Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B03930singletonON55555527080.0
KNAG0J002608.843ON55050217730.0
NCAS0A02540singletonON53948517590.0
NCAS0C004008.843ON51747217490.0
NDAI0K004008.843ON55348616770.0
Suva_13.4678.843ON54353515910.0
KAFR0B039408.843ON54750015860.0
YML116W (ATR1)8.843ON54252115830.0
CAGL0M03003g8.843ON55854415770.0
NDAI0E002808.843ON54953615650.0
Suva_13.278.843ON55355315520.0
Skud_13.258.843ON53749915400.0
Smik_13.188.843ON54549715380.0
YMR279C8.843ON54055215340.0
Skud_13.4518.843ON53952415200.0
NCAS0B002908.843ON54252415190.0
SAKL0D01386g8.843ON52151115140.0
Smik_13.4928.843ON54349615000.0
KNAG0G034308.843ON54249314930.0
KLTH0C03806g8.843ON52545614560.0
Kwal_27.102458.843ON51547614420.0
TDEL0B005508.843ON53746014350.0
CAGL0B02343g8.843ON53750414160.0
Kpol_541.168.843ON52848113910.0
KAFR0A028408.843ON52047613690.0
TPHA0C047908.843ON55648513570.0
TBLA0D032708.843ON55054913470.0
TBLA0D03280singletonON58051413421e-180
TBLA0C01160singletonON60046410651e-138
Smik_15.560na 1ON5164838441e-106
Skud_15.545na 1ON5164408351e-105
YOR378Wna 1ON5154888221e-103
KLLA0B00352gna 1ON4984508121e-101
Suva_8.435na 1ON5154807992e-99
KLTH0C10560gna 1ON5154687819e-97
Kwal_23.6547na 1ON5114407652e-94
TDEL0G04950singletonON5124627279e-89
KNAG0D00130na 1ON5654935642e-64
KAFR0C04860na 1ON5344654511e-48
SAKL0C06116gsingletonON1851904163e-47
CAGL0L02519gna 1ON5294474264e-45
NCAS0A05720na 1ON5634824039e-42
NDAI0K02730singletonON6044803689e-37
SAKL0F00440gsingletonON5444761553e-10
NDAI0D010202.242ON5922721332e-07
NCAS0C03460na 2ON6301371252e-06
KLLA0C18931gna 3ON5534571232e-06
KLTH0D16962gsingletonON5711421162e-05
AGR076C8.272ON6864171162e-05
Smik_6.24na 4ON5444741143e-05
Suva_10.11singletonON5404401117e-05
TDEL0G03260singletonON6121391101e-04
SAKL0E08756g2.242ON5652701091e-04
Skud_6.16na 4ON5494441072e-04
Kwal_34.15746na 3ON5182181053e-04
TBLA0G025502.242ON6132391029e-04
SAKL0D04510gna 5ON5311751010.001
KLTH0H16214gsingletonON5514461010.001
ZYRO0G21868gna 6ON6201681000.002
YNL065W (AQR1)2.242ON5862661000.002
CAGL0J01375g2.473ON564155990.002
TPHA0G031502.473ON600178980.002
KLLA0A04631g8.272ON57993980.003
ZYRO0G21890gsingletonON576111970.004
SAKL0A08228gsingletonON569145960.004
Skud_14.2672.242ON562269940.008
YPR198W (SGE1)singletonON543145940.008
SAKL0C05588gsingletonON677171910.023
Skud_7.560na 2ON642133900.024
CAGL0B02079gna 2ON624140900.027
YGR224W (AZR1)na 2ON613133900.027
KLLA0E24113g8.570ON575267900.027
KAFR0J009302.242ON566269900.027
Klac_YGOB_Anc_2.2412.241ON602188900.028
KLTH0B00594gsingletonON618151900.028
Ecym_6024na 5ON48976890.034
Smik_16.81na 2ON625133880.041
ABL210CsingletonON478143880.044
Kwal_56.237548.272ON589175870.052
Kwal_26.9616singletonON562142870.052
TBLA0F030408.272ON906178870.059
NCAS0G029902.242ON581268870.059
KNAG0K01020singletonON599166860.068
ZYRO0C01430g8.272ON590439860.078
TDEL0D06610singletonON49787860.083
TDEL0F039908.272ON631105860.085
SAKL0A00726gsingletonON598152850.10
KLTH0C10142gsingletonON573145850.10
Kpol_543.448.272ON64386850.12
YKR105C (VBA5)singletonON582151840.13
TDEL0B019008.446ON68756830.19
KNAG0I019102.242ON598273820.21
KLTH0C10120gsingletonON651147820.22
AAR192Cna 5ON500144810.29
SAKL0E04246gna 7ON565110810.34
TBLA0E02520singletonON563276800.35
Smik_17.11singletonON544145800.45
TPHA0A017508.272ON63694790.59
Skud_16.503singletonON543145780.64
ZYRO0A00330gsingletonON576160780.67
KLTH0E16720gsingletonON574230780.68
ZYRO0E09966gsingletonON561282780.75
Kwal_27.116388.446ON72356770.96
Kpol_416.5singletonON607155770.96
NDAI0B037702.242ON571263761.1
AFR333WsingletonON500111761.1
SAKL0H16808g8.272ON657137761.2
KLLA0F03311g2.242ON542200751.5
SAKL0B12716gsingletonON632152751.7
Smik_18.10singletonON531114742.1
Kpol_1017.33.503ON621256742.2
KLTH0B00132gsingletonON568134732.4
ZYRO0G19646g3.503ON594127732.4
Kwal_23.48242.242ON553306723.3
KLLA0F17776gna 7ON553131723.4
KLTH0F17798g5.675ON113187723.7
Smik_14.2622.242ON561264723.7
TPHA0D033103.503ON613133723.8
SAKL0C11066gsingletonON58097724.0
ZYRO0A13618gsingletonON529220714.1
NCAS0B020108.570ON530163714.7
KAFR0D05140singletonON574272714.9
KLTH0G13464g8.272ON59371705.8
CAGL0J00363g5.284ON498253706.1
ZYRO0A09878g8.446ON68256707.2
SAKL0H12518g8.446ON73056697.6
SAKL0E08778g2.241ON600242697.8
Kpol_1003.112.241ON581212698.4
KLTH0B10384gsingletonON551115698.7
SAKL0C02178gsingletonON56587699.1
Kwal_14.728singletonON568134689.7
AGL277Wna 8ON671496810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03930
         (555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...  1047   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   687   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   682   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      678   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               650   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   617   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   615   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   614   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   612   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      607   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   602   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   597   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   597   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   595   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   590   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      589   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   587   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   582   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   579   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   565   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   560   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   557   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   550   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   540   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   531   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   527   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   523   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   521   e-180
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   414   e-138
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   329   e-106
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   326   e-105
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   321   e-103
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   317   e-101
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   312   2e-99
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   305   9e-97
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   299   2e-94
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   284   9e-89
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   221   2e-64
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     178   1e-48
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   164   3e-47
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   168   4e-45
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            159   9e-42
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   146   9e-37
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    64   3e-10
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    56   2e-07
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    53   2e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    52   2e-06
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    49   2e-05
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    49   2e-05
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    49   3e-05
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    47   7e-05
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               47   1e-04
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    47   1e-04
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    46   2e-04
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    45   3e-04
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    44   9e-04
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    44   0.001
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    44   0.001
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    43   0.002
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    43   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    43   0.002
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    42   0.002
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    42   0.003
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    42   0.004
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    42   0.004
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    41   0.008
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    41   0.008
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.023
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    39   0.024
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    39   0.027
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    39   0.027
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    39   0.027
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    39   0.027
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    39   0.028
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    39   0.028
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    39   0.034
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    39   0.041
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    39   0.044
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    38   0.052
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    38   0.052
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    38   0.059
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    38   0.059
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    38   0.068
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    38   0.078
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    38   0.083
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    38   0.085
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    37   0.10 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    37   0.10 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    37   0.12 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    37   0.13 
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    37   0.19 
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    36   0.21 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    36   0.22 
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    36   0.29 
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    36   0.34 
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    35   0.35 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    35   0.45 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    35   0.59 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    35   0.64 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    35   0.67 
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    35   0.68 
ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} simila...    35   0.75 
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    34   0.96 
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    34   0.96 
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    34   1.1  
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    34   1.1  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    34   1.2  
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    33   1.5  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    33   1.7  
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    33   2.1  
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    33   2.2  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    33   2.4  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    33   2.4  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    32   3.3  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   3.4  
KLTH0F17798g Chr6 (1437309..1440704) [3396 bp, 1131 aa] {ON} sim...    32   3.7  
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    32   3.7  
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    32   3.8  
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    32   4.0  
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    32   4.1  
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     32   4.7  
KAFR0D05140 Chr4 (1010805..1012529) [1725 bp, 574 aa] {ON}             32   4.9  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    32   5.8  
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    32   6.1  
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    32   7.2  
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    31   7.6  
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    31   7.8  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    31   8.4  
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    31   8.7  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    31   9.1  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    31   9.7  
AGL277W Chr7 (185070..187085) [2016 bp, 671 aa] {ON} NOHBY715; N...    31   10.0 

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 1047 bits (2708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/555 (93%), Positives = 519/555 (93%)

Query: 1   MIEIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE 60
           MIEIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE
Sbjct: 1   MIEIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE 60

Query: 61  KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120
           KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK
Sbjct: 61  KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120

Query: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180
           TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC
Sbjct: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180

Query: 181 RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAE 240
           RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAE
Sbjct: 181 RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAE 240

Query: 241 KQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEA 300
           KQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEA
Sbjct: 241 KQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEA 300

Query: 301 PIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGS 360
           PIVGWEKAY                 YEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGS
Sbjct: 301 PIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGS 360

Query: 361 FGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVA 420
           FGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVA
Sbjct: 361 FGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVA 420

Query: 421 FTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVN 480
           FTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVN
Sbjct: 421 FTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVN 480

Query: 481 TIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQ 540
           TIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR                   FLFESLRQ
Sbjct: 481 TIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQ 540

Query: 541 KRGRTAALTAKKDMS 555
           KRGRTAALTAKKDMS
Sbjct: 541 KRGRTAALTAKKDMS 555

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/502 (65%), Positives = 386/502 (76%)

Query: 37  DSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQ 96
           +  T+V EK +  +  E       +F+DN+TPWQNP+YF++RW+EY FI TCML+ LLNQ
Sbjct: 30  NDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQ 89

Query: 97  AGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLI 156
           AGQ QAT+ MN++  AFN+ +  +TWLMASFPLVSGSFILVSGRIGDIYGLK+T+IGG +
Sbjct: 90  AGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYL 149

Query: 157 VMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISC 216
           V++IWSLICGFANY+ +  FFI+CRAFQGLGIAF+LPNVMGL+GNIYK  +LRKN VIS 
Sbjct: 150 VVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISF 209

Query: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGF 276
           +GMCAP GAA G  W+GLIA +  KQWPWIFYAYA    +N+V+AIYSIP TVP N+HGF
Sbjct: 210 VGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGF 269

Query: 277 SMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPL 336
            MDWTGS +GV+G+ILFNFVWN+ PI GW K Y                 YEIKFAKSPL
Sbjct: 270 GMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPL 329

Query: 337 LPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTI 396
           LP  V  N +I MIL A+FMGWGSFGIWTFYYYAF LNLR Y+ + AG +  MF++WGTI
Sbjct: 330 LPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTI 389

Query: 397 AAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSF 456
           AAF VA TIKRVGPSVLL  SM  FTVG IMLS+TPVHQ+YWKM  GMQIIL+FGMDLSF
Sbjct: 390 AAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSF 449

Query: 457 PASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRXXX 516
           PASSIILSD LP +YQGMAGSLVNT+VNYSTSLCLG+G+TAE QVNKNGTD LKGYR   
Sbjct: 450 PASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAAL 509

Query: 517 XXXXXXXXXXXXXXXXFLFESL 538
                           +LFE L
Sbjct: 510 YVGIGLGACGMLVAFCYLFEVL 531

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/485 (65%), Positives = 390/485 (80%), Gaps = 7/485 (1%)

Query: 29  ATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTC 88
           +T++  N D + S +EK       E  S   +   D+++PWQNP+YFSS++KEY FI TC
Sbjct: 17  STVSFPNEDKNISHNEK-------EVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTC 69

Query: 89  MLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLK 148
           M++NLLNQAGQTQ  STMNVI  +F++DS  +TWLMASFPLVSGSFIL+SGRIGDIYGLK
Sbjct: 70  MVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLK 129

Query: 149 RTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSL 208
           +TMIGG I MIIWSL+CGFA+++ + TFFI+CRAFQGLGI+F+LPNVMGL+GNIYKVG+L
Sbjct: 130 KTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTL 189

Query: 209 RKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
           RKNIVIS IG+ APTGA  GA W GLI T+  KQWPWIFYAYA  G++NL++A+YS+P+ 
Sbjct: 190 RKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNC 249

Query: 269 VPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYE 328
           +P NVH F+MDW GS++GV+GLILFNFVWN+ P+ GW+KAY                 YE
Sbjct: 250 IPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYE 309

Query: 329 IKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHC 388
           +K+  SPLLP  VT N  I+ ILS +F+GWG+FGIWTFYY+AF LNLR Y+P+  G ++ 
Sbjct: 310 LKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYF 369

Query: 389 MFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIIL 448
           MFI+WGTIAA  VAFTIK+VGP++LLF S + FT+GS+MLS+TP+HQ YW+M  GMQIIL
Sbjct: 370 MFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIIL 429

Query: 449 AFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDL 508
            FGMDLSFPASSIILSD LPM+YQGMAGSLVNT++NY+TSLCLGMGTT E Q+NK+G DL
Sbjct: 430 CFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDL 489

Query: 509 LKGYR 513
           LKGYR
Sbjct: 490 LKGYR 494

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/472 (66%), Positives = 378/472 (80%)

Query: 42  VSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQ 101
           +  K   +S  +  +   +   +N+TPWQN  YF S  KEY FI TCM +NLLNQAGQTQ
Sbjct: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60

Query: 102 ATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIW 161
             STMNVI  +F++D  ++TWLMASFPLVSGSFIL+SGRIGDIYGLK+TMIGG I MIIW
Sbjct: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120

Query: 162 SLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCA 221
           +L+CGFA+Y+ S TFFI+CRAFQGLGI+F+LPN+MGLVGNIYKVG+LRKNIVIS IG+ A
Sbjct: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180

Query: 222 PTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWT 281
           PTGA  GA W GLIAT++ +QWPWIFYAYA A  +NL++AIYS+P+ VP NVH F+MDW 
Sbjct: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240

Query: 282 GSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAV 341
           G+++GV+GLILFNFVWN+ P+ GW K Y                 YE+KF  SPLLP+ V
Sbjct: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREV 300

Query: 342 THNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTV 401
           T N  I+ IL  +F+GWGSFGIWTFYYYAF LNLR Y+PL AGA+H MFI+WG+IAAF V
Sbjct: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360

Query: 402 AFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSI 461
            FTI RVGP+VLLF S + FT+GS+MLS+TP+HQTYW+M  GMQIIL+FGMDLSFPASSI
Sbjct: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420

Query: 462 ILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           ILSD LPM+YQGMAGSLVNTI+NYSTSLCLGMGTT E Q+NK G +LL+GYR
Sbjct: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYR 472

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 387/486 (79%), Gaps = 1/486 (0%)

Query: 28  KATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILT 87
           ++TI+  + +  T++ E+   I     T+  +    +NN+ WQNP YFSS +KEY+F+ T
Sbjct: 23  QSTIDCTSSERKTAIKEQDDEIGSDSTTT-SSSSLQENNSSWQNPDYFSSSFKEYIFVAT 81

