 TT 488
           T+
Sbjct: 464 TS 465

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 8/150 (5%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + L+    T   + MN +A+    +   K W+  SF L + +F  + G++ DI G K 
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
             +  +  F +    C ++ + +N+T F I RA  G+G   V  N M  +  + ++ S R
Sbjct: 107 AVLTSHFFFGLG---CFLTCFAQNITQFSIARAICGIGAGGV--NAMSSI-TVSDICSTR 160

Query: 202 -KNIVISFIGCMAPVGQTFGGMWGGLIVDS 230
            + I   +   +  +GQ  G   GGL +DS
Sbjct: 161 ERGIYQGYANIVFGLGQLLGAPLGGLFIDS 190

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 84/183 (45%), Gaps = 13/183 (7%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + L+    T   + MN +A+   S+ + K W+  SF L + +F  + G++ DI G K+
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
             +  +  F I    C ++ +  NVT F I RA  G+G   +  N +G +       +  
Sbjct: 103 ALLTAHFFFGIG---CLLTCFARNVTEFSIARAICGIGAGGL--NAIGSIAVSDICTARE 157

Query: 202 KNIVISFIGCMAPVGQTFGGMWGGLIVDSN------KDQWPWIFFATAIAVFINLIMGIY 255
           + +   +   +  +GQ  G   GG+ +++         Q P I   + +A+  N+ + ++
Sbjct: 158 RGVYQGYANIVFGLGQLLGAPLGGVFIETIGWRALFGVQVPVIMLCSVLAI-KNINIKLF 216

Query: 256 SIP 258
            +P
Sbjct: 217 HVP 219

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 100/244 (40%), Gaps = 28/244 (11%)

Query: 31  TSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPTYFKSSWQEYTFIGTCMLANLLNQAG 90
           +SLD + D  K +Q                   P    S  Q++  +   ++    +  G
Sbjct: 71  SSLDTVPDEEKLEQTSESTA-------------PYTLLSYKQKWGMVFLLVMCGFWSSLG 117

Query: 91  QTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIF 150
                  +  L    N D       +  + L  G    VSG + D++G +   +GG +I+
Sbjct: 118 SPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIY 177

Query: 151 CIWSILCGVSKYTENVTFFIIC--RAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISF 208
            + SI    +      ++ +IC  R  Q +G++  +    G+VG+ + +   R   V + 
Sbjct: 178 VVASIGLACAP-----SYGVICFLRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGAT 231

Query: 209 IGCMAPVGQTFGGMWGGLIVDSNKDQWPW--IFFATAIAVFINLIMGIYSIPNHVPTNIY 266
            G +  +GQ FG + G ++      +W W  IF+  AI   + LI+  +++P    T + 
Sbjct: 232 SG-LVLLGQCFGSLIGAVLT----ARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVG 286

Query: 267 NLKM 270
           NL +
Sbjct: 287 NLSI 290

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 79/185 (42%), Gaps = 7/185 (3%)

Query: 68  KSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFI 127
           KS +Q    +G   L    +       +S ++ LA + N      +W + S+ +    FI
Sbjct: 22  KSRYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFI 81

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
              GR+GDI G    F      F + S+LC V     N   F + RA QG+  A ++P  
Sbjct: 82  ACMGRLGDIIGNSVLFTISCSCFAVLSLLCAV---MPNFPAFAVFRAIQGICAAGLVPCA 138

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFAT-AIAV 246
             L+  +     ++K   I   G  + +G   G + GG    + K  +  IF+ T A+  
Sbjct: 139 YALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFA-TTKIGYRGIFYLTFAVMT 195

Query: 247 FINLI 251
            I++I
Sbjct: 196 LISII 200

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 68  KSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFI 127
           KS +Q    +G   L    +       +S ++ LA   N      +W + S+ +    FI
Sbjct: 22  KSPYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFI 81

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
              GR+GDI G    F      F I S+LC V     N   F + RA QG+  A ++P  
Sbjct: 82  ACMGRLGDIVGNSVLFTISCSCFAILSLLCAV---MPNFPAFAVFRAIQGICAAGLVPCA 138

Query: 188 MGLV 191
             L+
Sbjct: 139 YALI 142

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 77/200 (38%), Gaps = 8/200 (4%)

Query: 328 LLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGS 387
           L+P +V   ++ + I+++  L         +    ++      SPL AG      II   
Sbjct: 303 LIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMV 362

Query: 388 LTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTS--PDQTYWRNSLGMQIILALGMD 445
           +     AF   K+ P V   L       G+II        D  +W+     Q ++  G+ 
Sbjct: 363 VGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQALVGFGVA 422

Query: 446 LSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTA--EVQYNNGGKDVLKG 503
           + +P +  I     P Q +G++  +  T       +   +  +   ++    G +D ++ 
Sbjct: 423 IFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQN 482

Query: 504 YRAAL----YVAIGLGALGF 519
           +R       Y  + +GALGF
Sbjct: 483 FRTGFQNCSYFTVAVGALGF 502

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 78/188 (41%), Gaps = 6/188 (3%)

Query: 68  KSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFI 127
           KS++Q    +    L    +       +S ++ LA   +      +W + S+ +    FI
Sbjct: 22  KSTYQLNVNVALIFLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFI 81

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
              GR+GDI G    F      F I S+LC V     N   F + RA QG+  A ++P  
Sbjct: 82  AFMGRLGDIVGNSILFTVSCFFFAILSLLCAV---MPNFPAFAVFRAIQGISAAGLVPCA 138

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVF 247
             L+  +     ++K   I   G  + +G   G + GG    + K  +  IF+ T   +F
Sbjct: 139 YALIPMLAPEEEVQKYFSIVSCGFSSTIG--LGLIIGGAFA-ATKIGYKGIFYLTFAVMF 195

Query: 248 INLIMGIY 255
           +  I+  +
Sbjct: 196 LISIVAFF 203

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 38/200 (19%), Positives = 78/200 (39%), Gaps = 8/200 (4%)

Query: 328 LLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGS 387
           L+P +V   ++ + I+++  L         +    ++      SPL+AG      II   
Sbjct: 303 LIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMV 362

Query: 388 LTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTS--PDQTYWRNSLGMQIILALGMD 445
           +     AF   K+ P V   L       G+II +      +  +W+     Q ++  G+ 
Sbjct: 363 IGNGLCAFESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQALVGFGVA 422

Query: 446 LSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLG-----MGTTAEVQYNNGGKDV 500
           + +P +  I     P + +G++  +  T       +        +G    ++  +G    
Sbjct: 423 IFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQK 482

Query: 501 LK-GYRAALYVAIGLGALGF 519
            + G++   Y  + +GALGF
Sbjct: 483 FRTGFQNCTYFTVAVGALGF 502

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 109/264 (41%), Gaps = 11/264 (4%)

Query: 11  QQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQDPTYFKSS 70
           ++E +   I + + T   +  S +  S  V+ ++                +  P    S+
Sbjct: 50  EKESDMTDISEIKDTDFDSDKSKEEQSSIVRNEKHPETAFTALEPEIA--YNPPYSAFSN 107

Query: 71  WQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF--TLASGSFIL 128
           +Q  + +   +    L        +  + +L    N+   A    +A+F    A G F+ 
Sbjct: 108 YQVVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFAVGPFLW 167

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVM 188
                 D  G K  +I   +I  I ++L  ++   +++    I R FQ +G + V+P  +
Sbjct: 168 AVH--ADFGGRKFLYIFSLMIALIANVL--LAAVPKHLAALYILRVFQAIGTSAVIPLGV 223

Query: 189 GLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFI 248
           G V ++  +  M +   +S+      +G   G ++GGLI+  N +QW W+F  T+I   +
Sbjct: 224 GTVSDL--ISPMNRAKGVSYFMLGPNMGPILGPIFGGLIL-MNGNQWRWLFGFTSITTGV 280

Query: 249 NLIMGIYSIPNHVPTNIYNLKMDW 272
            LI+ +  +P  +   + N    W
Sbjct: 281 GLILIVTFLPETLRCIVGNGDPRW 304

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 76/168 (45%), Gaps = 11/168 (6%)

Query: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILC 157
           MN +A+  + +   K W+  SF L + +F  + GR  DI G K   +     F + ++L 
Sbjct: 68  MNKIAEEFH-ESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLL- 125

Query: 158 GVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQ 217
             + +  NVT F I RA  G+G   +       V +I    +  + +   +   +   GQ
Sbjct: 126 --TCFARNVTEFAIARAICGMGGGGIGAMSSITVSDI--CTTKERGMYQGYANVIFGAGQ 181

Query: 218 TFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIP---NHVP 262
             G   GGLI+++    W  IF A  +A+ I +I+   +I     H+P
Sbjct: 182 VLGAPVGGLIMETFN--WRIIFAAQVVAIMICMILAYRNINLKLLHIP 227