Query: 88  CMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGL 147
           CM++NLLNQAGQ+Q  S MNVI  +F++ +  +TWLMASFPLVSGSFIL+SGR+GDIYGL
Sbjct: 82  CMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGL 141

Query: 148 KRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS 207
           KR MIGG I MIIWSLICGF NY+ S TFFI+ RAFQGLGI+F+LPNVMGLVGNIYKVG+
Sbjct: 142 KRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGT 201

Query: 208 LRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPD 267
           LRKN+VIS IG+ APTG+ FGA W GLI T+  KQWPWIFYAYA A  + LV+  Y++PD
Sbjct: 202 LRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPD 261

Query: 268 TVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXY 327
            +P NV+GF+MDW GSV+GVIGLILFNFVWN+ PIVGWEKAY                 Y
Sbjct: 262 NIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVY 321

Query: 328 EIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASH 387
           EIK+AK PLLP+AVT N +I+ IL+ +F+GWGSFGIWTFYY+AF LNLR Y+P+ +G + 
Sbjct: 322 EIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTF 381

Query: 388 CMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQII 447
            +FI++GT+AA TVA TIK+VGP++LLF S + FT GSI++S+TPVHQTYW+ TFGMQII
Sbjct: 382 FVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQII 441

Query: 448 LAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTD 507
           L FGMDL FPASSIILSD LPM+YQGMA SLVNTIVNYSTSLCLGMGTT E Q+NK+G D
Sbjct: 442 LVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDD 501

Query: 508 LLKGYR 513
           LLKGYR
Sbjct: 502 LLKGYR 507

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/535 (56%), Positives = 386/535 (72%), Gaps = 5/535 (0%)

Query: 20  QEKVNVAVKAT--INTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSS 77
           +EKVNV  K +  I+ ++  +   V   +    V    S +      N++PWQ+P+YFSS
Sbjct: 6   EEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSS 65

Query: 78  RWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILV 137
             +E +FI+TCML+ LLNQAGQT A + MNV+  +FN++S  + WLMASFPLV+GSFIL+
Sbjct: 66  FGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILI 125

Query: 138 SGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMG 197
           SGR+GDIYGLK+ ++ G + +I+WSLICG + YS++  FFI CRAFQGLGIAF+LPNVMG
Sbjct: 126 SGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMG 185

Query: 198 LVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILN 257
           LVG++YKVGS RKN+VIS IG CAP G  FG  + GLI  +  +QWPW+FYA+A A  LN
Sbjct: 186 LVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLN 245

Query: 258 LVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXX 317
           ++LA YSIP+ +P NVHGFSMDWTGSV+ VIGLILFNFVWN+AP  GW  AY        
Sbjct: 246 MILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS 305

Query: 318 XXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRG 377
                    YE+K+AK PLLP AVT N ++IMIL A+F+GWGSFGIWTFYY +F LNLR 
Sbjct: 306 VFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRH 365

Query: 378 YTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTY 437
           Y+P+  G ++ +F+++GTIAAF VA +IKRVGP+ LL  ++VAF VGSIM S+ PV Q++
Sbjct: 366 YSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSF 425

Query: 438 WKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTA 497
           WK+ FGMQ IL FGMDLSFPASSIILSD LPMEYQGMAGSLVNT++NYS SLCLGMG T 
Sbjct: 426 WKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATV 485

Query: 498 EIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESL---RQKRGRTAALT 549
           E Q+NKNG DLLKGYR                   ++ E+    R+ R + + +T
Sbjct: 486 EHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT 540

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/500 (60%), Positives = 368/500 (73%), Gaps = 7/500 (1%)

Query: 17  EQKQEKVNVAVKATINTLNYDSSTSV---SEKTSAISVFEGTSPDAEKFSDNNTPWQNPS 73
           +Q++E+ N        T+   +S  V   S K   IS+   T  D    S NN+ WQ+P+
Sbjct: 10  KQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISI---TDDDVSSIS-NNSKWQDPT 65

Query: 74  YFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGS 133
           YF S W+EY FI TCML+NLLNQAGQTQ  STMNV+  + N+D ++KTWLMASF L SGS
Sbjct: 66  YFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGS 125

Query: 134 FILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLP 193
           FILVSGRIGDIYGLK T IGG I+  IWS++CG + Y+ +VTFFIICRAFQGLG+AFVLP
Sbjct: 126 FILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185

Query: 194 NVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFA 253
           NVMGLVGNIY VGS+RKNIVIS IG  AP G  FG  W GLI    + QWPWIF+A A A
Sbjct: 186 NVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIA 245

Query: 254 GILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXX 313
             +NL++ IYSIP+ VP N++   MDW GS++GVIGLIL NFVWN+API GW KAY    
Sbjct: 246 VFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVI 305

Query: 314 XXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLL 373
                        YE+K A+SPLLP  VT N +I+ I+ ++F+GWG+FGIWTFYYYAF L
Sbjct: 306 LIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNL 365

Query: 374 NLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPV 433
           NLR ++PL AG++H +FI++G++ A TVAFTI +VGPSVL   S + FT G+I+ S+T  
Sbjct: 366 NLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSP 425

Query: 434 HQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGM 493
            QTYW+ + GMQIILA GMDLSFP SSIILSD LPM+YQGM+GSLVNTI NY+TSLCLGM
Sbjct: 426 DQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGM 485

Query: 494 GTTAEIQVNKNGTDLLKGYR 513
           GTTAE+Q N  G D+LKGYR
Sbjct: 486 GTTAEVQYNNGGKDVLKGYR 505

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/521 (58%), Positives = 370/521 (71%), Gaps = 8/521 (1%)

Query: 35  NYDSSTSVSEKTSAISVFEGTSPDAEKFS-------DNNTPWQNPSYFSSRWKEYLFILT 87
            Y++ T +  K S+     G S  A  F+       D+N  WQNP+YF   W+EYLFI T
Sbjct: 15  EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFT 74

Query: 88  CMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGL 147
           CM+S LLNQAG TQ  S MN++  +F ++ +SK+WLMASFPLVSGSFIL+SGR+GDIYGL
Sbjct: 75  CMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGL 134

Query: 148 KRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS 207
           K+ ++ G +++IIWSLICG   YS S TFFII RAFQGLGIAFVLPNV+G++GNIY  G+
Sbjct: 135 KKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGT 194

Query: 208 LRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPD 267
            RKNIVIS +G  AP GA  G  +AGLI T+  KQWPW FYAY+ A  +N VL+IY+IP 
Sbjct: 195 FRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPS 254

Query: 268 TVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXY 327
           T+P N+H FSMDW GSV+GVIGLIL NFVWN+API GW +AY                 Y
Sbjct: 255 TIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIY 314

Query: 328 EIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASH 387
           EI+FAK+PLLP+AV  + ++I I+ A+F GWGSFGI+TFYY+ F LN+R YT L AG ++
Sbjct: 315 EIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTY 374

Query: 388 CMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQII 447
            MF++WG IAA  V FTIK V PSV LF SMVAF VGSIM S+TPVH+TY++   G  II
Sbjct: 375 FMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMII 434

Query: 448 LAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTD 507
           L+FGMDLSFPASSII SD LPMEYQGMAGSLVNT+VNYS SLCLGMG T E QVN +G  
Sbjct: 435 LSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKH 494

Query: 508 LLKGYRXXXXXXXXXXXXXXXXXXXFLFES-LRQKRGRTAA 547
           LLKGYR                   ++ ES ++ +R R AA
Sbjct: 495 LLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAA 535

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/544 (57%), Positives = 391/544 (71%), Gaps = 10/544 (1%)

Query: 9   NSITSASGEQKQEKVN--------VAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE 60
           +++TS     K EK N        +A        + D   S S++ S  S  +G     +
Sbjct: 7   HNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDECQSNSDQLSVTS--KGCICSVD 64

Query: 61  KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120
              +N++P+QNP YF + +KE +FI++CM++ LLNQAGQTQ+ STMNV+   F ++SS +
Sbjct: 65  DCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQ 124

Query: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180
            WLMASFPLVSGSFIL+SGR+GDIYGLK+ +  G I+M +WS+ICG A Y++S  FFI+C
Sbjct: 125 PWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVC 184

Query: 181 RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAE 240
           R+FQGLGIAF+LPN+MGLVGNIYKVG+LRKNIVISCIG  AP GAA GA + GLI T+  
Sbjct: 185 RSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDA 244

Query: 241 KQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEA 300
           +QWPW+FYA+  A  +N++LA+YSIP+ VP N++  +MDW GS++GV GL+L N VWN+A
Sbjct: 245 EQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQA 304

Query: 301 PIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGS 360
           PIVGW +AY                 YEIK+A SPLLP +V  N  I+MIL+A+F GWGS
Sbjct: 305 PIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGS 364

Query: 361 FGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVA 420
           FGIWT+YYYAF LNLR YTPL AG +H MF++WGT+AAF VA TIK+VGP+VLL  SMVA
Sbjct: 365 FGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVA 424

Query: 421 FTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVN 480
           F  GSIMLS+TPVHQTYW+M  GMQIIL+FGMDLSFPASSIILSD LPM+YQGMAGSLVN
Sbjct: 425 FDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVN 484

Query: 481 TIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQ 540
           T+VNYSTSLCLGMG T E Q N +G DLLKGYR                   FL   +  
Sbjct: 485 TVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIA 544

Query: 541 KRGR 544
           KR R
Sbjct: 545 KRHR 548

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/536 (55%), Positives = 380/536 (70%), Gaps = 1/536 (0%)

Query: 21  EKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFS-DNNTPWQNPSYFSSRW 79
           E+     ++T + +  + S+   E+ + +S  E  S + E  +  +++ WQNP YF ++W
Sbjct: 14  EEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKW 73

Query: 80  KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSG 139
           +EYLFI +CM+S LLNQA   Q  S MN+I  +F ++   +TWL+ASFPLVSGSFIL+SG
Sbjct: 74  QEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISG 133

Query: 140 RIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLV 199
           RIGDIYGLK+T+IGG +  IIWSLI GF +YS +  FFII RAFQGLGIAF+LPNVMG+V
Sbjct: 134 RIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIV 193

Query: 200 GNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLV 259
           GNIYK  + RKNIVIS IG  AP GA  G+ +AGLI T+  KQWPW FYA+A A  +NL 
Sbjct: 194 GNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLA 253

Query: 260 LAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXX 319
           ++IYSIP+ +P N+HGF+MDW GS++ VIGLIL NFVWN+ PIVGW+KAY          
Sbjct: 254 ISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISII 313

Query: 320 XXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYT 379
                  YEIK+AKSP+LP  VT N +IIMIL+A+F+GWGSFGI++FYY++FLLNLR Y+
Sbjct: 314 ALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYS 373

Query: 380 PLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWK 439
            L AG ++ MF +WGT+AA  V   IKR+  SV+LF SM+AF +G IMLS+TPV QTY++
Sbjct: 374 ALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFR 433

Query: 440 MTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEI 499
           M  G  IIL+FGMD+SFPA++IILSD L M+YQGMAGSL NT+VNYS SLCLGMGTT E 
Sbjct: 434 MNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVER 493

Query: 500 QVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQKRGRTAALTAKKDMS 555
           Q+NK+G ++LKGYR                   ++ E L  KR    +     DMS
Sbjct: 494 QINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDMS 549

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/553 (53%), Positives = 376/553 (67%), Gaps = 6/553 (1%)

Query: 3   EIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKF 62
           E +  +  + +A  E+   ++   V      L  + S+  + K  A++    T+ + E  
Sbjct: 7   ECVIQNPEVKTAGKEEDYLEIENEV-----ALEAEDSSPRNNKEGALTTIVLTNSEDEVM 61

Query: 63  SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTW 122
                 WQNP+YF   W+EYLFI TCM+S LLNQ+G TQ  S MN++  +F +D++S++W
Sbjct: 62  KTKQK-WQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSW 120

Query: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182
           LMASFPLVSGSFIL+SGR+GDI+GLK  ++ G +++IIWSLICG   YS S TFFI+ RA
Sbjct: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA 180

Query: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQ 242
           FQGLGIAFVLPNV+G++GN+Y  G+ RKNIVIS IG  AP GA  G F+AGLI T    Q
Sbjct: 181 FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ 240

Query: 243 WPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPI 302
           WPW FYAY    ++NL+L+IY+IP+ +P NVH FSMDW GS +GVIGL+L N VWN+API
Sbjct: 241 WPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPI 300

Query: 303 VGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFG 362
            GW +AY                 YEI FAKSPLLPQAV  + ++I I+ ++F GWGSFG
Sbjct: 301 SGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFG 360

Query: 363 IWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFT 422
           I+TFYY+ F LN+R YTPL AG S+ MF++WG IAA  V F+IKRV PSV LF +MVAF 
Sbjct: 361 IFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFN 420

Query: 423 VGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTI 482
           VGSIM S+TPVH+TY++M  G  IIL+FGMDLSFPASSII SD LPMEYQGMAGSLVNT+
Sbjct: 421 VGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTV 480

Query: 483 VNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQKR 542
           VNYS SLCLGMG T E+Q++ +G  +LKGYR                   ++ E   +  
Sbjct: 481 VNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDH 540

Query: 543 GRTAALTAKKDMS 555
              A    K+ MS
Sbjct: 541 RAKAVAEDKRSMS 553

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/499 (57%), Positives = 359/499 (71%), Gaps = 6/499 (1%)

Query: 15  SGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSY 74
           S E +Q+    A   +++ +   S    +E+T  IS   G     E+ + +   WQNP+Y
Sbjct: 9   SAESRQDSFE-AENESVSAVKKSSRHDGNEETVTISTDHG-----EEMTVDKQRWQNPNY 62

Query: 75  FSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSF 134
           F + W EYLFI TCM+S LLNQAG TQ  S MN+I ++F ++ +S+TWLMASFPLVSGSF
Sbjct: 63  FKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSF 122

Query: 135 ILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPN 194
           IL+SGR+GDIYGLK+ +  G +V+IIWSLICG   YS S TFFII RAFQGLGIAFVLPN
Sbjct: 123 ILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPN 182

Query: 195 VMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAG 254
           V+G++GNIY  G+ RKNIVIS +G  AP GA  G  +AGLI TK  KQWPW FYAY    
Sbjct: 183 VLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITS 242

Query: 255 ILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXX 314
           I+NL L++YSIP+ +P N+  FSMDW GS +GVIGL+L NFVWN+API GW++AY     
Sbjct: 243 IINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLL 302

Query: 315 XXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLN 374
                       YE +FAKSPLLP+AV  + ++I I+ A+F GWGSFGI+TFYY+ F LN
Sbjct: 303 VISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLN 362

Query: 375 LRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVH 434
           +R Y+ + AG ++ MF++WG IAA  V   IK+V PSV LF SM+AF +GSIM S+TPVH
Sbjct: 363 IRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVH 422

Query: 435 QTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMG 494
           +TY++   G  IIL+FGMD SFPASSII SD LPMEYQGMAGSLVNT+VNYS SLCLGMG
Sbjct: 423 ETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMG 482

Query: 495 TTAEIQVNKNGTDLLKGYR 513
            T E  V+ +G  +LKGYR
Sbjct: 483 ATVETHVDPDGKHVLKGYR 501

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/497 (58%), Positives = 359/497 (72%), Gaps = 3/497 (0%)

Query: 17  EQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFS 76
           E+K +         +      S  + SE+T   + F       ++  + N  WQNP YF 
Sbjct: 10  EEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLE---DEMVECNQKWQNPKYFK 66

Query: 77  SRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFIL 136
             W+EYLFI TCM+S LLNQAG TQ  S MN++  +F ++ +SK+WLMASFPLVSGSFIL
Sbjct: 67  YAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 126

Query: 137 VSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVM 196
           +SGR+GDIYGLK+ ++ G +++IIWSLICG  NYS S TFFIICRAFQGLGIAFVLPNV+
Sbjct: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186

Query: 197 GLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGIL 256
           G++GNIY  G+ RKNIVIS +G  AP GA  G  +AGLI T+   QWPW FYA++ A ++
Sbjct: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLI 246

Query: 257 NLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXX 316
           N  L+IY+IP+ +P N+H FSMDW GSV+GVIGLIL NFVWN+API GW +AY       
Sbjct: 247 NFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILII 306

Query: 317 XXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLR 376
                     YE+ FAKSPLLP AV  ++++I I+ A+F GWGSFGI+TFYY+ F LN+R
Sbjct: 307 SVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 366

Query: 377 GYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQT 436
            YT L AG ++ MF++WG IAA  V FTIK V PSV LF SMVAF VGSIM S+TPVH+T
Sbjct: 367 HYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHET 426

Query: 437 YWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTT 496
           Y++   G  IIL+FGMDLSFPASSII SD LPMEYQGMAGSLVNT+VNYS SLCLGMG T
Sbjct: 427 YFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 486

Query: 497 AEIQVNKNGTDLLKGYR 513
            E Q++ +G  LLKGYR
Sbjct: 487 VETQLDPDGKHLLKGYR 503

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/552 (53%), Positives = 387/552 (70%), Gaps = 14/552 (2%)

Query: 1   MIEIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE 60
           M  I     S+     E   EK+ V  K  +       ST   E T+ +S  + T     
Sbjct: 1   MFSIFKKKTSVQGTDSE-IDEKITVKAKDKVVV-----STEDEEVTTIVSSTKSTQ---- 50

Query: 61  KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120
               N++PWQ+P+YFSS  KE +FI TCML+ LLNQAGQT A   MNV+  +FN++++++
Sbjct: 51  --VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ 108

Query: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180
            WLMASFPL +GSFIL+SGR+GDIYGLK+ +I G +++I+WS+I G + YS+S  FFI  
Sbjct: 109 AWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITS 168

Query: 181 RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAE 240
           RAFQG+GIAF+LPN+MGLVG++YKVGS RKNIVIS IG CAPTG  FG  + GLI T+  
Sbjct: 169 RAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDP 228

Query: 241 KQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEA 300
            QWPW+FYA+  A  L+L++A YSIP+ VP N+HG SMDWTGS + +IGLILFNFVWN+A
Sbjct: 229 NQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQA 288

Query: 301 PIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGS 360
           PIVGW+K Y                 YE K+A+ PLLP+A+T N ++IMIL A+F+GWGS
Sbjct: 289 PIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGS 348

Query: 361 FGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVA 420
           FGIWTFYY +F LNLR Y+P+  G ++ +F+++G++AAF VAF+IKR+GP++LL  S++A
Sbjct: 349 FGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMA 408

Query: 421 FTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVN 480
           F  GSIM S+ PV Q+YWK+ F MQ IL FGMDLSFPASSIILSD LPM+YQGMAGSLVN
Sbjct: 409 FDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVN 468

Query: 481 TIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESL-- 538
           T++NYS SLCLGMG T E Q+NK+G DLLKGYR                   ++ E+L  
Sbjct: 469 TVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWN 528

Query: 539 RQKRGRTAALTA 550
           R ++    +L A
Sbjct: 529 RHRKSEDRSLEA 540

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/524 (55%), Positives = 384/524 (73%), Gaps = 3/524 (0%)

Query: 24  NVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSD---NNTPWQNPSYFSSRWK 80
            ++V+ T + +N   S    +K    +  E T+  +   S+   N++PWQ+P+YFSS  K
Sbjct: 8   KMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGK 67

Query: 81  EYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGR 140
           E +FI TCML+ LLNQAGQT A   MNV+  +F ++S+++ WLMASFPL +GSFIL+SGR
Sbjct: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGR 127

Query: 141 IGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVG 200
           +GDIYGLK+ ++ G +++I+WS+I G + YS++ +FFI CRAFQG+GIAF+LPN+MGLVG
Sbjct: 128 LGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVG 187

Query: 201 NIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVL 260
           ++YKVGSLRKN+VIS IG C PTGA FG  + GLI T+   QWPW+FYA+  A  +++++
Sbjct: 188 HVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLM 247

Query: 261 AIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXX 320
           A YSIP+ VP NVHG SMDWTGSV+ VIGLILFNFVWNEAPI GW+KAY           
Sbjct: 248 AWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFF 307

Query: 321 XXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTP 380
                 YEIK+A+ PLLP AVT N ++IMIL A+F+GWGSFGIWTFYY +F LNLR Y+P
Sbjct: 308 LVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSP 367

Query: 381 LEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKM 440
           +  G ++ +F ++GTIAAF VAF+IKR+GP++LL  +++AF  GSIM S+ PV Q+YWK+
Sbjct: 368 VWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKL 427

Query: 441 TFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQ 500
            F MQ +L FGMDLSFPASSIILSD LPM+YQGMAGSLVNT++NYS SLCLGMG T E Q
Sbjct: 428 NFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQ 487

Query: 501 VNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQKRGR 544
           +NK+G ++L+GYR                   ++ E++  +R +
Sbjct: 488 INKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/524 (56%), Positives = 372/524 (70%), Gaps = 6/524 (1%)

Query: 38  SSTSVSEKTSAISVFEGTSPDAEKFSDNNTP------WQNPSYFSSRWKEYLFILTCMLS 91
           +++S++E+TS I   +    + +  S   TP      WQNP YF ++W+EYLFI +CM+S
Sbjct: 19  AASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMS 78

Query: 92  NLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTM 151
            LLNQA   Q  S MN+I  +FN++   +TWL+ASFPLVSGSFIL+SGRIGDIYGLK+T+
Sbjct: 79  QLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL 138

Query: 152 IGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKN 211
           +GG I  IIWS+I G   YS S TFFI+ RAFQGL IAF+LPNVMG+VGNIYK  S RKN
Sbjct: 139 VGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKN 198

Query: 212 IVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPV 271
           IVIS IG  AP GA FG+ +AGLI T+   QWPW FYA+A A   NL ++IYSIP++VP 
Sbjct: 199 IVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPT 258

Query: 272 NVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKF 331
           NVHGF+MDW GSV+ VIGLIL NFVWN+ PIVGW+ AY                 YE+K+
Sbjct: 259 NVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKY 318

Query: 332 AKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFI 391
           A+SPLLP  VT N +IIMIL+A+F+GWGSFGI++FYY++FLLNLR Y+ L AG ++ MF 
Sbjct: 319 AESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFA 378

Query: 392 LWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFG 451
           +WGT+AA  V   IK++  + +LF SMVAF +G IMLS+TPV QTY++M  G  IIL+FG
Sbjct: 379 IWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFG 438

Query: 452 MDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKG 511
           MD+SFPA++IILSD L M+YQGMAGSL NT+VNYS SLCLGMGTT E Q+NK+G DLLKG
Sbjct: 439 MDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKG 498

Query: 512 YRXXXXXXXXXXXXXXXXXXXFLFESLRQKRGRTAALTAKKDMS 555
           YR                   +L E L  KR +  A     D+S
Sbjct: 499 YRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQHLAANVVPDLS 542

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/511 (55%), Positives = 363/511 (71%), Gaps = 5/511 (0%)

Query: 38  SSTSVSEKTSAISVFEGTS-PDAEKFSDNNTPW---QNPSYFSSRWKEYLFILTCMLSNL 93
           S+ SVS ++  +     T+  +      ++  W   Q+P+YFS+ WKEYLFI   M+S L
Sbjct: 6   SNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQL 65

Query: 94  LNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIG 153
           LNQAG TQ  S +N++   F++ +S +TWLMASFPLVSGSFILVSG+IGDIYGLK+T++ 
Sbjct: 66  LNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125

Query: 154 GLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIV 213
           G +V IIWSLICG  +Y+SSV FFII RAFQGLGIAF+LPN+MG+VGNIY  G+ RKN+V
Sbjct: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185

Query: 214 ISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNV 273
           IS IG CAP GA  G  ++GLI T +E+ W W FYAY     +N+ L+I+ IP+T+P NV
Sbjct: 186 ISLIGACAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGLSIWVIPNTIPTNV 244

Query: 274 HGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAK 333
            G SMDW GS +G++G+ILFNFVWN+ PIVGW+ AY                 YE K+A 
Sbjct: 245 RGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYAN 304

Query: 334 SPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILW 393
            PL+P+   HNH ++M L A+F GWGSFGIWTFYY+ F+LNLR YTPL AG S+ MF++W
Sbjct: 305 DPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIW 364

Query: 394 GTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMD 453
           G IAA +V +TIKR+ PS++LF SM+AF  G IMLS+TPV QTY++M  GM IIL+FGMD
Sbjct: 365 GIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMD 424

Query: 454 LSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           LSFPASSIILSD LPME QGMAGSLV+T++NYS S+CLG+  T E Q+NKNG DLLKGYR
Sbjct: 425 LSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYR 484

Query: 514 XXXXXXXXXXXXXXXXXXXFLFESLRQKRGR 544
                              F+ E+  + R R
Sbjct: 485 AALYLGIGLASLGVFISALFMLENYLRMRRR 515

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 374/496 (75%), Gaps = 4/496 (0%)

Query: 22  KVNVAVKATINTLNYDSSTSVSEK----TSAISVFEGTSPDAEKFSDNNTPWQNPSYFSS 77
           K  ++V+ T   ++  +   V +K    T    V   TS +      N++PWQ+P YFSS
Sbjct: 6   KKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSS 65

Query: 78  RWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILV 137
             KE +FI TCML+ LLNQAGQT A   MNV+  +FN++S+++ WLMASFPL +GSFIL+
Sbjct: 66  FGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILI 125

Query: 138 SGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMG 197
           SGR+GDIYGLK+ ++ G +++IIWS+I G + YS+S  FFI CRAFQGLGIAF+LPN+MG
Sbjct: 126 SGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMG 185

Query: 198 LVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILN 257
           LVG++YKVGSLRKN+VIS IG CAP G  FG  + GLI T+  +QWPW+FYA++ A  ++
Sbjct: 186 LVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFIS 245

Query: 258 LVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXX 317
           L++A YSIP+ VP NVHG SMDWTGS + V+GLILFNFVWN+API GW +AY        
Sbjct: 246 LLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILS 305

Query: 318 XXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRG 377
                    YEIK+A+ PLLP AVT N ++IMIL A+F+GWGSFGIWTFYY +F LNLR 
Sbjct: 306 VFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRH 365

Query: 378 YTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTY 437
           Y+P+  G ++ +F+++G+IAAF VAF+IKR+GP++LL  +++AF  GSIM S+ PV Q+Y
Sbjct: 366 YSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSY 425

Query: 438 WKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTA 497
           WK+ F MQ IL FGMDLSFPASSIILSD LPM+YQGMAGSLVNT++NYS SLCLGMG T 
Sbjct: 426 WKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTV 485

Query: 498 EIQVNKNGTDLLKGYR 513
           E Q+NK+G +LLKGYR
Sbjct: 486 ERQINKSGQNLLKGYR 501

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/493 (55%), Positives = 357/493 (72%)

Query: 63  SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTW 122
           +D N  WQ+ +YF +RW+EY+F+ TCM+S LLNQA   Q  S MN++  +F++++ ++TW
Sbjct: 50  TDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTW 109

Query: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182
           LMASFPLVSGSFIL+SGR+GDIYGLK +++GG I  IIW+LI GF NY+ S TFFI+ R+
Sbjct: 110 LMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRS 169

Query: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQ 242
           FQGLG+AF+LPNVMG VGNIYK  + RKNIVIS IG CAP GA  GAF+AGLI TK    
Sbjct: 170 FQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDD 229

Query: 243 WPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPI 302
           WPW FYA A A  L L+ A+YSIP+ +P NVHGFSMDW GS + V+GLIL NFVWN+ PI
Sbjct: 230 WPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPI 289

Query: 303 VGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFG 362
            GW KAY                 YE+ +A SPLLP+ +T N +++MIL A+F+GWGSFG
Sbjct: 290 DGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFG 349

Query: 363 IWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFT 422
           I++FYY+AFLLNLR Y+ + AG ++ MF +WG +A+  V  +I+++  S++LF SM+AF 
Sbjct: 350 IFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFD 409

Query: 423 VGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTI 482
           VG IMLS+TPV QTY++M  G  IIL+FGMD+SFPA++IILSD+LP +YQGMAGSL NT+
Sbjct: 410 VGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTM 469

Query: 483 VNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQKR 542
           VNYS SLCLGMG+T E Q+N+NG DLLKGYR                   ++ E L   R
Sbjct: 470 VNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDR 529

Query: 543 GRTAALTAKKDMS 555
                 T++ ++S
Sbjct: 530 KERMESTSETNLS 542

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/456 (58%), Positives = 339/456 (74%), Gaps = 1/456 (0%)

Query: 58  DAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADS 117
           D++    + +  QNP YF  +WKEYLF+++ MLS LLNQA   QA    +++     A +
Sbjct: 27  DSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKA 86

Query: 118 SSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFF 177
           S + WLMASFPLVSGSFILVSG++GDIYGLK+T++GG  V++IWSLICG ++Y+ +V FF
Sbjct: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146

Query: 178 IICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIAT 237
           I+ R+FQGLGIAFVLPNV G+VGNIYK  +  KN+V S IG CAP GA  G  ++GLI T
Sbjct: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206

Query: 238 KAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVW 297
           ++E  W W FYAY     LN ++A Y IPD +P NVH F MDW GS +GV GLI+FNFVW
Sbjct: 207 ESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVW 265

Query: 298 NEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMG 357
           N+AP  GW+ AY                 +E +FAK PLLP+AV  N  ++MIL+++F+G
Sbjct: 266 NQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLG 325

Query: 358 WGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCS 417
           WGSFGIWT+YY AF+LNLR YTPL AG S+ MF ++GTIAAF V  TI + GP+++L  S
Sbjct: 326 WGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLAS 385

Query: 418 MVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGS 477
           ++AF VG IMLS+TPV QTY++M+ G  +IL+FGMDLSFPASSIILSD LP +YQGMAGS
Sbjct: 386 VIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGS 445

Query: 478 LVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           LVNT++NYS SLCLG+  TAE QVNK+GTDLLKGYR
Sbjct: 446 LVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYR 481

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/476 (56%), Positives = 342/476 (71%), Gaps = 4/476 (0%)

Query: 70  QNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPL 129
           QNP YF   WKEY+F+L+ MLS LLNQA  TQ     +V+    NA  S + WLMASFPL
Sbjct: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98

Query: 130 VSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIA 189
           VSGSFILVSG++GDIYGLK+T++GG +V++IWSLICG ++Y+ +V FF++ R+FQGLGIA
Sbjct: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158

Query: 190 FVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYA 249
           FVLPNVMG+VGNIYK  +  KN+V S IG CAP GA  G  ++GLI  + +  W W FYA
Sbjct: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTD-LWGWTFYA 217

Query: 250 YAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAY 309
           YA    LN ++A++ IP+ +P NV+ + MDW GS +GV GLILFNFVWN+API GW  AY
Sbjct: 218 YAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY 277

Query: 310 XXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYY 369
                            YEI+FAK PLLP +V  N  ++MILS++F GWGSFGIWTFYY 
Sbjct: 278 IIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM 337