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 84  NLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATF 143
           +LLN AG    +S +  L ++        +W + S+ +    FI   GR+GDI G    F
Sbjct: 40  DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLF 96

Query: 144 IGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185
                +F ++S+LC V +   +   F + RA QG+  A ++P
Sbjct: 97  TISCFLFTLFSLLCAVVR---DFPTFAVFRALQGISAAGIVP 135

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 66/148 (44%), Gaps = 6/148 (4%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L +  +    T   + MN +A+   ++   K W+  SF L + +F  + G++ DI G K 
Sbjct: 51  LGSFFSSLDSTIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 109

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
             +  +  F +    C ++ + +NVT F I RA  G+G   +  N M  +       +  
Sbjct: 110 AVLTAHFFFGLG---CLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRE 164

Query: 202 KNIVISFIGCMAPVGQTFGGMWGGLIVD 229
           + I   +   +  +GQ  G   GGL +D
Sbjct: 165 RGIFQGYANIVFGMGQVLGAPLGGLFLD 192

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 12/126 (9%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           W+  S+ L+S  F  + G++ DI+G KA  I  N+IF    I+CG+S    ++   +  R
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSN---SLNMLVWGR 492

Query: 174 AFQGLGVAFVLPNVMGLVGNIYNVGS--MRKNIVISFIGCMAPVGQTFGGMWGGLIVDSN 231
              G+G   +       V +I  + S  + + I   F G    +G  FGG+ GG+ VD  
Sbjct: 493 FVAGIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFG----LGTAFGGVIGGIFVD-- 546

Query: 232 KDQWPW 237
             Q+ W
Sbjct: 547 -HQYGW 551

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 84  NLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATF 143
           +LLN AG    +S +  L ++   +    +W + S+ +     I   GR+GDI G    F
Sbjct: 44  DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLF 100

Query: 144 IGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185
                 F ++ +LC V     N   F + RA QG+  A ++P
Sbjct: 101 TISGFFFSLFCLLCAV---VTNFPAFAVLRALQGIAAAGLVP 139

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 87/195 (44%), Gaps = 33/195 (16%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + L+    T   + MN +A+   S+ + K W+  SF L + +F  + G++ DI G K+
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
             +     F +    C ++ +  NVT F I RA  G+G   +  N +  +  + ++ + R
Sbjct: 103 ALLTAQFFFGLG---CLLTCFARNVTEFSIARAICGIGAGGL--NAISSIA-VSDICTAR 156

Query: 202 K--------NIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMG 253
           +        NIV  F       GQ  G   GG+ +++    W  +F    I V + ++  
Sbjct: 157 ERGVYQGYANIVFGF-------GQLLGAPLGGVFIET--IGWRALF---GIQVPVIMLCS 204

Query: 254 IYSIPN------HVP 262
           + +I N      HVP
Sbjct: 205 VLAIKNINIKLFHVP 219

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + L+    T   + MN +A+   S+ + K W+  SF L + +F  + G++ DI G K+
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
             +     F +    C ++ +  NVT F I RA  G+G   +  N +  +  + ++ + R
Sbjct: 103 ALLIAQFFFGLG---CLLTCFARNVTEFSIARAICGIGAGGL--NAISSIA-VSDICTAR 156

Query: 202 K--------NIVISFIGCMAPVGQTFGGMWGGLIVDS------NKDQWPWIFFATAIAVF 247
           +        NIV  F       GQ  G   GG+ +++         Q P I   T +A+ 
Sbjct: 157 ERGVYQGYANIVFGF-------GQLLGAPLGGVFIETIGWRALFGVQVPMIMLCTILAI- 208

Query: 248 INLIMGIYSIP 258
            N+ + ++ +P
Sbjct: 209 KNINIKLFHVP 219

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 7/173 (4%)

Query: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILC 157
           +  L    N D       +  + L  G    +SG + D+YG +   +GG +IF + SI  
Sbjct: 114 LKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI-- 171

Query: 158 GVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQ 217
           G++K   +    +  R  Q +G++  +    G+V + + V   R   V +  G +  +GQ
Sbjct: 172 GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVSD-FTVKRERGTFVGATSG-LVLIGQ 228

Query: 218 TFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKM 270
             G + G +I  +    W  +F+   I     +I+G + +P    T + NL +
Sbjct: 229 GIGPLLGAVITAAL--HWRAVFWFLTIGCGSCMIIGFFLLPETKRTIVGNLSI 279

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 86/195 (44%), Gaps = 33/195 (16%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + L+    T   + MN +A+   S+ + K W+  SF L + +F  + G++ DI G + 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRP 102

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR 201
             +     F +    C ++ +  NVT F I RA  G+G   +  N +  +  + ++ + R
Sbjct: 103 ALLTAQFFFGLG---CLMTCFARNVTEFSIARAVCGIGAGGL--NAISSIA-VSDICTAR 156

Query: 202 K--------NIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMG 253
           +        NIV  F       GQ  G   GG+ +++    W  +F    + V + ++  
Sbjct: 157 ERGVYQGYANIVFGF-------GQLLGAPLGGIFIET--IGWRALF---GVQVPMIIVCS 204

Query: 254 IYSIPN------HVP 262
           I +I N      HVP
Sbjct: 205 ILAIKNINIKLFHVP 219

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 82/398 (20%), Positives = 153/398 (38%), Gaps = 44/398 (11%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172
           +W+  S+ L+S +F  + G++ DI+G K   +  N+ F I  ++CG+SK   +  + +I 
Sbjct: 149 SWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSK---SFWWLVIA 205

Query: 173 RAFQGLG----VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIV 228
           R   G+G     +     +  LV       +M + I   F G    +G   GG+ GG   
Sbjct: 206 RFVAGVGGGGLTSMSSITITDLVP--LRERAMYQGICNVFYG----LGTACGGIVGGWFS 259

Query: 229 DSNKDQWPWIFFATAIAVFINLIMGI--YSIPNHVPTNIYN-------LKMDWXXXXXXX 279
           D NK  W   F        I+L++ I    +P+   T   +       L +DW       
Sbjct: 260 D-NKGGWRMAFLIQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTLV 318

Query: 280 XXXXXMNFVWNQAPISGWSKAYXXXXXXXXXXXXXXXXX----YELKKAESPLLPPEVTK 335
                       A + G   AY                      EL+ A  P+LP     
Sbjct: 319 IFLVLFLLT---ASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLA 375

Query: 336 NRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGST---HFVFIIFGSLTAIT 392
            R ++   +S +    A    ++Y   +   + + SP   G     +F  + FGSL A  
Sbjct: 376 IRSVLGSSLSNWFCMMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGA-- 433

Query: 393 VAFTINKVGP----SVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSF 448
             + + K       S++FC  ++    G +   +  P    WR  + + ++  +G  +  
Sbjct: 434 -GYYMKKTRKYYWFSLIFCAVAV---LGQLQILLIDPKIPTWRQYI-LLLVPGVGTSVLI 488

Query: 449 PGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMG 486
             + + +   +P ++Q  + S+     +   +L + +G
Sbjct: 489 TVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIG 526

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTE 164
           +W+  ++ L+S +F  + G+I DI+G K   I  NI F + S++CG+S   E
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFE 210

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 107 SDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENV 166
           +D A   WLMA + L +  F+L+ GRI  + GLK + +   +IF   S++ G +    ++
Sbjct: 39  NDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAGAAN---SM 95

Query: 167 TFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGL 226
              I  R   G G + +   V G+  +I  V    +  VI+ +G    + +  G   GG 
Sbjct: 96  GMLIGARVISGFGGSGIESLVYGVGTSI--VEEKHRARVITVLGIAYMLAEGAGPFVGGG 153

Query: 227 IVDSNKDQWPWIFF 240
           + +     W W F+
Sbjct: 154 LAE--HVSWRWCFY 165

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 79/413 (19%), Positives = 163/413 (39%), Gaps = 40/413 (9%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172
           +W+  ++ L+S +F  + G++ DI+G K   +  NI+F +  ++CG+   T +    +  
Sbjct: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGL---TPSFWGLVGA 173

Query: 173 RAFQGLGVAFVLPNVMGLVGNIYNV--GSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDS 230
           R   G+G   V       + +I  +   ++ + +   F G    +G   GG+ GG   D 
Sbjct: 174 RFISGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFG----LGTACGGVVGGWFSDH 229

Query: 231 NKDQWPWIFFATAIAVFINLIMGIY-SIPN-----HVPTNIYN--LKMDWXXXXXXXXXX 282
                        ++   +L++ ++  +P      + P +I N  L +DW          
Sbjct: 230 GGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDW---IGASALV 286

Query: 283 XXMNFVWNQAPISGWSKAYXXXXXXXXXXXXXXXXXY----ELKKAESPLLPPEVTKNRH 338
             ++     A + G   A+                 +    EL  A+ P+LP    +NR 
Sbjct: 287 VFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRS 346

Query: 339 IVTIIISLFLGWGAFGIWTFY---YYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAF 395
           ++    S +    A    ++Y   YY+  LN+   +P   G          +L ++   +
Sbjct: 347 VLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---NPTRVGKRLMPNFFSTALGSLGAGY 403

Query: 396 TINKVGP----SVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGS 451
            + + G     +V FC  S+    G++  ++  PD   WR  + + +I   G  +    +
Sbjct: 404 YMKRTGKYYWLTVGFCTLSL---LGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVA 459

Query: 452 SIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNG--GKDVLK 502
            + +   +P  +   + S+     +  ++L + +G     Q  NG   + VLK
Sbjct: 460 LLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLK 512

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 95  LSTMNVLADSLNSDGA----AKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIF 150
           +S+M  L D L++  +      +W + S+ +    FI   GR+GDI G    F      F
Sbjct: 45  VSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCF 104

Query: 151 CIWSILCGVSKYTENVTFFIICRAFQGLGVA 181
            I S+LCG+     N   F + RA QG+  A
Sbjct: 105 AILSLLCGL---MPNFEAFAVMRALQGIAAA 132

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 85/213 (39%), Gaps = 11/213 (5%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           ++  P    S  Q++  +G   +    +  G       +  L    + D       +  +
Sbjct: 88  EYVAPYTLFSYSQKWIMVGLLTMCGFWSSLGSPIYYPALRQLEKQFDIDENLVNVTVVVY 147

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            L  G    V G + DIYG +   + G +++ + SI    +     + F    R  Q  G
Sbjct: 148 LLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALACANSYGVIIFL---RCLQSCG 204

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPW-- 237
           ++ ++    G VG+ + + + R   V +  G +  +GQ FG + G  +  +    W W  
Sbjct: 205 ISPIIAISSGCVGD-FTMKAERGTFVGAVSG-LVLLGQAFGSLIGAALAAA----WDWRA 258

Query: 238 IFFATAIAVFINLIMGIYSIPNHVPTNIYNLKM 270
           IF+  AI     L +GI  +P    T + N+ +
Sbjct: 259 IFWFLAIGAGCCLFVGILVLPETKRTIVGNMSI 291

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 69  SSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFIL 128
           S  + +  I +  L + L     T   + ++ +A   N + +  +W+  ++ L+S +F  
Sbjct: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
           + G+I DI+G +   I  N+ F +  ++CG+SK   N+   +  R   G+G
Sbjct: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK---NLWTLVAGRFIAGIG 162

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 11/168 (6%)

Query: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILC 157
           MN +A+    +   K W+  SF L + +F  + G++ DI G K   +  +  FC+    C
Sbjct: 75  MNRVAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLG---C 130

Query: 158 GVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQ 217
            ++ +  NVT F I RA  G+G   +       V +I    +  +     +   +   GQ
Sbjct: 131 LLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDI--CTARERGAYQGYANVVFSTGQ 188

Query: 218 TFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIP---NHVP 262
             G   GG  +D  +  W  IF      + I +++G  ++     HVP
Sbjct: 189 LLGAPLGGFALD--RIGWRAIFGLQVPMLLICMVLGYRNVNIKLAHVP 234

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 95  LSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWS 154
           ++ +N +AD  N+      WL+  ++L++  F L+ GR   I+G K T +   IIF I S
Sbjct: 41  VTILNTIADKFNAYSKIG-WLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 155 ILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAP 214
           ++  VS   + +   I  R   G G + +   V  +  ++  V    +  +++ +     
Sbjct: 100 LVIAVSNSMDMI---IGGRVIAGCGASGIQTLVFAIATSL--VDEHTRGTIVTLLSLSYA 154

Query: 215 VGQTFGGMWGGLIVDSNKDQWPWIFF 240
           V    G   GG + +     W W F+
Sbjct: 155 VASALGPYIGGALTE--YVTWRWCFY 178

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVS 160
           +W+  ++ L+S +F  + G+I DI+G K   I  N++F +  ++CG+S
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 65/145 (44%), Gaps = 24/145 (16%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL+  ++L+S  F L+ GR+  + GLK   +   +IF I S++  VS    ++   I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSN---SMGMLIAGR 138

Query: 174 AFQGLGVAFVLPNVMGLVGNIYNVG----SMRKNIVISFIGCMAPVGQTFGG-MWGGLIV 228
              G G +       G+   +Y VG    S R   ++  +   A VG   GG + GG + 
Sbjct: 139 VVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGAL- 190

Query: 229 DSNKDQWPWIFFATAIAVFINLIMG 253
            +    W W F       FINL +G
Sbjct: 191 -NEHASWRWCF-------FINLPIG 207

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 19/133 (14%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           W+ A ++L +    L+ GRI  I G K+  +   IIF I S++ GV+    ++   I  R
Sbjct: 117 WIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVAN---SMNMLIGGR 173

Query: 174 AFQGLG------VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
              G+G      +AFV+ + +        V   R+ ++I+ +     V    G   GG  
Sbjct: 174 VIAGVGGSGIQSLAFVIGSNL--------VDERRRGLIIACMSSAFAVASVIGPFLGGAF 225

Query: 228 VDSNKDQWPWIFF 240
             +    W W F+
Sbjct: 226 --TTHATWRWCFY 236

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + L+    T   + +  +A  L++  +  +W+  S+ L+  +F  + G++ DI+G K 
Sbjct: 49  LGSFLSALDTTIVSTLLPTIASDLDAS-SQMSWIATSYLLSCSAFQPLYGKLSDIFGRKI 107

Query: 142 TFIGGNIIFCIWSILCGVSKYTENV 166
             +  N++F I   LCG S +T N+
Sbjct: 108 LLVWSNLVFAIGCALCG-SPWTTNI 131

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 76/186 (40%), Gaps = 27/186 (14%)

Query: 74  YTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRI 133
           YT IG+  L   L         +++ V+A+    D +   W+++ ++L      L+ GR 
Sbjct: 118 YTTIGSLTLVLFLAALDVLIISASIEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRF 176

Query: 134 GDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG------VAFVLPNV 187
             I G K++ +   +IF   S++  +S    ++   I  R   G+G      + FV+ + 
Sbjct: 177 ATIIGFKSSLLVSILIFEAGSLISAIS---NSMNMLIGGRVVAGIGGSGIQSLCFVIAST 233

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVF 247
           +             + I+IS + C   V    G   GG +  +    W W F       +
Sbjct: 234 L--------TPDRSRVIIISVLSCSYAVAAVVGPFLGGAL--TTHVTWRWCF-------Y 276

Query: 248 INLIMG 253
           INL +G
Sbjct: 277 INLPIG 282

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 13/139 (9%)

Query: 99  NVLADSLNSDGAA------KTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCI 152
            V+A+ +NS  A       K W+  S+ L + +F  + G++ DI G K   I  +  F +
Sbjct: 60  TVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFAL 119

Query: 153 WSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMR-KNIVISFIGC 211
               C ++ + +NVT F I RA    G+     N M  +  + ++ S R + +   +   
Sbjct: 120 G---CLLTCFAQNVTQFSIARAI--CGIGGGGINAMSSI-TVTDICSARERGVYQGYANV 173

Query: 212 MAPVGQTFGGMWGGLIVDS 230
           +   GQ  G   GG ++DS
Sbjct: 174 VFGTGQLLGAPIGGFLLDS 192

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 96  STMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSI 155
           +TMN +A S+  + +  TW+  ++ L + +   + G+  D+ G K   +   ++F +  +
Sbjct: 70  TTMNEIA-SIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLV 128

Query: 156 LCGVSKYTENVTFFIICRAFQGLG 179
           +CG ++  E +   I+ RA  G+G
Sbjct: 129 MCGAARTIEEL---IVARAICGVG 149

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 96  STMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSI 155
           +TMN +A S+  + +  TW+  ++ L + S   + G+  D+ G K   +   ++F I  +
Sbjct: 73  TTMNEVA-SIFQEASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGLV 131

Query: 156 LCGVSKYTENVTFFIICRAFQGLG 179
           LCG+++  + +    I RA  G+G
Sbjct: 132 LCGMARTVKELA---IARAICGIG 152

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 7/104 (6%)

Query: 76  FIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGD 135
           F+G+ + A  L+    T  L T+    D+ N      +W+  S+ L+  +F  + G++ D
Sbjct: 39  FVGSYLAA--LDTTIVTTLLPTIASELDASNQ----MSWIATSYLLSCSAFQPLYGKLSD 92

Query: 136 IYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
           ++G K   I  N+ F    ILCG + +T+++    I R   G+G
Sbjct: 93  VFGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVG 135

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 63/142 (44%), Gaps = 7/142 (4%)

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVM 188
           +SG + D+YG +   + G +I+ + SI    S     + F    R  Q  G++ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL---RCVQSAGISPLIAISS 208