Query: 370 AFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLS 429
           +F+LNLR Y+PL AG ++ MF +WG +A+  V +TI + GP+V+LF SMVAF  G IML+
Sbjct: 338 SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLA 397

Query: 430 ITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSL 489
           +TPVHQTY++MT G+ IIL+FGMDLSFPA+SIILSD LP +YQGMAGSLV+T+++YS SL
Sbjct: 398 VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSL 457

Query: 490 CLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFE---SLRQKR 542
           CLG+  TAE QVNKNG DLLKGY+                   F+ E   + R+KR
Sbjct: 458 CLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/460 (56%), Positives = 342/460 (74%), Gaps = 1/460 (0%)

Query: 55  TSPDAEKFSDN-NTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAF 113
           T  +A  F +   +PWQ+P+YF  +W E LF+L+CM+  LLNQAG T   STM V+    
Sbjct: 36  TEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLEREL 95

Query: 114 NADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSS 173
           ++ S+  +WLMASFPLVSGSFIL+SGR+GDIYGLK+ ++ G I + IWSLICG +++S +
Sbjct: 96  DSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHN 155

Query: 174 VTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAG 233
            TFFI  RAFQGLGI+FVLPN++G+VGNIYK G+ RKNIVIS IGMCAP GA FG  +AG
Sbjct: 156 DTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAG 215

Query: 234 LIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILF 293
           ++  + +  WPW FYAY  A  L  +++ + IP+++PVNV+ F+MDW GS +GV GL+LF
Sbjct: 216 VVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLF 275

Query: 294 NFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSA 353
           NFVWN++ +VGW   Y                 +EIK+AK PLLP+ VT + +IIMIL++
Sbjct: 276 NFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILAS 335

Query: 354 MFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVL 413
           +  GWGSFGIW FYY+ F+L LR Y+P+ AG +  M  + G IAA TV F+IKRVGP+VL
Sbjct: 336 LMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVL 395

Query: 414 LFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQG 473
           LF SM+AFT GSI+LS+TPVH+TY++   G  +IL+FGMDLSFPA+SIILSD L M+YQG
Sbjct: 396 LFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQG 455

Query: 474 MAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           MAGSLVNT+VNYS SL LG+G T E Q+NK+G  LL+G+R
Sbjct: 456 MAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFR 495

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/504 (52%), Positives = 349/504 (69%), Gaps = 12/504 (2%)

Query: 11  ITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQ 70
           I   SG    ++  ++  ++ ++   D++  V EK       +G           N  WQ
Sbjct: 3   IFRKSGTDSVQQETLSSSSSGSSFKQDNNDIVDEKQCDTQAIDG-----------NQKWQ 51

Query: 71  NPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLV 130
           NP YF S  KEYLF+ +C +S LLNQAG  Q    MN++  + ++ +  + WLMA+FPL+
Sbjct: 52  NPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLI 111

Query: 131 SGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAF 190
           SGSFIL+SGRIGDIYGLK+T++ G + +I+WSLICG   Y+ S +FFI+ RAFQGLGI+ 
Sbjct: 112 SGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISL 171

Query: 191 VLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAY 250
           +LPN++G+VG+IY  GS RKN+VIS IG  AP GA  GA ++GLI T+   QWPW FY+Y
Sbjct: 172 ILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY 231

Query: 251 AFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYX 310
           A    +N VL+I+ IP+T+P NVHG  MDW GS +GV+GLI+ NFVWN+API GW+ AY 
Sbjct: 232 AITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYL 291

Query: 311 XXXXXXXXXXXXXXXXYEIKFAK-SPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYY 369
                           YE+ F   +PLLP+ V  +   I++L A+F GWGSFGI++FYY+
Sbjct: 292 IVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYF 351

Query: 370 AFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLS 429
            F LNLR YTPL AG ++ MF++WG +AA  V FTIK+V PS++LF SMVAF  GSI++S
Sbjct: 352 TFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMS 411

Query: 430 ITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSL 489
           +TP+HQTY++   GM IIL+FGMDLSFPASSI+LSD LP++YQGMAGSLVNT+VNYS S 
Sbjct: 412 VTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSF 471

Query: 490 CLGMGTTAEIQVNKNGTDLLKGYR 513
           CLG+    E  VN +G D+LKGYR
Sbjct: 472 CLGVAGVVEQHVNNHGKDVLKGYR 495

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/481 (55%), Positives = 340/481 (70%), Gaps = 5/481 (1%)

Query: 35  NYDSSTSVSEKT--SAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSN 92
           N + S+ ++E+T  S  S     SP  E     N+  +NP YF+S  +EY FI +CMLS 
Sbjct: 9   NIEVSSYIAEETIRSDCSDANDESPSMEL---KNSSLRNPDYFNSTTQEYAFIFSCMLSQ 65

Query: 93  LLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMI 152
           LLN AG TQ  S MNV+    ++  S K WL+ASFPLVSGSFILVSGR+GDIYGLK+ +I
Sbjct: 66  LLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLI 125

Query: 153 GGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNI 212
            G ++++IWSLI G + YS S  FFII RAFQGLGI+ VLPNV+GL+G IYK G+L+KN+
Sbjct: 126 LGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNM 185

Query: 213 VISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN 272
           VIS +G  +P GA  G  ++GL+AT++E  WPW FYAY  A  +N  ++ YSIP+ +P N
Sbjct: 186 VISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTN 245

Query: 273 VHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFA 332
           V+  SMDW GS  GV+GLILFNFVWN+AP  GW  AY                 YE+++A
Sbjct: 246 VNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYA 305

Query: 333 KSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFIL 392
           ++PLLP  +  N  +IMIL+AM  GWGSFGIWTFYY++F+LNLR Y+PL AG S+ +F++
Sbjct: 306 ENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVI 365

Query: 393 WGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGM 452
            GTI A +  F +K++ P+VLL  SMV F +G I+ S+TPVHQTY++   G  IIL  GM
Sbjct: 366 SGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGM 425

Query: 453 DLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGY 512
           DLSFPASSIILSD LP ++QGMAGSLVNT++NYS SL LG+  T E   NKNGTDLL+GY
Sbjct: 426 DLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGY 485

Query: 513 R 513
           R
Sbjct: 486 R 486

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/476 (55%), Positives = 344/476 (72%), Gaps = 1/476 (0%)

Query: 39  STSVSEK-TSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQA 97
           ++S+ E   S IS+ + ++   E      + WQ+P YF + ++EYLF+ +CM + LLNQA
Sbjct: 6   TSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQA 65

Query: 98  GQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIV 157
              Q  S MNV+  +FN+  S++TWL+ASFPLV+GSFIL+SGRIGDIYGLK+T+IGG I 
Sbjct: 66  TTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIF 125

Query: 158 MIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCI 217
           +IIWSLICGF  YS S TF II RAFQGLGIAF LPNV+G +GNIY VGSLRKN+VIS I
Sbjct: 126 LIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLI 185

Query: 218 GMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFS 277
              AP GAA G  +AGLI T++  QWPW FYA+A A   NL+++IYSIP  +P NV+GF 
Sbjct: 186 AASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFK 245

Query: 278 MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLL 337
           MDW GS + V GLILFNF WN+ PIVGW+ AY                 YEI FA SPL+
Sbjct: 246 MDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLI 305

Query: 338 PQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIA 397
            + +TH+ N+I+ +  +F+GWGS+GIW+FYY++F+LNLR Y+P+ AG S+ +F ++G +A
Sbjct: 306 AREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLA 365

Query: 398 AFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFP 457
           +  V  +IK++   V+L  SMV F VG+ +LS+ PV Q+Y+K+T     IL  G+D SFP
Sbjct: 366 SAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFP 425

Query: 458 ASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           A++IILSD LPMEYQGMAGSL  T+VNYS SLCLGMG T E Q+NK+G D+LKGYR
Sbjct: 426 AATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYR 481

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 333/485 (68%), Gaps = 8/485 (1%)

Query: 37  DSSTSVSEKTSAISVFEGTSP-DAEKF-------SDNNTPWQNPSYFSSRWKEYLFILTC 88
           DS  S    +  I   E   P D+EK+          +   Q P YFSS+  E+ FI TC
Sbjct: 25  DSDNSTVNSSQKIDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFTC 84

Query: 89  MLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLK 148
           ++  LLNQAG TQ+ S MN+I   F +++S + WL ASFPLVSGSFILV GR GDIYGLK
Sbjct: 85  LMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLK 144

Query: 149 RTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSL 208
           + ++ G  ++ IWS+ICG  +Y+ S  FFI+ +AFQGLG++F+LPN++GLVG IY+ GS+
Sbjct: 145 KMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSM 204

Query: 209 RKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
           +KNI IS IG  AP GA FG  ++G++  K +K WPW FYA+A    L  V   + +PD 
Sbjct: 205 KKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDN 264

Query: 269 VPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYE 328
           VP N +   MDW GS VGV+GL+LF+FVWN+AP+ GW+KAY                 YE
Sbjct: 265 VPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYE 324

Query: 329 IKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHC 388
           I +A+ PLLP+A+T N +IIMIL A+FMGWG+FGIW+FYY++F LNLR ++P+  G ++ 
Sbjct: 325 INYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYF 384

Query: 389 MFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIIL 448
            FIL G   A  V F IK + PS++L  S+  FT+G+++ ++TP  QTYW+ TFGM ++L
Sbjct: 385 AFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLL 444

Query: 449 AFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDL 508
             GMDLSFPASSIILSD LP EYQGMAGSLVNT+VNYS S CLG+ TT E Q+N +G DL
Sbjct: 445 PLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDL 504

Query: 509 LKGYR 513
           LKGYR
Sbjct: 505 LKGYR 509

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/549 (45%), Positives = 360/549 (65%), Gaps = 9/549 (1%)

Query: 7   SDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNN 66
           SDN+I   +    ++  N   ++  N    DS +S++  +S   V    + D    +D +
Sbjct: 9   SDNTINEINYTNNEDCKNPEQQSLKNI---DSRSSLN--SSLTQVLSTDTAD----NDES 59

Query: 67  TPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMAS 126
           + +QNP YF ++++E+ FI + M+  LL+QAG TQ  S MNV+    ++ SS + WLM+S
Sbjct: 60  SSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSS 119

Query: 127 FPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGL 186
           FPL  GSFILVSGR+GDIYGLK+ ++GG I+  +WS+ICG ++Y+ +  FFI  RAFQGL
Sbjct: 120 FPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGL 179

Query: 187 GIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWI 246
           G+AF LPN++GL+G IY+ G  RKN++IS IG  +PTGA  G  +AGL     +  WPW 
Sbjct: 180 GLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWS 239

Query: 247 FYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWE 306
           FYA+     +NL+++ Y IP+++P N+HG  MDW GSV+GV GLI+ NFV+N+APIVGW+
Sbjct: 240 FYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQ 299

Query: 307 KAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTF 366
            AY                 YE+K+AK+PL+P+A++ N  ++MIL ++F GWGSFGIWTF
Sbjct: 300 SAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTF 359

Query: 367 YYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSI 426
           YY++F LNLR Y+PL AG+S+ +F++ G+  A     TIK++ PSVL  CSM+ F  G+I
Sbjct: 360 YYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNI 419

Query: 427 MLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYS 486
           + + TPV+QT+++   G   +L  GMD SFPASSIILSD+LPM+YQGMAGSLVNT++NYS
Sbjct: 420 IFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYS 479

Query: 487 TSLCLGMGTTAEIQVNKNGTDLLKGYRXXXXXXXXXXXXXXXXXXXFLFESLRQKRGRTA 546
           TS+CLGM  T E++ N +G DLL GYR                   ++ E L + R  + 
Sbjct: 480 TSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSL 539

Query: 547 ALTAKKDMS 555
               + D+ 
Sbjct: 540 EENKQTDIE 548

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  521 bits (1342), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 248/514 (48%), Positives = 356/514 (69%), Gaps = 3/514 (0%)

Query: 1   MIEIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAIS-VFEGTSPDA 59
           +I + +++     A+ E K+ K    +K   +  +  ++TS++E   +IS V   +  ++
Sbjct: 19  IISLSTAETLDIDATPESKERKDYFQLKKNYSQ-DSQTNTSMNEVIGSISSVSNDSDINS 77

Query: 60  EKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSS 119
           E     N    +P YF +R  EYLFI++CM+S  ++QAG TQA S MN++    NA+ S 
Sbjct: 78  ENLQSENKVL-SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSR 136

Query: 120 KTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFII 179
           + WLMASF L  GSFILVSGR+GDIYGLK+ ++GG  ++ IWSLICGF++YS +  FFI 
Sbjct: 137 QAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFIT 196

Query: 180 CRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKA 239
            RAFQGLG+AFVLPN +GL+G IY+ GS++KN++I  +G  +P GA  G  +AG+I TK 
Sbjct: 197 SRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKD 256

Query: 240 EKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNE 299
            KQWPW FY++      N++L+ YSIP+ +P N++  SMDW G+++G+ GL++ NFV+N+
Sbjct: 257 PKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQ 316

Query: 300 APIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWG 359
           APIVGW+ AY                 YE+K+AK+PL+P+A++ N  ++MIL A+F GWG
Sbjct: 317 APIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWG 376

Query: 360 SFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMV 419
           +FG WTFYY++F+LN+RGYT   AG S+ +FI+ G   A    F +K+V PSV+L+ SM+
Sbjct: 377 AFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMI 436

Query: 420 AFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLV 479
            F  G +ML++TP+HQ+Y++   G+  +L  G+DLSFPA+SIILSDALP++YQGMAGSLV
Sbjct: 437 GFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLV 496

Query: 480 NTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
            TI NYSTS+CLGM  + E   N NG ++LKGYR
Sbjct: 497 YTITNYSTSICLGMAGSVEAYHNDNGQNILKGYR 530

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  414 bits (1065), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/464 (41%), Positives = 286/464 (61%)

Query: 50  SVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVI 109
           S    T PD + F   +   + P  F +R++E+ F+L  ++   L+Q G TQ  STMN++
Sbjct: 91  SSLSATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNIL 150

Query: 110 GSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFAN 169
               +     + WLMA+FPL  G  IL+SGR+GDI+GLK+ ++ G I+  IW+LICGF++
Sbjct: 151 AEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSS 210

Query: 170 YSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGA 229
           Y+ S   FI+ R FQGLG+A  LPN+  L+G IYK    +KN++   IG  +P GA  G 
Sbjct: 211 YAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGG 270

Query: 230 FWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIG 289
            +AGL      K WPW FY++A    LN ++A + IP+ +  N  G  MDW GS +G+ G
Sbjct: 271 IFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFG 330

Query: 290 LILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIM 349
           L++ NFV+N+ PI GW  AY                 YE+  A  PL+P+ +  N+ +I+
Sbjct: 331 LVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLIL 390

Query: 350 ILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVG 409
           IL  +F GWG F IWTFYY+AF LNLR Y+PL A +S+ + I+ GTI        ++R+ 
Sbjct: 391 ILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMK 450

Query: 410 PSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPM 469
           P +LLF SM+ F  G+I+ ++TP+HQT+++  FG   +   GM  SFP++S++ ++ LP 
Sbjct: 451 PPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPT 510

Query: 470 EYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
            Y+ MAGSLVN  +NY+TS+C+GM  +A +  N +G DLL G+R
Sbjct: 511 HYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFR 554

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  329 bits (844), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/483 (39%), Positives = 279/483 (57%), Gaps = 18/483 (3%)

Query: 39  STSVSEKTSAISVFEGTSPDAEKFSDN-NTPWQNPSYFSSRWKEYLFILTCMLSNLLNQA 97
           S+ V+E+   ++V E    D E  SD  +   + P   S  W+     + C  + L+ QA
Sbjct: 4   SSPVTEENLDMNV-ETLKKDDEVLSDEFDVQEEKPE--SLLWESAFVGVLCS-AQLMTQA 59