Query: 189 GLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFI 248
           G+VG+ +   S R + V +  G  A +GQ FG + G  +  +    W  IF+   I    
Sbjct: 209 GVVGD-FTTKSERGSFVGAVSG-FALMGQAFGSLIGAGLTAAY--DWRAIFWFLTIGCGT 264

Query: 249 NLIMGIYSIPNHVPTNIYNLKM 270
             ++  + +P    T   NL +
Sbjct: 265 CFVINFFLLPETKRTITGNLSI 286

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVM 188
           +SG + D+YG +   + G +I+ I SI    SK    V F    R  Q  G++ ++    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINS 193

Query: 189 GLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
           G+ G+ + V S R   V +  G    +GQ FG + G  +  +    W  IF
Sbjct: 194 GVAGD-FTVKSERGTFVGAVSG-FTLMGQAFGSLIGAALTAAY--DWRAIF 240

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 63/145 (43%), Gaps = 5/145 (3%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
           LV G   D  G K  +I    IF + +IL  ++    N+    + R  Q +G +  +   
Sbjct: 188 LVWGMFADFGGRKFLYIISLFIFTVANIL--LASLPANIIALYLVRVLQVVGASAAISLG 245

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVF 247
            G V +I       K++ +  +G    +G     +  GLI+  N +QW W+F  +AI   
Sbjct: 246 TGTVADISPPKHRGKSVALFMLG--PNMGPIIAPIIAGLIL-MNSNQWRWLFGFSAICTG 302

Query: 248 INLIMGIYSIPNHVPTNIYNLKMDW 272
           + L++ I  +P  +   + N    W
Sbjct: 303 VALMIVIVILPETLRCIVGNNDPKW 327

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 8/149 (5%)

Query: 92  TQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFC 151
           T T ST   + +  N    + +W+ AS+ + S SF  + G   D+ G +      ++IF 
Sbjct: 85  TVTASTYQTIGNEFNHMDLS-SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFS 143

Query: 152 IWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGC 211
           I  + CG+S    N+ +    RAF   G+       +  + N   + + ++ I  +F   
Sbjct: 144 IGCLGCGISI---NILWLSFMRAFT--GIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNL 198

Query: 212 MAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           +  +G   G  +GG+I  S    W W F 
Sbjct: 199 LLGLGAICGASFGGVITSSIG--WRWCFL 225

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 8/171 (4%)

Query: 90  GQTQTLST-MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNI 148
           GQT  L+     LA+  N   +  ++L+    LA     +++     ++G +  ++ G I
Sbjct: 93  GQTSILAAGSRSLAEEFNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGII 152

Query: 149 IFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISF 208
           +F   SI C VS   E++   +  R   GLGVA +       V  IY        + +  
Sbjct: 153 VFFFGSIGCSVSHSYESL---LASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYT 209

Query: 209 IGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPN 259
           +  +   G+    +   L+  S  D++ W+F+   I V IN ++ ++ +P 
Sbjct: 210 LLLLG--GKNLVPLLASLVFQS-LDRY-WLFWIVTIIVGINFVLHLFFVPE 256

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 81  MLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLK 140
           ++ + L+    T   + +  +A  L++  +  +W+  ++ L+  +F  + G++ DI+G K
Sbjct: 48  LMGSFLSALDTTIVATLLPTIASDLDAS-SQMSWIATAYLLSCSAFQPLYGKLSDIFGRK 106

Query: 141 ATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
              I  N+ F +   +CG S +T NV      R   G+G
Sbjct: 107 ILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIG 144

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
           L+   + DIYG + T+     ++ I++I C +     N+   +ICR F G+  +  L  V
Sbjct: 296 LIWSPMSDIYGRRLTYFVSMGLYVIFNIPCAIPN---NIATLMICRFFCGVWSSSGLCLV 352

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ----WPWIFFATA 243
            G + +++   S  +   I+F       G  FG +  G I  S +      W  + FA A
Sbjct: 353 GGSLADMF--PSETRGRAIAFFAYAPYCGPVFGPLVNGFISISTRRMDLIFWVNMAFAGA 410

Query: 244 IAVFINLI 251
           + + + LI
Sbjct: 411 MWIIVALI 418

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 69/139 (49%), Gaps = 11/139 (7%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172
           +W+ AS+ L++  F  + G++ DI+G KA  +  N++F +  ++CG +     V + +  
Sbjct: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTA---PTVWWLLAG 246

Query: 173 RAFQGLGVAFV--LPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDS 230
           R   G+G   +  +P++  ++ +I  + S R +    F  C   +G T GG  GG + + 
Sbjct: 247 RFVAGIGGGGLTSMPSI--IISDIVPLRS-RASYQDLFNICYV-LGITLGGSMGGWLAEY 302

Query: 231 NKDQWPWIFFATAIAVFIN 249
               W  +F    +A  I+
Sbjct: 303 GG--WRLVFLLQVVAALIS 319

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL   ++L +    L+ GRI    G K T +   +IF I S+   +S    +++  I  R
Sbjct: 106 WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL---ISALANSMSMLIGGR 162

Query: 174 AFQGLG------VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
              G+G      ++FV+ + +        V   ++ I+I+ + C   +    G   GG+ 
Sbjct: 163 VIAGVGGCGIQSLSFVIGSTL--------VEESQRGILIAVLSCSFAIASVVGPFLGGVF 214

Query: 228 VDSNKDQWPWIFF 240
             S    W W F+
Sbjct: 215 TSS--VTWRWCFY 225

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 13/147 (8%)

Query: 108 DGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVT 167
           D     W++  ++L +  F L+ GR+  + G + + I   I+F   S++  ++K   ++ 
Sbjct: 77  DYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAK---SMN 133

Query: 168 FFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
             I  R   G+G + +    + LV     V    + +V+S + C   V    G   GG  
Sbjct: 134 MLISGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAF 191

Query: 228 VDSNKDQWPWIFF------ATAIAVFI 248
             +    W W F+        AIA+FI
Sbjct: 192 --TTHVTWRWCFYINLPIGGLAIAIFI 216

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 82/207 (39%), Gaps = 7/207 (3%)

Query: 64  PTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLAS 123
           P    S W ++  +    +    +  G       +  L    N D       +  + +  
Sbjct: 88  PHSMLSYWNKWGMVAVLTMCGFWSSLGSPIYYPALKQLEKKFNVDENLVNVSVVVYLIFQ 147

Query: 124 GSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFV 183
           G    VSG + DIYG +   + G +++ + SI  G++    +    I  R  Q  G++ +
Sbjct: 148 GFAPAVSGGLADIYGRRPVILFGMLVYVVASI--GIAA-CNSYGVIIFLRCLQSTGISPL 204

Query: 184 LPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATA 243
           +    G VG+ + V + R   V +  G +  +GQ FG + G  +  +    W  IF+  A
Sbjct: 205 IAISSGAVGD-FTVKAERGTFVGAVSG-LVLMGQAFGSLIGAALAAAY--NWRAIFWFLA 260

Query: 244 IAVFINLIMGIYSIPNHVPTNIYNLKM 270
           I     + +    +P    T + NL +
Sbjct: 261 IGCGACMAIAGIVLPETKRTLVGNLSV 287

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 68/144 (47%), Gaps = 11/144 (7%)

Query: 130 SGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMG 189
           SG + D YG +   +GG +++ + SI  G+++   +    +  R  Q +G++  +    G
Sbjct: 169 SGGLADRYGRRPIILGGMLVYVVASI--GLAR-APSYGVIVFLRIVQSIGISPTIAISSG 225

Query: 190 LVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPW--IFFATAIAVF 247
           +V + Y +   R   V +  G +  +GQ  G + G +I      +W W  IF+   I   
Sbjct: 226 VVSD-YTLKRERGTFVGATSGFVL-IGQGIGPLLGAVIA----ARWDWRAIFWFLVIGCG 279

Query: 248 INLIMGIYSIPNHVPTNIYNLKMD 271
            ++++  + +P    T + NL ++
Sbjct: 280 TSMLIAFFLLPETKRTIVGNLSIE 303

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 94/244 (38%), Gaps = 41/244 (16%)

Query: 4   LYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQXXXXXXXXXXXXXXXKWQD 63
           L+ K+ KQQ E+K     F      A TS +    S+ +D                  ++
Sbjct: 10  LHSKEAKQQHEQK---RQFAVDQKFAHTSSEHDETSIPEDNVK---------------KN 51

Query: 64  PTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTM-NVLADSLNSDGAAKTWLMASFTLA 122
               K S    + +   +  +L   A     +ST+   +A  L S      WL   ++L 
Sbjct: 52  VELSKGSILYVSLVAVAL--SLFLAALDVMIVSTIIEEVAKQLGSYSEIG-WLFTGYSLP 108

Query: 123 SGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG--- 179
           +   +L+ GRI    G KAT +   +IF I S+   +S    ++   I  R   G+G   
Sbjct: 109 NALLVLIWGRIATPIGFKATMLFAIVIFEIGSL---ISALASSMNMLIGGRVIAGIGGCG 165