Query: 98  GQTQATSTMNVIGSAF-NADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLI 156
           G  Q+ + +++IG +F  A+    +W  +++ L  G+FIL++GR+GDI+G K+  + G  
Sbjct: 60  GLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119

Query: 157 VMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISC 216
              +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V S 
Sbjct: 120 WYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSL 177

Query: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN--VH 274
            G  AP G   GA ++ ++   A   WPW ++    A  L  V   Y IP T   N  V 
Sbjct: 178 FGASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVA 235

Query: 275 GFSM----DWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIK 330
            F +    D+ GSV GV+GLILFNF WN+ P+VGW+  Y                  E +
Sbjct: 236 SFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295

Query: 331 FAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMF 390
            A  PLLP A   + +   +LS +  GW SFGIW FY + F+ + RG TPL + A     
Sbjct: 296 -AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353

Query: 391 ILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAF 450
            + G  AA    F +    PS ++F +M AFTVG+I+++  PVHQTYW  TF   I++ +
Sbjct: 354 AISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPW 413

Query: 451 GMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLK 510
           GMD+SFPA++I+LSD++P E+QG+A SLVNT+VNYS S+ LG+  T E  VN  G ++LK
Sbjct: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLK 473

Query: 511 GYR 513
           GYR
Sbjct: 474 GYR 476

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/440 (40%), Positives = 258/440 (58%), Gaps = 13/440 (2%)

Query: 81  EYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVSG 139
           E  F+     + L+ QAG  Q+ + +++IG +F   +  + +W  +++ L  G+FIL++G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 140 RIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLV 199
           R+GDI+G K+  + G     +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 200 GNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLV 259
           G  YK G  RKN+V S  G CAP G   GA ++ L+   A   WPW ++    A     +
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQLA--WWPWAYWIMGIACFFLAI 218

Query: 260 LAIYSIPDTVPVNVHGFS------MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXX 313
              + IP T   + H  S      +D+ GSV GVIGLILFNF WN+ P+VGW+  Y    
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 314 XXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLL 373
                         E + A  PLLP A   + +   +LS +  GW SFGIW FY + F+ 
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 374 NLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPV 433
           + RG TPL + A      + G  AA T  + + R  PS ++  +M AFT G+I+++  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 434 HQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGM 493
           HQTYW  TF   I++ +GMD+SFPA++I+LSD++P E+QG+A SLVNT+VNYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 494 GTTAEIQVNKNGTDLLKGYR 513
             T E  VN  G   LKGYR
Sbjct: 457 AGTIESNVNDGGAKPLKGYR 476

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/488 (39%), Positives = 283/488 (57%), Gaps = 25/488 (5%)

Query: 37  DSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQ 96
            +S+SV++K    +  E    + +  S+ +   + P   S  W+     + C  + L+ Q
Sbjct: 2   STSSSVTQKNLDTNA-EALKKEDKVLSEFDIQDERPK--SLLWESAFVGVLCS-AQLMTQ 57

Query: 97  AGQTQATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGL 155
           AG  Q+ + +++IG++F   ++ + +W  +++ L  G+FIL++GR+GDI+G K+  + G 
Sbjct: 58  AGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 117

Query: 156 IVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVIS 215
               +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V S
Sbjct: 118 FWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFS 175

Query: 216 CIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAI---YSIPDTVPVN 272
             G  AP G   GA ++ ++   A   WPW   AY   GI   VLA+   + IP T P+ 
Sbjct: 176 LFGASAPGGFFLGAVFSSMLGQLA--WWPW---AYWIMGIACFVLAVAGYFVIPHT-PMP 229

Query: 273 VHGFS-------MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXX 325
               S       +D+ GSV GV+GLILFNF WN+ P+VGW+  Y                
Sbjct: 230 SRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA 289

Query: 326 XYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGA 385
             E + A  PLLP A   + +   +LS +  GW SFGIW FY + F+ + RG TPL + A
Sbjct: 290 YIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 347

Query: 386 SHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQ 445
                 + G  AA T  F +    PS ++  +M AFTVG+I+++  PVHQTYW  TF   
Sbjct: 348 QFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSI 407

Query: 446 IILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNG 505
           I++ +GMD+SFPA++I+LSD++P E+QG+A SLVNT+VNYS S+ LG+  T E +VN  G
Sbjct: 408 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGG 467

Query: 506 TDLLKGYR 513
              LKGYR
Sbjct: 468 AKPLKGYR 475

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  317 bits (812), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/450 (38%), Positives = 258/450 (57%), Gaps = 12/450 (2%)

Query: 70  QNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK-TWLMASFP 128
           QN   ++S  KE   I+    + L+ QAG  Q+   + +IG +F   +  + +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 129 LVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGI 188
           L  G+FIL++GR+GD +G K+  + G +   +WS++ GF+ YS+ + FF  CRAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGP 136

Query: 189 AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248
           AF LPN + ++   Y+ G  ++N++ S  G CAP+G   GA ++ L++  A   WPW ++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSEFA--WWPWAYW 193

Query: 249 AYAFAGILNLVLAIYSIPDTVPVNVHG-----FSMDWTGSVVGVIGLILFNFVWNEAPIV 303
                  L  V     IP   P++          +D  GSV GV+GLILFNF WN+ P+V
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 304 GWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGI 363
           GWE +Y                  E + AK PLLP     + + I ++  +  GW SFGI
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP-VRKLSSDTIFVMGCIAAGWSSFGI 311

Query: 364 WTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTV 423
           W +Y +  + NLR   PL + A      + G  AA +  F + R  PS ++  +M+AFTV
Sbjct: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV 371

Query: 424 GSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIV 483
           GSI+++  PV QTYW  TF   I++ +GMD+SFPA++IILS A+P  +QG+A SLVNTI+
Sbjct: 372 GSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTII 431

Query: 484 NYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           NYS S+ LG   T E Q++    DLLKGYR
Sbjct: 432 NYSISIGLGFAGTIESQISDGEDDLLKGYR 461

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  312 bits (799), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/480 (39%), Positives = 272/480 (56%), Gaps = 16/480 (3%)

Query: 41  SVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQT 100
           SV++K    S  E T  D E    N    Q+ +  S  W E  F+     + L+ QAG  
Sbjct: 6   SVTQKNLETSA-ETTKTDDEVLL-NQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLG 62

Query: 101 QATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMI 159
           Q+ + +++IG +F   +  + +W  +S+ L  G+FIL++GR+GDI+G ++  I G     
Sbjct: 63  QSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYA 122

Query: 160 IWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGM 219
           +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V S  G 
Sbjct: 123 LWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGA 180

Query: 220 CAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT-VPV-NVHGFS 277
            AP G   GA ++ ++   A   WPW ++    A  L  V   + IP   +P  +   F+
Sbjct: 181 SAPGGFVLGAVFSSMLGQLA--WWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFN 238

Query: 278 M----DWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAK 333
           M    D+ GSV GVIGLILFNF WN+ P+VGWE  Y                  E + A 
Sbjct: 239 MLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AA 297

Query: 334 SPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILW 393
            PLLP A   + +   +L  +  GW SFGIW FY + F+   R  +PL + A      + 
Sbjct: 298 YPLLPFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAIS 356

Query: 394 GTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMD 453
           G  AA T  F +     S ++  +M AFTVG I+++  PVHQTYW  TF   I++ +GMD
Sbjct: 357 GFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMD 416

Query: 454 LSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           +SFPA++I+LS+++P E+QG+A SLVNT+VNYS S+ LG+  T E QVN  G + LKGYR
Sbjct: 417 MSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYR 476

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  305 bits (781), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 176/468 (37%), Positives = 261/468 (55%), Gaps = 16/468 (3%)

Query: 53  EGTSPDAEKFSD-NNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGS 111
           E T    ++ S  ++   Q P    S   E  F+     + L+ QAG  Q+ + +++IG 
Sbjct: 19  ESTHDQGQELSQPHHNGIQKPE---SLLGEAAFVGVICGAQLMTQAGLGQSIAPLHIIGD 75

Query: 112 AFNADSSSK-TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANY 170
           +F   +  + +W  A++ L  G+FIL++GR+GD+YG K+  I G     +WSL+ GF+ Y
Sbjct: 76  SFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVY 135

Query: 171 SSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAF 230
           S+ + FF  CRAFQG+G A +LPN + ++G  Y  G  RK +++S  G  AP G   GA 
Sbjct: 136 SNQI-FFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFGATAPAGFVLGAV 193

Query: 231 WAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIP----DTVPVNVHGFS-MDWTGSVV 285
           ++ +        WPW ++A         V  I  IP      +  +V  +  +D  GSV 
Sbjct: 194 FSSIFGQL--TWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVT 251

Query: 286 GVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNH 345
           GVIGL+L NF WN+ P+VGW+  Y                  E + A  PLLP +   + 
Sbjct: 252 GVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPLLPLSALSS- 309

Query: 346 NIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTI 405
           +   +L  +  GW SFGIW +Y++ FL  LRG++PL   A      + G  AA T  F I
Sbjct: 310 DAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVI 369

Query: 406 KRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSD 465
            RV  S+++  +M AFTVG I+++  PV Q YW   F   I++ +GMD+SFPA++I+LSD
Sbjct: 370 TRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSD 429

Query: 466 ALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
           ++P E+QG+A SLVN +VNYS S+ LG+  T E +VN  G +LLKGYR
Sbjct: 430 SMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYR 477

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  299 bits (765), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 164/440 (37%), Positives = 254/440 (57%), Gaps = 12/440 (2%)

Query: 80  KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVS 138
           +E LF+     + L+ QAG  Q+ + + +IG++F   +  + +W  A++ L  G+FIL++
Sbjct: 38  REALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIA 97

Query: 139 GRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGL 198
           GR+GD++G K+  + G +   +WSL+ GF+ YS+ + FF  CRA QG+G AF+LPN + +
Sbjct: 98  GRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNSIAI 156

Query: 199 VGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNL 258
           +G  Y  G  RK +V S  G  AP G   G+ ++ + +  A   WPW ++A   A ++  
Sbjct: 157 LGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFSQLA--WWPWAYWAMGTACLVLG 213

Query: 259 VLAIYSIPDTVPVNVH---GF--SMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXX 313
           V  I  IP   P  +    G    +D  G+  G++GL L NF WN+ P+VGW+  Y    
Sbjct: 214 VAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYTYAL 273

Query: 314 XXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLL 373
                         E + A+ PLLP A     ++  +L  +  GW SFGIW FY++ FL 
Sbjct: 274 LIVGFVFLLVFSLIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLE 331

Query: 374 NLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPV 433
           + R  +PL   A      + G  AA T  + +  V    ++  +M+AFTVG ++++  P+
Sbjct: 332 DSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPI 391

Query: 434 HQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGM 493
           +QTYW  TF   II+ +GMD+SFPA++I++S+A+P E+QG+A SLVNT+VNYS SL LG 
Sbjct: 392 NQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGF 451

Query: 494 GTTAEIQVNKNGTDLLKGYR 513
             T E +VN  G + L+GYR
Sbjct: 452 AGTIETRVNNKGANRLEGYR 471

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  284 bits (727), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 161/462 (34%), Positives = 265/462 (57%), Gaps = 17/462 (3%)

Query: 58  DAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADS 117
           ++ K + +   W   S F    KEY F+ T +++   NQAG T     +NV+  +F+   
Sbjct: 27  ESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK- 85

Query: 118 SSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFF 177
               +L+ S+P+V GSF+L+ GR+G+++G K T++GG I++I+ SL+ G + YS S  F+
Sbjct: 86  ----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFY 141

Query: 178 IICRAFQGLGIAFVLPNVMGLVGNIYK--VGSLRKNIVISCIGMCAPTGAAFGAFWAGLI 235
           +ICRAFQG+G+A +LPN        Y+    + RK I+ + IG  A TGA  G F +G+ 
Sbjct: 142 VICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGIC 201

Query: 236 ATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN----VHGFSMDWTGSVVGVIGLI 291
            T++E  W W +Y Y  A  L L L+ YS+PD +       ++G  + W  +     GL+
Sbjct: 202 VTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNG--LGWFSNRS--CGLL 257

Query: 292 LFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMIL 351
           + N   N A +     ++                 +E+KF++ P+  + +  N ++ ++L
Sbjct: 258 MLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVL 317

Query: 352 SAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPS 411
           +++F GWG++GIW+ Y++ FLLNLR Y+PL AG+++   ++ G +A   ++  +KR GP 
Sbjct: 318 ASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPK 377

Query: 412 VLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEY 471
           + L  S + FT   I+LS+TP+HQ+Y++ T G  I LA G+D SFP+S+IIL + LP +Y
Sbjct: 378 LFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKY 437

Query: 472 QGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
             M   L N I NY+ S   G+  +A   ++    +L+K YR
Sbjct: 438 HEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYR 477

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  221 bits (564), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 151/493 (30%), Positives = 245/493 (49%), Gaps = 20/493 (4%)

Query: 9   NSITSASGEQKQEKV-NVAVKATINTLNY----DSSTSVSEKTSAISVFEGTSPDAEKFS 63
           NSI S S  +   ++ N  V  T +++N+    DSS +  +    +S    ++P  E+  
Sbjct: 2   NSINSDSNSENIFRLENKEVNGTYDSINFNGGDDSSKTRRDSDDNVSDINKSAPAPEE-H 60

Query: 64  DNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKT-W 122
           D     +  +   S   E +F+L    S +L  AG  Q    M+VI   F     S + W
Sbjct: 61  DPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGW 120

Query: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182
               +    GSF+L++G++GD+ G K   + G   + +WSL+ GF+ Y  S  FF  CRA
Sbjct: 121 CNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRA 180

Query: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQ 242
            QG+G AF   + + ++G  Y     RKN + S  G C   G   G  ++ L    A   
Sbjct: 181 AQGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALFTQLA--H 237

Query: 243 WPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHG----FSMDWTGSVVGVIGLILFNFVWN 298
           W W +++ A A ++ ++L+I+ IP  V V  H     F  D+ G+ + V GL+LF+  WN
Sbjct: 238 WSWAYWSMAIACVVIIILSIFFIPGDV-VEKHETSNVFYFDYLGAFLFVTGLVLFSVAWN 296

Query: 299 EAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTH-NHNIIMILSAMFMG 357
           +AP  G+ + Y                  E K    PLLP   TH + N + +L A+F  
Sbjct: 297 QAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLPW--THISANTLKVLLAIFFA 353

Query: 358 WGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIK-RVGPSVLLFC 416
           + SF +W  Y + F L  +G T L A A      + G  AA   A  +   V   + +  
Sbjct: 354 YASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLI 413

Query: 417 SMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAG 476
           S++AF V  I+++     QTYW   F   I+++FG+D+SFP+++++LS+ +P +++G+  
Sbjct: 414 SLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGA 473

Query: 477 SLVNTIVNYSTSL 489
           SLV  ++NY+T+L
Sbjct: 474 SLVGAVLNYATAL 486

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  178 bits (451), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 137/465 (29%), Positives = 228/465 (49%), Gaps = 17/465 (3%)

Query: 43  SEKT---SAISVFEGTSPDAEKFSDNNTPWQNPSY-FSSRWKEYLFILTCMLSNLLNQAG 98
           SE+T   S +   E TSP     S N    +   +  + ++KE + +L       ++  G
Sbjct: 6   SEETLTSSKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSGQFISLLG 65

Query: 99  QTQATSTMNVIGSAFNADSSSKT---WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGL 155
             Q    M  I S F+          W  A++   + +F++++G++GDI G K   I G 
Sbjct: 66  AVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGY 125