Query: 180 ---VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWP 236
              ++FV+ + +        V   ++ ++I+ +     +    G   GG+   S    W 
Sbjct: 166 IQSLSFVIGSTL--------VEESKRGMLIAILSSSFAIASVVGPFLGGVFTSS--VTWR 215

Query: 237 WIFF 240
           W F+
Sbjct: 216 WCFY 219

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172
           +W+  ++ L+S +F  + G+I DI+G K      N+ F I  ++CG +K   +    +I 
Sbjct: 133 SWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK---SFWVLVIG 189

Query: 173 RAFQGLG 179
           R   G+G
Sbjct: 190 RFISGVG 196

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 6/157 (3%)

Query: 97  TMNVLADSLNSDGAAK--TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWS 154
           T+NV   S + D   K  TW +    +      ++ G IGD YG K +FI       +  
Sbjct: 95  TLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVLE 154

Query: 155 ILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAP 214
           I+ G  K+  N  +F+I RAF G+ +  +  N      +  +      + +  F      
Sbjct: 155 IITGFIKH--NFKYFLIARAFFGVVLGGIFGNSAAQCFD--DCPPEAHSFISGFFQQGYT 210

Query: 215 VGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLI 251
           +G     ++   + D+ KD+W   F+  A   F+ +I
Sbjct: 211 LGYLLAVIFTRALADTTKDRWRSCFWFAAGITFLLII 247

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 58/133 (43%), Gaps = 9/133 (6%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
           L+   + DIYG +  +     ++ I++I C V+K   N    +ICR F G+  +  L  V
Sbjct: 223 LIWSPVSDIYGRRVAYFVSMFLYVIFNIPCAVAK---NPQTLMICRFFCGVWASSGLCLV 279

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ----WPWIFFATA 243
            G + +++   +  +   I+F       G  FG +  G I  S        W  + FA  
Sbjct: 280 GGSIADMFPNDT--RGRAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLIFWVNMAFAGV 337

Query: 244 IAVFINLIMGIYS 256
           + + + LI   Y+
Sbjct: 338 MWIIVALIPETYA 350

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 101 LADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVS 160
           +A+ LN +    TW M    +      ++ G IGD +G KA+F+   I   + SIL  ++
Sbjct: 71  IAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQKASFM---INIGMISILQLLT 127

Query: 161 KYTENVTFFIICRAFQGL 178
            +     +FI CRA+ G+
Sbjct: 128 GFATTFPYFIACRAYFGV 145

>Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON}
           (29969..31474) [1506 nt, 502 aa]
          Length = 501

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 119 FTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGL 178
           F L  G  IL    + ++YG + TFI    +  IW  L   SK  E V F    R   G 
Sbjct: 107 FGLGVGPLIL--SPLSELYGRRLTFIFSLALSIIWQCLTTWSKTIEGVMF---GRFLSGF 161

Query: 179 GVAFVLPNVMGLVGNIYNVGSMRKNIVISF-IGCMAP-VGQTFGGMWGGLIVDSNKDQWP 236
             +  L    G + +I+     +K+I I   I   +P +G + G + GG +   +KD + 
Sbjct: 162 FGSSFLSVAGGSISDIFE----KKDIGIPMAIFTTSPMLGPSIGPIIGGAL---HKDSYK 214

Query: 237 WIFFATAIAVFINLIMGIYSIPN 259
           W F    IA  + L++   ++P 
Sbjct: 215 WTFIVLLIASGVCLVLITLTVPE 237

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 133 IGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVG 192
           + D++G +  +     ++ I++I C VSK   NV   +ICR F G+  +  L  V G + 
Sbjct: 236 VSDLFGRRVAYFVSMGLYVIFNIPCAVSK---NVQTLMICRFFCGVWSSSGLCLVGGSIA 292

Query: 193 NIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
           +++   S  +   I+F       G  FG +  G I
Sbjct: 293 DMFP--SETRGRAIAFFAYAPYCGPVFGPLVNGFI 325

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 55/133 (41%), Gaps = 19/133 (14%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL+  ++L +    L+ GR   I G + + I   +IF   S++  ++    ++   I  R
Sbjct: 76  WLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALA---SSMNMLIFGR 132

Query: 174 AFQGLG------VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
              G+G      + FV+   M        VG   + +VIS + C   V    G + GG  
Sbjct: 133 VVAGVGGSGLQTLCFVIGCTM--------VGERSRPLVISILSCAFAVAAIVGPIIGGAF 184

Query: 228 VDSNKDQWPWIFF 240
             +    W W F+
Sbjct: 185 --TTHVTWRWCFY 195

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 7/127 (5%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL+  ++L +    LV GR   I G K++ +   IIF + S+   VS    ++   I  R
Sbjct: 82  WLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSL---VSALANSMNMLIGGR 138

Query: 174 AFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKD 233
              G+G + +      ++  + N  S  + + IS + C   V    G   GG    +   
Sbjct: 139 VISGVGGSGLQTLCFLIISTLVNERS--RGMAISVLSCSFAVASIVGPFLGGAF--TTHV 194

Query: 234 QWPWIFF 240
            W W F+
Sbjct: 195 TWRWCFY 201

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 60/143 (41%), Gaps = 12/143 (8%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
           ++   + ++YG K   +   + F ++      +   EN    +ICR F G   A  +  V
Sbjct: 247 IIYAPLSELYGRKGVLVVSGLGFALFQFAVATA---ENFQTIMICRFFAGFIGAAPMAIV 303

Query: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFAT---AI 244
             +  ++++     K I +  +G    VG   G + G  IV      W W+ +     A 
Sbjct: 304 PAVFADMFDTDFRGKAICLFTLGVF--VGPILGPVMGSYIVQHT--TWRWLNYVVGFQAC 359

Query: 245 AVFINLIMGIYSIPNHVPTNIYN 267
           AVF+ +++ +     H PT + N
Sbjct: 360 AVFVAIVLFVEE--THHPTILVN 380

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 65/144 (45%), Gaps = 11/144 (7%)

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVM 188
           +SG + D++G +   + G +I+ + SI    +     + F    R  Q +G++  +    
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASIGLACAPSYGVIVFL---RIIQSIGISPTIAISS 201

Query: 189 GLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPW--IFFATAIAV 246
           G+VG+ + +   R   V +  G +  +GQ FG + G ++  +    W W  IF+   I  
Sbjct: 202 GVVGD-FTLKHERGTFVGATSG-LVLLGQCFGSLIGAVLAAA----WNWRAIFWFLTIGC 255

Query: 247 FINLIMGIYSIPNHVPTNIYNLKM 270
             + I+    +P    T + NL +
Sbjct: 256 GTSFIIAFLLLPETKRTLVGNLSI 279

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

Query: 108 DGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVT 167
           D A   WL+  + L +  F L+ GR+  I GLK +     +IF I S++  VS    ++ 
Sbjct: 40  DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVS---NSMG 96

Query: 168 FFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
             I  R   G G + +  +++ +VG    V    + +VI+ +G    V    G + GG  
Sbjct: 97  MIIGGRVVAGCGGSGI-QSLVFVVGTSL-VEERNRGMVITVLGLAFAVAFAVGPVIGGAF 154

Query: 228 VDSNKDQWPWIFF 240
            ++    W W F+
Sbjct: 155 TEN--VSWRWCFY 165

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 57/132 (43%), Gaps = 7/132 (5%)

Query: 108 DGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVT 167
           D +   W+ A ++L S    L+ GRI  + G K++ +   IIF + S+   V+    ++ 
Sbjct: 88  DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSL---VAALANSMD 144

Query: 168 FFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
             I  R   GLG + +      ++  +  V   ++ ++I+ +G    +    G   GG  
Sbjct: 145 MLIGGRVIAGLGGSGIQTLCFVIISTL--VEESKRGLLIACMGSAFGIASVVGPFLGGAF 202

Query: 228 VDSNKDQWPWIF 239
             +    W W F
Sbjct: 203 --TTHVTWRWCF 212

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 96  STMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSI 155
           +T+N +A       +  TW+  ++ L + +   + G+I DI G +   + G +IF +  +
Sbjct: 82  TTVNDIASQFQ-QASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVL 140

Query: 156 LCGVSKYTENVTFFIICRAFQGLG 179
           LC    +   +    I RA  G+G
Sbjct: 141 LC---NFANTIPQLAIARAICGIG 161

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 47/100 (47%), Gaps = 5/100 (5%)

Query: 133 IGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVG 192
           + D+YG +  +     ++ I++I C +S    N++  ++CR   G+  +  L  V G + 
Sbjct: 232 VSDLYGRRVAYFVSMGLYVIFNIPCAISP---NISGLMVCRFLCGVWASSGLCLVGGSIA 288