Query: 156 IVMIIWSLICGFANYS-SSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVI 214
             + +WSL+ GF+ Y+ ++  FF  CR  QG+G AF+ P  + L+G  Y     RKN V 
Sbjct: 126 AWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCK-RKNYVF 184

Query: 215 SCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIP-DTVPVNV 273
           S  G C P G   G+ ++ L        W W +++ A   ++  +L+   IP D  P   
Sbjct: 185 SFYGACGPFGIVAGSVFSALFTQLTT--WAWTYWSMAVTCLIITILSYIFIPKDNTPKRE 242

Query: 274 HG--FSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKF 331
               +S D+ G   G+ G+ILF+ VWN+AP+  ++  Y                  + + 
Sbjct: 243 RSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSR- 301

Query: 332 AKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFI 391
            K PL+P   +   N+I  L  +F G+  F IW FY + F L  +  + L A A      
Sbjct: 302 VKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLG 360

Query: 392 LWGTIAA-FTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAF 450
           + G  AA F+V    K+V   + L  ++ AF + +I++S   + +TYW   F   +I+A 
Sbjct: 361 ISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAI 420

Query: 451 GMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGT 495
           G+D++FP+++++LS+ +  E QG+A +L  T +NY T+L  G+ T
Sbjct: 421 GLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVAT 465

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  164 bits (416), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 114/190 (60%), Gaps = 34/190 (17%)

Query: 89  MLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLK 148
           M+S LLNQ G TQ    +NV+   F + ++ +T L+AS PLVSGSFILVSG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 149 RTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSL 208
            T++ G   +I+WS ICG   Y+ SV FF+I RAFQGLG+AFVLPNVMG V N+Y  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 209 RKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
           RKN+V                                  YAY  A  LN+ L ++++P  
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 269 VPVNVHGFSM 278
           +P NV G +M
Sbjct: 147 IPTNVRGQAM 156

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  168 bits (426), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 127/447 (28%), Positives = 219/447 (48%), Gaps = 29/447 (6%)

Query: 59  AEKFSDNNTPWQNPSYFSSRW-KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADS 117
           AEK ++ +T  + P      W +E   ++  + S L+   G  Q       +   +  + 
Sbjct: 19  AEKLTEVDTSIRLPK----TWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEP 74

Query: 118 SSKT---WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSS-S 173
           +      W  AS+ L S   +L++G++GD+ G KR ++ G I + IWSLI GF+ Y   +
Sbjct: 75  AKGGLVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGN 134

Query: 174 VTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAG 233
             F+   RA QG+G  F++PN + ++G  Y    L+K I+ S  GM   TG   G  ++ 
Sbjct: 135 QAFYYTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSS 194

Query: 234 LIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN-VHGFS-------MDWTGSVV 285
           L A     +W W ++A A   +L  V AI  IP   P N VH  +        D+ G++ 
Sbjct: 195 LFAQLT--KWAWNYWALACVCVLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAIT 249

Query: 286 GVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTH-N 344
           GV GL+LF+  + +A  +GW   +                  + +    PL+P  + H  
Sbjct: 250 GVSGLVLFDVAFTQASALGWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVP--LQHLR 306

Query: 345 HNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAA--FTVA 402
            ++++IL  ++ G+ SF IW  +++ F   +   +PL   A      + G+I A  FTV 
Sbjct: 307 ADVVVILICVYFGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVT 365

Query: 403 FTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSII 462
                +    ++  SMV F V +I+++    + TYW   F   II  F +D++ P ++++
Sbjct: 366 CLQLNIKAPTMMVISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLL 425

Query: 463 LSDALPMEYQGMAGSLVNTIVNYSTSL 489
            SD++  E QG+A SL+ T+++Y+ S+
Sbjct: 426 FSDSVRKESQGIAASLIITVISYAISI 452

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  159 bits (403), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 130/482 (26%), Positives = 217/482 (45%), Gaps = 21/482 (4%)

Query: 24  NVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYL 83
            + ++ T NT +Y  S S +    +    E  S      + +     NP    SR +E +
Sbjct: 14  TLKIQDTGNTDHYLPSNSTASSLHSQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECM 73

Query: 84  FILTCMLSNLLNQAGQTQATSTMNVIGSAFN--ADSSSKT-WLMASFPLVSGSFILVSGR 140
           FI+    S  ++ A  +QA   M+ I + F   AD S +  W  A+F +  G+FI+ +G+
Sbjct: 74  FIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGK 133

Query: 141 IGDIYGLKRTMIGGLIVMIIWSLICGFANYSS--SVTFFIICRAFQGLGIAFVLPNVMGL 198
           + D+ G K   I G     +WSL+ G + Y+     TFF   R  QG+G A + P+ + L
Sbjct: 134 LCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLAL 193

Query: 199 VGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAF-AGILN 257
           +G  Y   S +KNIV S  G C P G   G  ++ +    A   W W +++ A  +    
Sbjct: 194 LGKYYP-PSCKKNIVFSLYGFCVPLGVVVGGVFSAIFTQLA--HWSWNYWSMAIVSAFFT 250

Query: 258 LVLAIYSIPDTVPVN---------VHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKA 308
           L+   Y  PD +  +          H    D+ G+ + V  L+LF   WN+A    ++  
Sbjct: 251 LISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSV 310

Query: 309 YXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYY 368
                              E  +   P++P    H   I  +L  +F  + SF IW FY 
Sbjct: 311 QVYVTLIVSLVCFVAMVIVEF-YVDDPIIPARKIHPQTIKALL-VVFFSYLSFTIWLFYL 368

Query: 369 YAFLLNLRGYTPLEAGASHCMFILWGTIAA-FTVAFTIKRVGPSVLLFCSMVAFTVGSIM 427
           + +   +R  T L   A      + G IAA F++      V   + L     +F +  I+
Sbjct: 369 WKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHIL 428

Query: 428 LSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYST 487
                  ++YW   F   II++ G+D+SFP+++++LS+ +P E +G++ +LV T +NY T
Sbjct: 429 FITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGT 488

Query: 488 SL 489
            +
Sbjct: 489 GI 490

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  146 bits (368), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 114/480 (23%), Positives = 211/480 (43%), Gaps = 66/480 (13%)

Query: 70  QNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKT---WLMAS 126
           Q+P+  +S   + +FI     S  +  A  +QA   M+ +   F    +S     W+ AS
Sbjct: 62  QSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNAS 119

Query: 127 FPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANY-SSSVTFFIICRAFQG 185
           F +  G+FI+++G++ DI   +   I G +   +W+LI GFA+Y   ++ F  ICR  QG
Sbjct: 120 FAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQG 179

Query: 186 LGIAFVLPNVMGLVGNIYKVGSL------------------------------------- 208
           +G A + P+ + L+   Y V                                        
Sbjct: 180 IGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSI 239

Query: 209 ---------RKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLV 259
                     K+I  S  G CAP G   G  ++ +    A   WPW +++ +    L  +
Sbjct: 240 ADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLAT--WPWNYWSMSIVTTLLSI 297

Query: 260 LAIYSIPDTVPV-----NVHGF----SMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYX 310
           L+ + +   +PV     N +      + D+ G ++G+  LILF   W++A +  ++  + 
Sbjct: 298 LSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHV 357

Query: 311 XXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYA 370
                           +E  F  +P++P    H   I  +L  +F  + SF  W FY + 
Sbjct: 358 YLTLLFSLVSFIAMIIWEYYF-NNPIIPIRQIHPGTIKALL-VVFFSYISFTQWLFYTWK 415

Query: 371 FLLNLRGYTPLEAGASHCMFILWGTIAA-FTVAFTIKRVGPSVLLFCSMVAFTVGSIMLS 429
               ++  +P+          + G I+A F++   +KRV   + L     +F +  I+L 
Sbjct: 416 LFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLL 475

Query: 430 ITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSL 489
              +  +YW   F   I ++ G+D+SFP+++++L++ +P E QG+  +LV +++NY T++
Sbjct: 476 TCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAI 535

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 106/476 (22%), Positives = 180/476 (37%), Gaps = 60/476 (12%)

Query: 69  WQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFP 128
           +QN S+   R+   + I+     +L+N      AT     I + +  + ++ +W + ++ 
Sbjct: 16  FQNISF--HRYINLVLIMVSCAFDLINVTAVLSATRD---IENTYQIEFTTASWALTAYA 70

Query: 129 LVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGI 188
           +    FI   GR+GDI G     +    +  I SLIC   N   +   F + RA QG+  
Sbjct: 71  ITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAA 127

Query: 189 AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAF---GAFWAGLIATKAEKQWPW 245
           A ++P+   L+  +     ++    I   G     G  F   GAF    I  K       
Sbjct: 128 AGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTLTRIGYKG------ 181

Query: 246 IFYAYAFAGILNL-VLAIYSI-------------PDTVPVNVHGFSMDWTGSVVGVIGLI 291
           IFY   FA +L + +++ +SI             P T   +    S+D+ GS + +   I
Sbjct: 182 IFY-LTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWS-DALSLDFIGSFMFISSTI 239

Query: 292 LFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXXXXYEI---------KFAKSP------- 335
           L      E     W+K                   + I         K A +P       
Sbjct: 240 LIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFR 298

Query: 336 ----LLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFI 391
               L+P+ V    N I I  A+F  +G      +    +   +   +PL A       +
Sbjct: 299 TIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLV 358

Query: 392 LWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVH----QTYWKMTFGMQII 447
           +   I    +A     + P   +        +GSI+L    +H      YWK+ F  Q +
Sbjct: 359 VSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIIL--IQLHLITDNLYWKIFFCSQSL 416

Query: 448 LAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNK 503
           +AFG  + FP S  IL    P EY+G+A  ++ T   +   +   + T+    +N+
Sbjct: 417 IAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 118/272 (43%), Gaps = 33/272 (12%)

Query: 15  SGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFE-----------GTSPDAEKF- 62
            G+ K +K N+ + AT + L +   T     T  I+  E            T PD EK  
Sbjct: 24  EGDIKAKKDNIEIPATKDGLYHLHGTLSRTTTREINEGEDDEEDGEDSSLDTVPDEEKLE 83

Query: 63  --SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120
             S++  P+   SY   +W     ++ C      +  G       +  +   FN D +  
Sbjct: 84  QTSESTAPYTLLSY-KQKWGMVFLLVMC---GFWSSLGSPIYYPALRQLEKEFNMDENKV 139

Query: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180
              +  + L  G    VSG + D++G +  ++GG+++ ++ S+  G A    + ++ +IC
Sbjct: 140 NVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI--GLA---CAPSYGVIC 194

Query: 181 --RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATK 238
             R  Q +GI+  +    G+VG+ + +   R   V +  G+    G  FG+    LI   
Sbjct: 195 FLRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGLVL-LGQCFGS----LIGAV 248

Query: 239 AEKQWPW--IFYAYAFAGILNLVLAIYSIPDT 268
              +W W  IF+  A    + L++A +++P+T
Sbjct: 249 LTARWDWRAIFWFLAIGSGVALIVAAFTLPET 280

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 62/137 (45%), Gaps = 20/137 (14%)

Query: 119 SKT-WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFF 177
           SKT W+ A + L +    L+ GRI  I G K  M+  +I+  I SLI G AN   S+   
Sbjct: 113 SKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVAN---SMNML 169

Query: 178 IICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFW 231
           I  R   G+G      +AFV+ + +        V   R+ ++I+C+       +  G F 
Sbjct: 170 IGGRVIAGVGGSGIQSLAFVIGSNL--------VDERRRGLIIACMSSAFAVASVIGPFL 221

Query: 232 AGLIATKAEKQWPWIFY 248
            G   T A   W W FY
Sbjct: 222 GGAFTTHA--TWRWCFY 236

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 97/457 (21%), Positives = 178/457 (38%), Gaps = 52/457 (11%)

Query: 63  SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTW 122
           S+ +  +   S F     ++L  +  +++  L+ A        +  I + FN   +   W
Sbjct: 3   SEKSVTFPKGSLFHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGW 62

Query: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182
            + S+ +    FI   GR+GDI G    M    ++  I+SL+C       + T F   RA
Sbjct: 63  ALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAVVPNFIAFTVF---RA 119

Query: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAF---GAFWAGLIATKA 239
           FQG+  A ++P    LV  +++  +L++   I    + A  G  F   GAF    +  K+
Sbjct: 120 FQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGETALGYKS 179

Query: 240 EKQWPWIFYAYAFAGIL---NLVLAIYSIPDTVPVNVHGFSMDW---------------T 281
                  F+ + FA  L    ++  +   P+ + +N H +   +               +
Sbjct: 180 -------FFYFLFAASLATAAVICVLIGYPELL-LNRHSYKEKFQRVYKLDVIGCLLFIS 231

Query: 282 GSVVGVIGLILFNFVWNE----APIV----------GWEKAYXXXXXXXXXXXXXXXXXY 327
           GS++ V+GL      WN+     P+            W   Y                 Y
Sbjct: 232 GSILLVVGLTQGGESWNDPTAYVPLAVSIVLLIIFFMWNLGYAVVLKLIKPISTHKGYAY 291

Query: 328 EIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASH 387
               + + L+P+ +  +HN I +L A F  +  F +  +    +   + G + + A    
Sbjct: 292 --MESVNLLIPKNLMFSHNFIPVLLATFFLFCGFMVVMYVIANYSATVEGNSMIVASIKI 349

Query: 388 CMFILWGTIAAFTVAFTIKRVGP-SVLLFCSMVAFTVGSIMLSITPVHQT-YWKMTFGMQ 445
              I    +A  TVA+      P + L+  S ++   G+  + I  V    +WK+ F   
Sbjct: 350 IPMISGLVLANGTVAYKQDLFKPKNALVVGSFISILGGAFFVPIKYVDDNLFWKLFFMGG 409

Query: 446 IILAFGMDLSFP-ASSIILSDALPMEYQGMAGSLVNT 481
                G    F    ++ + DA P +Y+ +AG +V T
Sbjct: 410 FFTGLGGAFFFCYMITMAIGDA-PDQYKALAGGIVQT 445

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 8/142 (5%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           + IG  FN D ++  WLMA + L +  F+L+ GRI  + GLK +++  +++    SL+ G
Sbjct: 32  DTIGQEFN-DYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAG 90

Query: 167 FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAA 226
            AN   S+   I  R   G G + +   V G+  +I  V    +  VI+ +G+       
Sbjct: 91  AAN---SMGMLIGARVISGFGGSGIESLVYGVGTSI--VEEKHRARVITVLGIAYMLAEG 145

Query: 227 FGAFWAGLIATKAEKQWPWIFY 248
            G F  G +A      W W FY
Sbjct: 146 AGPFVGGGLAEHV--SWRWCFY 165

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 92/417 (22%), Positives = 169/417 (40%), Gaps = 41/417 (9%)

Query: 100 TQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMI 159
           T  T+ ++ I S FN +    +W+  ++ L S +F  + G++ DI+G +  ++   +V  
Sbjct: 158 TIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFC 216

Query: 160 IWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS--LRKNIVISCI 217
           + +LICG    S ++   ++ R   G+G   +         +I  + S  L + I     
Sbjct: 217 LGALICGM---SKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFF 273

Query: 218 GMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFS 277
           G+    G A G    GL A +A   W   F       +L+       +    PV+ H  +
Sbjct: 274 GL----GTACGGLVGGLFADRAVG-WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGA 328

Query: 278 -------------MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYXXXXXXXXXXXXXXX 324
                        +DWTG+V  V+ L  F  V +   + G +  +               
Sbjct: 329 GQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYF 385

Query: 325 XXYEIKFAKSPLLPQAVTHNHNIIMI-LSAMF--MGWGSFGIWTFYYYAFLLNLRGYTPL 381
             +E+  A  P+LP     N +++   LS  F  MG  + G +   YYA +LN+    P 
Sbjct: 386 IYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPT 442

Query: 382 EAGASHCMFILWGTIAAFTVAFTIKRVGPS---VLLFCSMVAFTVGSIMLS-ITPVHQTY 437
           + G             +    + +KR G     +L FC  +   +G + +S +TP   T 
Sbjct: 443 DIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC--LVGVLGQVQISYVTPSIST- 499

Query: 438 WKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMG 494
           W+  + + +I  FG  +    + + L  A+P  +Q    S+     +  ++L + +G
Sbjct: 500 WRQ-YCLYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIG 555

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 99/474 (20%), Positives = 172/474 (36%), Gaps = 65/474 (13%)

Query: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142
           L  L C   +LLN A      S ++ +   +N   ++ +W + S+ +    FI   GR+G
Sbjct: 33  LIFLGCTF-DLLNVASMI---SLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLG 88

Query: 143 DIYGLKRTMIGGLIVMIIWSLICG-FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGN 201
           DI G             I SL+C    N+ +    F + RA QG+  A ++P    L+  
Sbjct: 89  DIVGNSVLFTISCSCFAILSLLCAVMPNFPA----FAVFRAIQGICAAGLVPCAYALIPI 144

Query: 202 IYKVGSLRKNI-VISC-----IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY-AYAFAG 254
           +     ++K   ++SC     IG+    G AF A   G         +  IFY  +A   
Sbjct: 145 LAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIG---------YRGIFYLTFAVMS 195

Query: 255 ILNLVLAIYSI--------PDTVPVNVHGFSMDWTGSVVGVIGLILF-------NFVWNE 299
           +++++   ++         P  +       S+D+ GS++ V G IL           WN 
Sbjct: 196 LISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNR 255

Query: 300 AP-----IVG---------WEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNH 345
                  I+G         W   Y                 +E       L+P  V    
Sbjct: 256 PVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFE---KVQLLIPVDVLFMK 312

Query: 346 NIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTI 405
           N I I+ A  +         +    +       +PL AG      I+   +     AF  
Sbjct: 313 NFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFES 372

Query: 406 KRVGPSVLLFCSMVAFTVGSIMLSITPVH----QTYWKMTFGMQIILAFGMDLSFPASSI 461
            ++ P V +         GSI+L    +H      +WK+ F  Q ++ FG+ + +P +  
Sbjct: 373 TKLKPRVGVALGFSLALAGSIIL--IQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQ 430

Query: 462 ILSDALPMEYQGMAGSLVNTIVNYSTSLCLGM--GTTAEIQVNKNGTDLLKGYR 513
           I     P + +G+A  +  T       +   +      +I   K   D ++ +R
Sbjct: 431 IAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFR 484

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 95/440 (21%), Positives = 160/440 (36%), Gaps = 63/440 (14%)

Query: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142
           L  L C   +LLN A      S ++ +   ++   ++ +W + S+ +    FI   GR+G
Sbjct: 33  LIFLGCTF-DLLNVASMI---SLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLG 88

Query: 143 DIYGLKRTMIGGLIVMIIWSLICG-FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGN 201
           DI G             I SL+C    N+ +    F + RA QG+  A ++P    L+  
Sbjct: 89  DIVGNSILFTVSCFFFAILSLLCAVMPNFPA----FAVFRAIQGISAAGLVPCAYALIPM 144

Query: 202 IYKVGSLRKNI-VISC-----IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY-AYAFAG 254
           +     ++K   ++SC     IG+    G AF A   G         +  IFY  +A   
Sbjct: 145 LAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIG---------YKGIFYLTFAVMF 195

Query: 255 ILNLVLAIYSI--------PDTVPVNVHGFSMDW-------TGSVVGVIGLILFNFVWNE 299
           ++++V   ++         P          S+D+       TGS++ V+GL      WN 
Sbjct: 196 LISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGESWNR 255

Query: 300 AP--------------IVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAVTHNH 345
                              W  +Y                 +E       L+P  V    
Sbjct: 256 PATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFE---KVQLLIPVDVLFMK 312

Query: 346 NIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTI 405
           N I I+ A  +         +    +       +PL AG      I+   I     AF  
Sbjct: 313 NFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFES 372

Query: 406 KRVGPSVLLFCSMVAFTVGSIMLSITPVH----QTYWKMTFGMQIILAFGMDLSFPASSI 461
            ++ P V +         GSI+L  T +H      +WK+ F  Q ++ FG+ + +P +  
Sbjct: 373 TKLKPKVGVVLGFSLALAGSIIL--TQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQ 430

Query: 462 ILSDALPMEYQGMAGSLVNT 481
           I     P   +G+A  +  T
Sbjct: 431 IAVGGAPDRSKGIASGVAQT 450

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 60/139 (43%), Gaps = 19/139 (13%)

Query: 116 DSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVT 175
           D S   W+ A + L S    L+ GRI  + G K +M+  +I+  + SL+   AN   S+ 
Sbjct: 88  DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALAN---SMD 144

Query: 176 FFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGA 229
             I  R   GLG      + FV+ + +        V   ++ ++I+C+G      +  G 
Sbjct: 145 MLIGGRVIAGLGGSGIQTLCFVIISTL--------VEESKRGLLIACMGSAFGIASVVGP 196

Query: 230 FWAGLIATKAEKQWPWIFY 248
           F  G   T     W W F+
Sbjct: 197 FLGGAFTTHV--TWRWCFW 213

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/270 (20%), Positives = 110/270 (40%), Gaps = 13/270 (4%)

Query: 4   IISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFS 63
           I+S D    + +G +++ K  V  K     L  D+  S+S  T+       +  D + ++
Sbjct: 15  ILSDDTFNENQNGTEQEVKELVQGKNNFKGLKGDNVNSLSRTTTREVRATPSESDLDTYT 74

Query: 64  DNNTP----WQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSS 119
           D  TP     + P    +  +++  +         +  G       +  +   FN +   
Sbjct: 75  DAETPDKVSCETPYTLMTHGQKWFMVALLTSGGFWSSLGSPIYYPALKQLEQVFNINEEM 134

Query: 120 KTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFII 179
               +  + +  G    +SG + D+YG +  ++ G+++ ++ S+    +N    + F   
Sbjct: 135 VNITVVVYFIFQGVAPTISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL-- 192

Query: 180 CRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAF-WAGLIATK 238
            R  Q  GI+ ++    G+VG+ +   S R + V +  G  A  G AFG+   AGL A  
Sbjct: 193 -RCVQSAGISPLIAISSGVVGD-FTTKSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAA- 248

Query: 239 AEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
               W  IF+          V+  + +P+T
Sbjct: 249 --YDWRAIFWFLTIGCGTCFVINFFLLPET 276

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 101/444 (22%), Positives = 168/444 (37%), Gaps = 71/444 (15%)

Query: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142
           L  L C   +LLN A      S ++ +   +N   ++ +W + S+ +    FI   GR+G
Sbjct: 33  LIFLGCTF-DLLNVASMI---SLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLG 88

Query: 143 DIYGLKRTMIGGLIVMIIWSLICG-FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGN 201
           DI G             + SL+C    N+ +    F + RA QG+  A ++P    L+  
Sbjct: 89  DIIGNSVLFTISCSCFAVLSLLCAVMPNFPA----FAVFRAIQGICAAGLVPCAYALIPI 144

Query: 202 IYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY-AYAFAGILNLVL 260
           +     ++K   I   G  +  G   G    G  AT  +  +  IFY  +A   +++++ 
Sbjct: 145 LAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFAT-TKIGYRGIFYLTFAVMTLISIIA 201

Query: 261 AIYSI--------PDTVPVNVHGFSMDWTGS----------VVG---------------- 286
             ++         P     +    S+D+ GS          VVG                
Sbjct: 202 FFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVT 261

Query: 287 -VIGLILF--NFVWN--EAPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAV 341
            VIG+ILF   FVWN     IV   K Y                  ++ F K+  +P  +
Sbjct: 262 LVIGIILFFGFFVWNCTYTKIVRGFK-YCGIDTSKYFEKVQLLIPIDVLFMKN-FIPIVL 319

Query: 342 THNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTV 401
               N   + S +++      I  +  YA        +PL AG      I+   I     
Sbjct: 320 AFALNNACLFSCLYI------IDQYSQYA-----ERNSPLLAGVKLVPLIICMVIGNALC 368

Query: 402 AFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVH----QTYWKMTFGMQIILAFGMDLSFP 457
           AF   ++ P V +         GSI+L    +H      +WK+ F  Q ++ FG+ + +P
Sbjct: 369 AFESTKLRPRVGVAIGFFLALAGSIIL--IQLHLVKEDLFWKIFFSAQALVGFGVAIFYP 426

Query: 458 ASSIILSDALPMEYQGMAGSLVNT 481
            +  I     P E +G+A  +  T
Sbjct: 427 YALQIAVGGAPDESRGIASGVAQT 450

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 91/218 (41%), Gaps = 30/218 (13%)

Query: 92  NLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTM 151
           +LLN AG     S +  +G  +    +  +W + S+ +    FI   GR+GDI G     
Sbjct: 40  DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLF 96

Query: 152 IGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKN 211
                +  ++SL+C       +   F + RA QG+  A ++P    L+  + +   ++K 
Sbjct: 97  TISCFLFTLFSLLCAVVRDFPT---FAVFRALQGISAAGIVPCGYALIPLLAEPQDIQKF 153

Query: 212 I-VISC-----IGMCAPTGAAF--------GAFW---AGLIATKAEKQWPWIFYAYAFAG 254
             ++SC     IG+    G AF        G F+   AG++           FY Y    
Sbjct: 154 FSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAAS----FYTYRIEE 209

Query: 255 ILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLIL 292
              L + +  IP   P      S+D+ GS++ V G +L
Sbjct: 210 RKFLEVKVEDIPHDHPKVA---SLDFVGSLIFVSGSVL 244

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 100/239 (41%), Gaps = 15/239 (6%)

Query: 33  TLNYDSSTSVSEKTSAISVF---EGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCM 89
           TL++ ++  +    S+I      E ++PD E  +  +TP   P    S W ++  +    
Sbjct: 51  TLSHTTTRELHSDDSSIDTSLDGELSTPDEE--AQEHTP---PHSMLSYWNKWGMVAVLT 105

Query: 90  LSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKR 149
           +    +  G       +  +   FN D +     +  + +  G    VSG + DIYG + 
Sbjct: 106 MCGFWSSLGSPIYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRP 165

Query: 150 TMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLR 209
            ++ G++V ++ S+     N   S    I  R  Q  GI+ ++    G VG+ + V + R
Sbjct: 166 VILFGMLVYVVASIGIAACN---SYGVIIFLRCLQSTGISPLIAISSGAVGD-FTVKAER 221

Query: 210 KNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
              V +  G+    G AFG+     +A  A   W  IF+  A      + +A   +P+T
Sbjct: 222 GTFVGAVSGLVL-MGQAFGSLIGAALA--AAYNWRAIFWFLAIGCGACMAIAGIVLPET 277

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 71/175 (40%), Gaps = 23/175 (13%)

Query: 61  KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120
           +FS +  P   P+     +K++LFIL+   S           T  +  I   F+  +   
Sbjct: 55  EFSKDVNPI--PALKLISYKQWLFILSAFASFTWEAFDFFTVTLNVKKISHDFDVTTKQV 112

Query: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180
           TW +    ++     ++ G IGD YG K + I  L  M++  +I GF  +  +  +F+I 
Sbjct: 113 TWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFIKH--NFKYFLIA 170

Query: 181 RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAF--GAFWAG 233
           RAF G+    VL  + G             N    C   C P   +F  G F  G
Sbjct: 171 RAFFGV----VLGGIFG-------------NSAAQCFDDCPPEAHSFISGFFQQG 208

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 98/446 (21%), Positives = 165/446 (36%), Gaps = 71/446 (15%)

Query: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142
           L  L C   +LLN AG     S +  +G  +  + ++ +W + S+ +     I   GR+G
Sbjct: 36  LIFLGCTF-DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLG 91

Query: 143 DIYGLKRTMIGGLIVMII----WSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGL 198
           DI       IG  ++  I    +SL C      ++   F + RA QG+  A ++P    L
Sbjct: 92  DI-------IGNSVLFTISGFFFSLFCLLCAVVTNFPAFAVLRALQGIAAAGLVPCGYAL 144

Query: 199 VGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNL 258
           +  +     ++    +   G  +  G       A  +     K    IFY  +FAG+L +
Sbjct: 145 IPTLADPEDVQLFFAVVSCGFSSTIGIGLIIGGAFALTNVGYK---GIFY-LSFAGMLLV 200

Query: 259 VLAIYSIPDTVPVNVHGF----------------SMDWTGSVVGVIGLILFNFVWNEA-- 300
            +A +    T  +  H F                S+D+ GS++ + G +L      E   
Sbjct: 201 SIAAFFF--TYRIEEHKFAEQDYEGSIHRPGKVASLDFVGSLIFISGSVLIVVGLTEGGE 258

Query: 301 ----PIV---------------GWEKAYXXXXXXXXXXXXXXXXXYEIKFAKSPLLPQAV 341
               P+                 W  +Y                  E       L+P+ V
Sbjct: 259 SWKRPVAYVPFTIGMIFFCGFFAWNCSYQNLVIFLKKLGCDTSRYLE---KVQVLIPRDV 315

Query: 342 THNHNIIMILSAMFMGWGSF--GIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAF 399
               N I I        G     I+    Y+  ++    +PL AG      I+   I   
Sbjct: 316 LFMTNFIPITLGFLCNGGCLYSNIYIIDQYSQYVDKN--SPLLAGVKLVPLIITMVIGNT 373

Query: 400 TVAFTIKRVGPSV---LLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSF 456
             A    ++ P +   L F SMV  ++  I L +      YWK+ F  QI++ FG  + +
Sbjct: 374 ICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVE-ENLYWKIMFCSQILVGFGAAIFY 432

Query: 457 P-ASSIILSDALPMEYQGMAGSLVNT 481
           P A  +++ DA P   +G+A  +  T
Sbjct: 433 PYALKLVVGDA-PSGAKGIASGVTQT 457

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 79/168 (47%), Gaps = 19/168 (11%)

Query: 21  EKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWK 80
           +K NV +    ++ N DS  S  E + A+   EG   D E   D     ++P  F  +W 
Sbjct: 54  DKQNVQLTVQSSSEN-DSYKSGREHSGAL---EGNKEDEE---DLEIDLRDPKTF--KW- 103

Query: 81  EYLFILTCMLSN-LLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSG 139
               +LT + +N  L+    T  ++T+N + S F   +S  TW+  ++ L + +   + G
Sbjct: 104 ----VLTSLWTNSALSALDGTIVSTTVNDVASRFQ-QASMVTWVATAYLLTTTAAQPLYG 158

Query: 140 RIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187
           +I DI G ++ ++ G IV  +   +C F   S S+    I R   G+G
Sbjct: 159 KISDIIGRRKCLLFGEIVFAVGVGLCIF---SKSIPQLAIARGICGIG 203

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 106/266 (39%), Gaps = 23/266 (8%)

Query: 12  TSASGEQKQEKVNVAVKATINTLNYDSSTSVSE-------KTSAISVFEGTSPDAEKFSD 64
           T   G+ K EK+N    A IN+    S T+  E       +TS+ S  +   P  +  ++
Sbjct: 28  TKPDGQTKSEKLNFE-GAYINSHGTLSKTTTREIEGDLDSETSSHSSDDKVDPTQQITAE 86