Query: 193 NIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNK 232
           +++   S  +   I+F      VG  FG +  G I  S +
Sbjct: 289 DMFP--SETRGKAIAFFAFAPYVGPVFGPLVNGFISVSTR 326

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 7/142 (4%)

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVM 188
           +SG + D+YG +   + G +I+   SI    S+    + F    R  Q  G++ ++    
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 189 GLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFI 248
           G+VG+ + +   R   V +  G    +GQ FG + G  +  +    W  IF+   I    
Sbjct: 198 GVVGD-FTLKHERGTFVGAVSG-FTLMGQAFGSLIGAALTAAF--DWRAIFWFLTIGCGT 253

Query: 249 NLIMGIYSIPNHVPTNIYNLKM 270
            +I+    +P    T + NL +
Sbjct: 254 CMIINFLILPETKRTLVGNLSI 275

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 5/142 (3%)

Query: 131 GRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGL 190
           G   D+ G K  ++   I+  + ++L  V     N+    + R FQ  G + V+    G 
Sbjct: 167 GVYADVCGRKWLYLCSLILVTVINLLLAV--LPANLASLFVLRVFQAFGSSSVITLGSGT 224

Query: 191 VGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINL 250
           V +I  +    K I    +G    +G   G +  GLI+  N D W W+F  T I   I  
Sbjct: 225 VTDITPMKHRGKAIAYFMLG--PNMGPILGPIIAGLIL-INGDYWRWLFGFTCIMSAIGF 281

Query: 251 IMGIYSIPNHVPTNIYNLKMDW 272
           ++ +  +P  +   + N    W
Sbjct: 282 LLVLIFLPETLRCIVGNGDPRW 303

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 62/141 (43%), Gaps = 13/141 (9%)

Query: 118 SFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQG 177
           S+  +   F  + G+  D++G K   I  N++F    + CG+SK    + + I+ R   G
Sbjct: 124 SYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSK---TIWWLILGRLVTG 180

Query: 178 LGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKD---- 233
           +G   +      ++ +I  V    + +   F      +G   GG+ GGL  +        
Sbjct: 181 IGGGGLTSMCTIIINDI--VPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWRMA 238

Query: 234 ---QWPWIFFAT-AIAVFINL 250
              Q P+ F +T +I V+++L
Sbjct: 239 FMIQLPFCFLSTISIIVYLDL 259

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL   ++L +    L+ GRI    G K T +   +IF + S+   +S    ++   I  R
Sbjct: 115 WLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL---ISALANSMNVLIGGR 171

Query: 174 AFQGLG------VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
              G+G      ++FV+ + +        V    + ++I+ + C   +    G   GG  
Sbjct: 172 VIAGVGGCGIQSLSFVIGSNL--------VEESNRGVLIAILSCSFAIASVVGPFLGG-- 221

Query: 228 VDSNKDQWPWIFF 240
           V +++  W W F+
Sbjct: 222 VFTSRVTWRWCFY 234

>KAFR0F04090 Chr6 complement(797919..799682) [1764 bp, 587 aa] {ON}
           Anc_4.212 YGR065C
          Length = 587

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 10/99 (10%)

Query: 176 QGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ- 234
              G A+  P    ++G  Y    M   + + F G M  +G    G+  G I DS   + 
Sbjct: 225 NAFGAAYY-PVTQYVMGCWYAPDEMSSRVSLFFCGNM--LGSVTSGLLQGRIYDSLDGRY 281

Query: 235 ----WPWIFFATAIAVFI-NLIMGIYSIPNHVPTNIYNL 268
               W W+F   A+A+ +  +I+G + IP  +P+  Y+L
Sbjct: 282 GIAGWRWMFLIDAVAISLPTVILGFFLIPG-IPSKCYSL 319

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 20/146 (13%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL+  + L++  F+L+ GR+ +I G K   +   I+F I S++  +S     +    +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVA 106

Query: 174 AFQGLGV---AFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDS 230
            F G G+   AFV+   +        V    + I+I+ +     + +  G   GG    +
Sbjct: 107 GFGGSGIESLAFVVGTSI--------VRENHRGIMITALAISYVIAEGVGPFIGGAF--N 156

Query: 231 NKDQWPWIFFATAIAVFINLIMGIYS 256
               W W F       +INL +G ++
Sbjct: 157 EHLSWRWCF-------YINLPIGAFA 175

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFV 183
           L+ GR+G+ +G + T   G++IF I  +  G   + + +   II R   GLGV  +
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQG---FADKMMHLIIGRTISGLGVGLL 215

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172
           +W+  S+ L+S +   + G++ D  G K   +  N++F I  ++CG+S    ++ + ++ 
Sbjct: 120 SWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST---SIWWVVVG 176

Query: 173 RAFQGLG 179
           R   G+G
Sbjct: 177 RFVSGIG 183

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 73/168 (43%), Gaps = 11/168 (6%)

Query: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILC 157
           MN +A+   S+   K W+  SF L + +F  + G++ D+ G K   +       I  +L 
Sbjct: 59  MNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLLT 117

Query: 158 GVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQ 217
            +++   NVT F + RA  G+G   +       V +I    +  + I   +   +  +GQ
Sbjct: 118 CLAR---NVTEFAVARAICGIGGGGINACSSITVSDICT--AKERGIYQGYANIVFGMGQ 172

Query: 218 TFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIP---NHVP 262
             G   GGL +D+    W  IF      V ++  +   ++    +HVP
Sbjct: 173 MLGAPLGGLFIDT--IGWRAIFGIQVPVVMVSAFLAYRNVNIKLSHVP 218

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 8/127 (6%)

Query: 133 IGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVG 192
           I ++YG + TFI    +  IW  L   + ++ NV   +  R   G   +  L    G + 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQCL---TTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 193 NIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIM 252
           +I++  ++   + +  + C    G   G +  G +   N   + W+F    IA  + L++
Sbjct: 191 DIFDKATITIPMSLYTLSCF--YGPVLGPIVSGALYREN---YRWVFATLLIASGVCLVL 245

Query: 253 GIYSIPN 259
            I++IP 
Sbjct: 246 IIFTIPE 252

>YER061C Chr5 complement(278298..279626) [1329 bp, 442 aa] {ON}
           CEM1Mitochondrial beta-keto-acyl synthase with possible
           role in fatty acid synthesis; required for mitochondrial
           respiration
          Length = 442

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 200 MRKNIVISFIGCMAPVGQTFGGMWGGLIVDSN 231
           M + +VI+ +GC+ P+G++    WG L+   N
Sbjct: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKN 32

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 53/133 (39%), Gaps = 19/133 (14%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           WL+  + L +    L+ GR G + G K + +   +IF + S++   +    ++T  I  R
Sbjct: 114 WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAAT---SMTMLIGGR 170

Query: 174 AFQGLG------VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
              G+G      + FV+ + +        V    +   IS + C   V    G   GG  
Sbjct: 171 VISGIGGSGIQTLCFVITSTL--------VTDRTRGTAISILSCAFAVASVAGPFLGGAF 222

Query: 228 VDSNKDQWPWIFF 240
             +    W W F+
Sbjct: 223 --ATHVTWRWCFY 233

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIY-GLKATFIGGNIIFCIWSIL 156
           MN +A+    +   K W+  SF L + +F  + G++ D+  G K   +     FC+  + 
Sbjct: 64  MNRIAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFCLGLV- 121

Query: 157 CGVSKYTENVTFFIICRA 174
             +S + +NVT F + RA
Sbjct: 122 --ISCFAQNVTQFAVGRA 137

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 7/134 (5%)

Query: 107 SDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENV 166
           +D A   WLM  + L +   +L+ GRI  + GLK + +   +IF   S+L  ++    ++
Sbjct: 39  NDYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALAT---SM 95

Query: 167 TFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGL 226
              I  R   G G + +   V  +   +  V    +  V++ +G    + +  G   GG 
Sbjct: 96  GMLIGGRVIAGFGGSGIETLVFAVGTRM--VDEKHRARVVTILGIAYMLAEGAGPFIGGA 153

Query: 227 IVDSNKDQWPWIFF 240
             +     W W FF
Sbjct: 154 FAE--HVSWRWCFF 165

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query: 129 VSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVM 188
           +SG + D+YG +   + G +I+   SI    S     + F    R  Q  G++ ++    
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 189 GLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGG 225
           G+VG+ + V   R   V +  G    +GQ FG + G 
Sbjct: 198 GVVGD-FTVKQERGTFVGAVSG-FTLMGQAFGSLIGA 232

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           +L A+F+L         GR  D YG K T I G +  CI  ++ G SK+       +I R
Sbjct: 66  YLSATFSLCKFLAAYHWGRFSDEYGRKLTVILGMLGTCISLLILGFSKHFYQA---MIAR 122

Query: 174 AFQGL---GVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIV 228
           +  GL    +A     +  +VG +   G   + I  S I  +   G   G + GG +V
Sbjct: 123 SMMGLLNGNIAV----IRTIVGELTTEGR-HQAIAFSTIPLLFQFGTVIGSIIGGFLV 175

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 15/95 (15%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAF----- 182
           L+S  + D  G K +    ++   +W I CG+   +  V   ++ R   G+G+ F     
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 183 -------VLPNVMGLVGNIYNVGSMRKNIVISFIG 210
                    P V G V  I+ +      +V+ FIG
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLAVTAGILVLFFIG 174

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 60/147 (40%), Gaps = 13/147 (8%)

Query: 108 DGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVT 167
           D     W++  ++L +  F L+  R+  + G + + +   I+F   S+   +S    ++ 
Sbjct: 77  DYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVVSCIILFEAGSL---ISALANSMN 133

Query: 168 FFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
             I  R   G+G + +    + LV     V    + +V+S + C   V    G   GG  
Sbjct: 134 MLIAGRVVAGIGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAF 191

Query: 228 VDSNKDQWPWIFF------ATAIAVFI 248
             +    W W F+        AIA+F+
Sbjct: 192 --TTHVTWRWCFYINLPIGGLAIAIFV 216

>Kwal_26.9264 s26 complement(1138989..1140833) [1845 bp, 614 aa]
           {ON} YGR065C (VHT1) - H+-biotin symporter [contig 70]
           FULL
          Length = 614

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 11/84 (13%)

Query: 195 YNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ---------WPWIFFATAIA 245
           Y +GS      IS   C+   GQ  GG+  GL+  S             W W+F   A+A
Sbjct: 257 YVLGSWYAPDEISSRVCLFFCGQLLGGITSGLLQASTFKHLNGVRGLAGWRWMFLIDAVA 316

Query: 246 VFINL-IMGIYSIPNHVPTNIYNL 268
           + I   ++G + IP  VP+  Y+L
Sbjct: 317 ISIPCAVIGFFVIPG-VPSKCYSL 339

>AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL217W (JEN1)
          Length = 500

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 76  FIGTCMLANLLNQAGQTQTLSTMNV--LADSLNSDGAAKTWLMASFTLASGSFILVSGRI 133
           FI +  LA  L        L ++NV  +A  LN      TW +    +      +V G I
Sbjct: 46  FIASAFLA--LTVEATDFYLVSLNVVSIAQDLNVREDTVTWGITVALMTRTIGAIVYGYI 103

Query: 134 GDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGL 178
           GD +G + +F+   I   + S+L  V+ +  +  +F+ CRA+ G+
Sbjct: 104 GDRFGQRTSFL---INVGMISVLQLVTGFATSFPYFLACRAYFGI 145

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 8/174 (4%)

Query: 67  FKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSF 126
           F +  + +  +G+ +L   L  A    T+ST+         D +   WL   ++L +   
Sbjct: 36  FPTGVELWAPLGSLVLCLFL-AALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALL 94

Query: 127 ILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPN 186
           +L+ GRI  + G K + +   +IF + S+   VS    ++   I  R   G+G + V   
Sbjct: 95  VLIWGRIATLVGFKTSTLAAIVIFEVGSL---VSALANSMDMLIGGRVIAGIGGSGVQSL 151

Query: 187 VMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF 240
           V  +   +  V    + ++I+ +     +    G   GG    +    W W F+
Sbjct: 152 VFVISSTL--VEERNRGLIIAVMSSSFGIASVVGPFLGGAF--TTHVTWRWCFY 201

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 135 DIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNI 194
           DIYG +A +     ++ I++I C +S    N++  +ICR   G+  +  L  V G + ++
Sbjct: 197 DIYGRRAAYFVSLGLYVIFNIPCAISP---NISGHMICRFLCGVYASSGLCLVGGSIADM 253

Query: 195 YNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
           +   +  K   I+F       G  FG +  G +
Sbjct: 254 FPAETRGK--AIAFFAFAPYCGPVFGPLVNGFV 284

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 37/197 (18%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 60  KWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASF 119
           +++DP  + S  +++  +     A+++   G +     + ++    N+        +  +
Sbjct: 86  EYKDPRDYPSILKKFIVL-LIAYASMMGPMGTSIVFPAIGLITSDYNTSTIMVNVSVGIY 144

Query: 120 TLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            ++ G F L    I ++ G +  ++   + F +    C  +  + N+  FII R   G  
Sbjct: 145 LISLGVFPLWWSSISELKGRRTVYL---VSFTLLFAFCIGTAVSPNIQAFIILRVLCGAS 201

Query: 180 VAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCM-APVGQTFGGMWGGLIVDS---NKDQW 235
            A V     G + ++Y      KN+   ++G + AP+      + G L+V+       QW
Sbjct: 202 SASVQSVGAGTIADLYAPEERGKNLGYFYLGALTAPL---LSPIIGSLLVNHWSWRSTQW 258

Query: 236 PWIFFATAIAVFINLIM 252
             +  A A  + I L +
Sbjct: 259 FMVILAGANVILIVLFL 275

>KLTH0D13442g Chr4 complement(1094195..1095973) [1779 bp, 592 aa]
           {ON} similar to uniprot|P53241 Saccharomyces cerevisiae
           YGR065C VHT1 vitamin H transporter H -biotin symporter
          Length = 592

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 11/84 (13%)

Query: 195 YNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ---------WPWIFFATAIA 245
           Y +GS      IS   C+   GQ  GG+  GL+  S             W W+F   A+A
Sbjct: 235 YVLGSWYAPDEISSRVCLFFCGQLLGGVTSGLLQASTYKTLNGVHGLAGWRWMFLIDAVA 294

Query: 246 VFINL-IMGIYSIPNHVPTNIYNL 268
           + I   I+G + IP  VP+  Y+L
Sbjct: 295 ISIPCAIIGFFVIPG-VPSKCYSL 317

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 80/192 (41%), Gaps = 13/192 (6%)

Query: 63  DP-TYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTL 121
           DP T +  S  +   + +  L + L+    T     MN +A+  N+    K W+  S+ L
Sbjct: 54  DPITKYNLSLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQ-KQWIATSYLL 112

Query: 122 ASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVA 181
            + +F  + GR+ DI G K T +     F + S L   SK       F + RA  G+G  
Sbjct: 113 TNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFLTTFSKTLPQ---FALARAVAGIGGG 169

Query: 182 FVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFF- 240
            +       V +I  V    + +   +       GQ  G   GGL++D  +  W  +F  
Sbjct: 170 GISAMSSIAVSDICTVK--ERGMYQGYANIFYGAGQLIGAPIGGLLID--RIGWRALFAF 225

Query: 241 ---ATAIAVFIN 249
                A+A+F++
Sbjct: 226 QVPMVAVAMFLS 237

>KLTH0F17798g Chr6 (1437309..1440704) [3396 bp, 1131 aa] {ON}
           similar to uniprot|P36161 Saccharomyces cerevisiae
           YKR082W NUP133 Subunit of the Nup84p subcomplex of the
           nuclear pore complex (NPC) localizes to both sides of
           the NPC required to establish a normal nucleocytoplasmic
           concentration gradient of the GTPase Gsp1p
          Length = 1131

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 437 QIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNG 496
           QI+ +L     F  SS++L D  P+  +G +  ++++ITNY  + C  + TT ++  +  
Sbjct: 295 QILESLQDLYPFAHSSLLLLDSHPLDTEGSAHMVLSSITNYDGA-CYYILTTIKIDESTN 353

Query: 497 GKDVLKGYRAALYVA 511
              +   YR   YV+
Sbjct: 354 SFAIFSTYRLNTYVS 368

>Suva_5.171 Chr5 complement(255450..256778) [1329 bp, 442 aa] {ON}
           YER061C (REAL)
          Length = 442

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 200 MRKNIVISFIGCMAPVGQTFGGMWGGLIVDSN 231
           M K +VI+ +GC+ P+G+T    W  L+   N
Sbjct: 1   MSKRVVITGLGCVTPLGRTLNESWRNLLSSKN 32

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 8/127 (6%)

Query: 133 IGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVG 192
           I ++YG + TF+    +  IW  L   SK  E V F    R   G   +  L    G + 
Sbjct: 116 ISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLF---GRFLSGFFGSVFLSVAGGAIS 172

Query: 193 NIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIM 252
           +I++    +  I ++     A +G + G +  G +  +N   + W F    IA  + L +
Sbjct: 173 DIFS--KKQIGIPMAIYTTAAFLGPSLGPIISGALYHAN---YKWTFVTLLIASGVCLTL 227

Query: 253 GIYSIPN 259
            + S+P 
Sbjct: 228 IVISVPE 234

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIY-GLK 140
           L + L     T   + MN +A+    +   K W+  SF L + +F  + G++ D+  G K
Sbjct: 48  LGSFLVALDGTIVANVMNRIAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK 106

Query: 141 -ATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLG 179
            AT I     F    I C    + +NVT F I RA  G+G
Sbjct: 107 LATLIAQFFFFLGLIISC----FAQNVTQFAIGRAVCGIG 142

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 3  KLYRKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKD 43
          K YRK+  +   +KNP E+       A ++ +VLSDS K+D
Sbjct: 24 KAYRKQALKYHPDKNPSEEAAEKFKEASSAYEVLSDSEKRD 64

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 60/133 (45%), Gaps = 21/133 (15%)

Query: 96  STMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSI 155
           +T+N +A       +  TW+  ++ L + +   + G+I DI G +   + G I+F +   
Sbjct: 124 TTVNDVASRFQ-QASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVG 182

Query: 156 LCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPV 215
           LC  SK   ++    I R   G+G +                G+M  NI++S +  ++  
Sbjct: 183 LCIFSK---SIPQLAIARGICGIGGS--------------GTGAM-TNIILSDMAPLSER 224

Query: 216 GQ--TFGGMWGGL 226
           G+   +G M GG+
Sbjct: 225 GKYWGYGSMLGGV 237

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 67/154 (43%), Gaps = 16/154 (10%)

Query: 82  LANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKA 141
           L + +     T   + MN +A+    +   K W+  SF L + +F  + G++ DI G + 
Sbjct: 41  LGSFIGSLDGTIVANIMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRF 99

Query: 142 TFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNV---G 198
             +  +  F    + C ++ + ++V  F + RA  G+G   +       V +I      G
Sbjct: 100 ALLTAHFFF---GLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERG 156

Query: 199 SMR--KNIVISFIGCMAPVGQTFGGMWGGLIVDS 230
           S +   NIV          GQ  GG  GGL++D+
Sbjct: 157 SYQGYANIVFG-------TGQMLGGPIGGLLIDT 183

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 72/171 (42%), Gaps = 8/171 (4%)

Query: 90  GQTQTLSTMNV-LADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNI 148
           GQT  L+  +  LA   +   +  ++L+    LA     +++     I+G +  ++ G I
Sbjct: 97  GQTSILAAGSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYLVGII 156

Query: 149 IFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISF 208
           IF   SI C VS+  E++   +  R   GLGV+ +       V  IY   +  +   + F
Sbjct: 157 IFFFGSIGCAVSQNYESL---LASRIVSGLGVSTIESLPSATVAEIYF--AHERAYRLGF 211

Query: 209 IGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPN 259
              +   G+    +    + +       W+F+   I V +N ++ +  +P 
Sbjct: 212 YTLLLLGGKNLVPLLASFVFEYLDRH--WLFWIVTIIVGVNFMLHVLFVPE 260

>NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8.22
           YFL040W
          Length = 565

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 78/197 (39%), Gaps = 29/197 (14%)

Query: 320 ELKKAESPLLPPEVTKNRHIVTIIISLF---LGWGAF----------GIWTFYYYAFNLN 366
           E +  + P +  E+ K      I IS+F   +G+G F          G      Y     
Sbjct: 38  EFETHQEPAI--EIPKKPASAYITISIFCTMIGFGGFICGWDTGTIGGFLAHPDYLRRFG 95

Query: 367 LRH------FSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIF 420
            +H      FS +  G    +F I G +  +T+    N++G  +      I F  G +I 
Sbjct: 96  SKHHDGTYYFSNVRTGLVVSIFNIGGLIGCLTLGDLANRIGRKMALVAVVIIFMVGLVI- 154

Query: 421 SVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATS 480
            + S D+  W      +II  +G+      S ++LS++ P   +G  GS+   +  +   
Sbjct: 155 QIASIDK--WYQYFIGRIISGMGVGAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTFGIF 212

Query: 481 L--CLGMGTTAEVQYNN 495
           L  C   GT A   Y+N
Sbjct: 213 LGDCTNYGTKA---YDN 226

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVS 160
           +W+  S+ L+S +   + G++ D  G K   +  N +F I  ++CG+S
Sbjct: 124 SWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS 171

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 7/133 (5%)

Query: 108 DGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVT 167
           D     W++  ++L +  F L+ GRI    G + + +   ++F   S+   +S    ++ 
Sbjct: 76  DYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSL---ISALARSMN 132

Query: 168 FFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227
             I  R   G+G + +    + LV     V    + +V+S + C   +    G   GG  
Sbjct: 133 MLIAGRVVSGVGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAF 190

Query: 228 VDSNKDQWPWIFF 240
             +    W W F+
Sbjct: 191 --TTHVTWRWCFY 201

>SAKL0F02178g Chr6 complement(187479..189050) [1572 bp, 523 aa] {ON}
           weakly similar to uniprot|P36035 Saccharomyces
           cerevisiae YKL217w
          Length = 523

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187
           L+ G +GD YG K  +    ++ CI  I  G   + ++   F+ CRA  G+    V+ +V
Sbjct: 127 LIFGYLGDRYGRKIPYCISMLLICIIQIGTG---FVKSFPAFLGCRAVFGI----VMGSV 179

Query: 188 MGLVG--NIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIF 239
            G+    ++ N     K+I+          G   G ++   IVD++   W  +F
Sbjct: 180 FGIASATSLENAPEESKSILSGIFQEGYAFGYLLGVVFQRAIVDNSSHGWRAMF 233

>Skud_5.176 Chr5 complement(275089..276417) [1329 bp, 442 aa] {ON}
           YER061C (REAL)
          Length = 442

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 200 MRKNIVISFIGCMAPVGQTFGGMWGGLI 227
           M K +VI+ +GC+ P+G+T    W  L+
Sbjct: 1   MSKRVVITGLGCVTPLGRTLNESWKNLL 28

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 60/154 (38%), Gaps = 7/154 (4%)

Query: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173
           W+  ++ + S SF  + G   D  G +      N  F I  + CG SK   N+      R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSK---NIYMLSFMR 62

Query: 174 AFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKD 233
           A  G+G   +    +  + N   + S ++ I  +F   +   G   G  +GG I  S   
Sbjct: 63  ALTGIGGGGL--ITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIASS--I 118

Query: 234 QWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYN 267
            W W F        I+ I+  Y +PN    N  N
Sbjct: 119 GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQN 152

>YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}
           SEO1Putative permease, member of the allantoate
           transporter subfamily of the major facilitator
           superfamily; mutation confers resistance to ethionine
           sulfoxide
          Length = 593

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 50/122 (40%), Gaps = 10/122 (8%)

Query: 153 WSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMG---LVGNIYNVGSMRKNIVISFI 209
           WS+L   + Y  +V      R F G   AF  P+ +    L G+ Y    M +     ++
Sbjct: 214 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 270

Query: 210 GC---MAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIY 266
           G    +   G     ++  L   +  + W W F   AI   +  ++G YS+P   P N Y
Sbjct: 271 GQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGD-PYNCY 329

Query: 267 NL 268
           ++
Sbjct: 330 SI 331

>TBLA0C04630 Chr3 complement(1122840..1124219) [1380 bp, 459 aa]
           {ON} Anc_7.242 YER061C
          Length = 459

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 204 IVISFIGCMAPVGQTFGGMWGGLI 227
           +V++ +GCM P+G+T G  W  L+
Sbjct: 7   VVVTGLGCMTPLGRTVGQSWNNLL 30

>Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AAR192C
          Length = 489

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 101 LADSLNSDGAAKTW--LMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCG 158
           L+   N   A+ TW   +A  T   G+ I   G +GD YG K +F+    I     I+ G
Sbjct: 71  LSGDFNVKTASITWGITLALMTRTIGAVIF--GYVGDRYGQKTSFLVNLSIMMALQIIIG 128

Query: 159 VSKYTENVTFFIICRAFQGLGV 180
              +  +  +F+ CRA  G+ +
Sbjct: 129 ---FATSFRYFLACRALFGIAL 147

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 319 YELKKAESPLLPPEVTKNRHIVT-IIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGS 377
           +E+K A  PL P +  KNR IV+ +++ LFL + A+ + + Y Y   L     S   A  
Sbjct: 324 WEIKFARYPLTPKDALKNRGIVSALVLVLFLQF-AYQMQSTYLYTVLLVAVDESKKSATR 382

Query: 378 THFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIG 412
            + +F     +T     F + KV  +  F    IG
Sbjct: 383 INKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIG 417

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 122 ASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSI--LCGVSKYTENVTFFIICRAFQGLG 179
           A GSF L  GR+GDIYG +   I  ++IF I ++  +  V  + +    ++I R   GLG
Sbjct: 132 AIGSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQ----YMIGRIIAGLG 185

Query: 180 VAFV 183
              +
Sbjct: 186 CGLI 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,070,871
Number of extensions: 2044742
Number of successful extensions: 7050
Number of sequences better than 10.0: 241
Number of HSP's gapped: 7114
Number of HSP's successfully gapped: 251
Length of query: 547
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 432
Effective length of database: 40,294,809
Effective search space: 17407357488
Effective search space used: 17407357488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)