Query: 65  NNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLM 124
              P+   SY   +W     +  C      +  G       +  +   FN D +     +
Sbjct: 87  TKAPYTLLSY-GQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTV 142

Query: 125 ASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQ 184
             + L  G    VSG + D +G +  ++ G+++ +I S+  G A  + S    I  R  Q
Sbjct: 143 VVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASI--GLA-CAPSYGVIIFLRCIQ 199

Query: 185 GLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWP 244
            +GI+  +    G+VG+ + +   R   V +  G     G  FG+    LI      +W 
Sbjct: 200 SIGISPTIAISSGVVGD-FTLKHERGTFVGATSGFVL-LGQCFGS----LIGAVLTARWD 253

Query: 245 W--IFYAYAFAGILNLVLAIYSIPDT 268
           W  IF+          ++A   +P+T
Sbjct: 254 WRAIFWFLTIGCGSCFLIAFLILPET 279

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 21/155 (13%)

Query: 35  NYDSSTSVSEKTSAISVFEGTSPDA--EKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSN 92
           N D +T + E+T      + T  DA  +++ ++N          S W          L +
Sbjct: 3   NLDETTGLLEQTP-----DTTEQDALEQEYHEHNLSLPKLPIVLSLW----------LGS 47

Query: 93  LLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMI 152
            L+    T   + MN +   F  +S  K W+  S+ L + +F  + G++ D+ G K  + 
Sbjct: 48  FLSSLDGTIVANIMNRVAEEFQ-ESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAV- 105

Query: 153 GGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187
             L     + L C    +++SVT F I RA  G+G
Sbjct: 106 --LTAHFFFGLGCLLTCFANSVTQFAIARAICGVG 138

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 19/178 (10%)

Query: 6   SSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDN 65
           S DNS  + + E+ Q   N AV         +S TS+++     S+  G S D+     N
Sbjct: 3   SIDNSNVNNT-EETQLLKNNAVN--------NSDTSLAKSGGYNSIVSGASSDS-----N 48

Query: 66  NTPWQNP-SYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLM 124
           N P  +P + ++    +   + +  L + L+    T     MN +   FNA S+ K W+ 
Sbjct: 49  NKPKLDPITKYNLSLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNA-SNQKQWIA 107

Query: 125 ASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182
            S+ L + +F  + GR+ DI G K T    LIV   + +      +S ++  F + RA
Sbjct: 108 TSYLLTNTAFQPLYGRLSDIIGRKYTQ---LIVPFFFGMGSFLTTFSKTLPQFALARA 162

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 77  SRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFIL 136
           SR + ++ I +  L + L     T  T+ ++ I S FN + S  +W+  ++ L S +F  
Sbjct: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114

Query: 137 VSGRIGDIYGLKRTMIGGLIVMIIWSLICGFAN 169
           + G+I DI+G +  +I   +  I+  LICG + 
Sbjct: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 78  RWKEYLFILTCMLSN-LLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFIL 136
           R   + ++LT + +N  L     T  ++T+N I S F   +S  TW+  ++ L + +   
Sbjct: 55  RDSNFSWVLTSIWTNSALAALDGTIVSTTVNDIASQFQ-QASMVTWVATAYLLTTTAVQP 113

Query: 137 VSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187
           + G+I DI G ++ ++ G ++  +  L+C FAN   ++    I RA  G+G
Sbjct: 114 LYGKISDIIGRRKCLLFGEVIFALGVLLCNFAN---TIPQLAIARAICGIG 161

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 8/145 (5%)

Query: 104 STMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSL 163
           + +N I   FNA  S   WL+  + L +  F L+ GR   I+G K T++  +I+  I SL
Sbjct: 42  TILNTIADKFNA-YSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSL 100

Query: 164 ICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPT 223
           +   +N   S+   I  R   G G + +   V  +  ++  V    +  +++ + +    
Sbjct: 101 VIAVSN---SMDMIIGGRVIAGCGASGIQTLVFAIATSL--VDEHTRGTIVTLLSLSYAV 155

Query: 224 GAAFGAFWAGLIATKAEKQWPWIFY 248
            +A G +  G  A      W W FY
Sbjct: 156 ASALGPYIGG--ALTEYVTWRWCFY 178

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 106/269 (39%), Gaps = 29/269 (10%)

Query: 12  TSASGEQKQEKVNVA----------VKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEK 61
           T  +GE K EK+N+            KAT   +  D    +  +TS+ S  +   P  + 
Sbjct: 28  TIPNGETKSEKLNLEGGYVNSHGTLSKATTREIEGD----LESETSSHSGDDKIDPQQQI 83

Query: 62  FSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKT 121
            ++   P+   SY   +W     +  C      +  G       +  +   FN D +   
Sbjct: 84  TAETGAPYTLLSY-GQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMIN 139

Query: 122 WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICR 181
             +  + L  G    +SG + D +G +  ++ G+++ ++ S+  G A  + S    I  R
Sbjct: 140 ITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASI--GLAC-APSYGVIIFLR 196

Query: 182 AFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEK 241
             Q +GI+  +    G+VG+ + +   R   V +  G     G  FG+    LI      
Sbjct: 197 CIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGFVL-LGQCFGS----LIGAVLTA 250

Query: 242 QWPW--IFYAYAFAGILNLVLAIYSIPDT 268
           +W W  IF+          ++A   +P+T
Sbjct: 251 RWDWRSIFWFLTIGCGSCFLIAFLVLPET 279

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 64/145 (44%), Gaps = 14/145 (9%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           + IG  F+ D  +  WL+  + L +  F+L+ GR+ +I G K  ++  +IV  I SLI  
Sbjct: 33  DTIGIKFH-DFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISA 91

Query: 167 FANYSSSVTFFIICRAFQGLGI---AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPT 223
            +N  +++    +   F G GI   AFV+   +        V    + I+I+ + +    
Sbjct: 92  LSNSMATLISGRVVAGFGGSGIESLAFVVGTSI--------VRENHRGIMITALAISYVI 143

Query: 224 GAAFGAFWAGLIATKAEKQWPWIFY 248
               G F  G  A      W W FY
Sbjct: 144 AEGVGPFIGG--AFNEHLSWRWCFY 166

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 70/171 (40%), Gaps = 21/171 (12%)

Query: 103 TSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWS 162
           ++++ VI   F  D S   W+++ + L      L+ GR   I G K +++  +++    S
Sbjct: 139 SASIEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGS 197

Query: 163 LICGFANYSSSVTFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISC 216
           LI   +N   S+   I  R   G+G      + FV+ + +             + I+IS 
Sbjct: 198 LISAISN---SMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISV 246

Query: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYA-YAFAGILNLVLAIYSIP 266
           +       A  G F  G + T     W W FY      G+  +VLA+   P
Sbjct: 247 LSCSYAVAAVVGPFLGGALTTHVT--WRWCFYINLPIGGLAFVVLAMVYNP 295

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 122 WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICR 181
           WL   + L +    L+ GRI    G KRTM+  +++  + SLI   AN   S+   I  R
Sbjct: 115 WLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLISALAN---SMNVLIGGR 171

Query: 182 AFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLI 235
              G+G      ++FV+ + +        V    + ++I+ +       +  G F  G+ 
Sbjct: 172 VIAGVGGCGIQSLSFVIGSNL--------VEESNRGVLIAILSCSFAIASVVGPFLGGVF 223

Query: 236 ATKAEKQWPWIFY 248
            ++    W W FY
Sbjct: 224 TSRV--TWRWCFY 234

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 56/140 (40%), Gaps = 19/140 (13%)

Query: 115 ADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSV 174
            D S   WL   + L +   +L+ GRI  + G K + +  +++  + SL+   AN   S+
Sbjct: 75  GDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSALAN---SM 131

Query: 175 TFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFG 228
              I  R   G+G      + FV+ + +        V    + ++I+ +       +  G
Sbjct: 132 DMLIGGRVIAGIGGSGVQSLVFVISSTL--------VEERNRGLIIAVMSSSFGIASVVG 183

Query: 229 AFWAGLIATKAEKQWPWIFY 248
            F  G   T     W W FY
Sbjct: 184 PFLGGAFTTHV--TWRWCFY 201

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 122 WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICR 181
           WL   + L +    L+ GRI    G K TM+  +++  I SLI   AN   S++  I  R
Sbjct: 106 WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALAN---SMSMLIGGR 162

Query: 182 AFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLI 235
              G+G      ++FV+ + +        V   ++ I+I+ +       +  G F  G+ 
Sbjct: 163 VIAGVGGCGIQSLSFVIGSTL--------VEESQRGILIAVLSCSFAIASVVGPFLGGVF 214

Query: 236 ATKAEKQWPWIFY 248
            +     W W FY
Sbjct: 215 TSSVT--WRWCFY 225

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 51/267 (19%), Positives = 111/267 (41%), Gaps = 8/267 (2%)

Query: 4   IISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFS 63
           +I++ N   + +  + +++ ++   + I   ++DS  S  E++S +       P+    +
Sbjct: 34  LITASNISINPNENRLEKESDMTDISEIKDTDFDSDKSKEEQSSIVR--NEKHPETAFTA 91

Query: 64  DNNTPWQNPSYFS-SRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTW 122
                  NP Y + S ++    +L  +    L           + ++ S FN  +++   
Sbjct: 92  LEPEIAYNPPYSAFSNYQVVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAING 151

Query: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182
            +A+F  V      +     D  G K   I  L++ +I +++   A     +    I R 
Sbjct: 152 TVAAFMGVFAVGPFLWAVHADFGGRKFLYIFSLMIALIANVL--LAAVPKHLAALYILRV 209

Query: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQ 242
           FQ +G + V+P  +G V ++  +  + +   +S   +    G   G  + GLI      Q
Sbjct: 210 FQAIGTSAVIPLGVGTVSDL--ISPMNRAKGVSYFMLGPNMGPILGPIFGGLILMNG-NQ 266

Query: 243 WPWIFYAYAFAGILNLVLAIYSIPDTV 269
           W W+F   +    + L+L +  +P+T+
Sbjct: 267 WRWLFGFTSITTGVGLILIVTFLPETL 293

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 105/269 (39%), Gaps = 24/269 (8%)

Query: 2   IEIISSDNSITSASGEQKQEKVNVAVKATINTLNYD--SSTSVSEKTSAISVFEGTSPDA 59
           I+ +  D +IT     QK        + T N L  D  SS    ++     + EG     
Sbjct: 23  IKKLHDDPTITKWRDYQKLH--GTISRTTTNELGDDDTSSECSHDEQEQQHIVEG----- 75

Query: 60  EKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSS 119
               + N P    +Y    +  +L  +T   S+L    G       +  +   FN D + 
Sbjct: 76  ----EQNYPHTLLTYRQKWFMVFLMTITGFWSSL----GSPIYYPALKELEQKFNIDENK 127

Query: 120 KTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFII 179
               +  + L  G    +SG + D+YG +  ++GG+++ ++ S+  G A  + S    + 
Sbjct: 128 VNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI--GIAK-APSYGVIVF 184

Query: 180 CRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKA 239
            R  Q +GI+  +    G+V + + V   R   V +  G+    G   G     +I   A
Sbjct: 185 LRCIQSIGISPTIAISSGVVSD-FTVKRERGTFVGATSGLVL-IGQGIGPLLGAVIT--A 240

Query: 240 EKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
              W  +F+         +++  + +P+T
Sbjct: 241 ALHWRAVFWFLTIGCGSCMIIGFFLLPET 269

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 77/188 (40%), Gaps = 14/188 (7%)

Query: 17  EQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFS 76
           E   E  N+ ++        D+   V++    +S+   T  +    + +  P+   + FS
Sbjct: 26  EHATEPQNLYMEHAEKIQKTDNRLDVTDSNRQLSLLNSTKSET---NFDGIPY---TRFS 79

Query: 77  SRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFIL 136
              K +L ++ C LS   +   QT     +++I   FN   S     +  + L  G F +
Sbjct: 80  KHDKLFL-VVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIFPV 138

Query: 137 VSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTF--FIICRAFQGLGIAFVLPN 194
           + G + D  G  R  +    +M+ +   C     +   TF   I  R  QG GI+ ++  
Sbjct: 139 IMGGLADRLG--RRPVAMFCIMVYF---CACIGIACCRTFGEMIFLRCLQGGGISPIIAI 193

Query: 195 VMGLVGNI 202
             GL+G+I
Sbjct: 194 NNGLMGDI 201

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 20/151 (13%)

Query: 104 STMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSL 163
           + M  + + FN  S +  WL+  + L +    L+ GR G + G K +M+  +++  + SL
Sbjct: 97  TIMETVAAKFNGYSMTG-WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSL 155

Query: 164 ICGFANYSSSVTFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCI 217
           I   A  ++S+T  I  R   G+G      + FV+ + +        V    +   IS +
Sbjct: 156 I---AAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTL--------VTDRTRGTAISIL 204

Query: 218 GMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248
                  +  G F  G  AT     W W FY
Sbjct: 205 SCAFAVASVAGPFLGGAFATHV--TWRWCFY 233

>Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AAR192C
          Length = 489

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 113 FNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSS 172
           FN  ++S TW +    +      ++ G +GD YG K + +  L +M+   +I GFA   +
Sbjct: 75  FNVKTASITWGITLALMTRTIGAVIFGYVGDRYGQKTSFLVNLSIMMALQIIIGFA---T 131

Query: 173 SVTFFIICRAFQGLGI 188
           S  +F+ CRA  G+ +
Sbjct: 132 SFRYFLACRALFGIAL 147

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 122 WLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICR 181
           WL   + L +   +L+ GRI    G K TM+  +++  I SLI   A   SS+   I  R
Sbjct: 100 WLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALA---SSMNMLIGGR 156

Query: 182 AFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLI 235
              G+G      ++FV+ + +        V   ++ ++I+ +       +  G F  G+ 
Sbjct: 157 VIAGIGGCGIQSLSFVIGSTL--------VEESKRGMLIAILSSSFAIASVVGPFLGGVF 208

Query: 236 ATKAEKQWPWIFY 248
            +     W W FY
Sbjct: 209 TSSV--TWRWCFY 219

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 61/143 (42%), Gaps = 5/143 (3%)

Query: 46  TSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATST 105
           T    +  G     E+F     P +  S  + + K +LF+ +   + L+        +  
Sbjct: 10  TRVTELLPGKKLSRERFRHEMDPRRTLS--TVKPKTWLFVASAFFALLVEATDFFIVSLN 67

Query: 106 MNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLIC 165
           +  I    N +    TW M    +      ++ G IGD +G K + +  + ++ I  L+ 
Sbjct: 68  VVKIAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQKASFMINIGMISILQLLT 127

Query: 166 GFANYSSSVTFFIICRAFQGLGI 188
           GFA   ++  +FI CRA+ G+ +
Sbjct: 128 GFA---TTFPYFIACRAYFGVEL 147

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 79/175 (45%), Gaps = 23/175 (13%)

Query: 15  SGEQKQEKVNVAVKATINTLNYDS--STSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNP 72
           + E +Q+  N       +   +DS  +T+V ++T+  +  + T P          P + P
Sbjct: 30  ANEVEQQDYN-------SRTGHDSYGATAVDDRTATSARCDLTFP----------PSETP 72

Query: 73  SYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSG 132
            +  S  +  + +++  L   L     T  ++ +  IGS FN+     +W+  S+ L S 
Sbjct: 73  EFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNS-LDKVSWIATSYLLSSS 131

Query: 133 SFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187
           +   + G++ D  G K  ++   +V  I  LICG    S+S+ + ++ R   G+G
Sbjct: 132 TCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM---STSIWWVVVGRFVSGIG 183

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 8/142 (5%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           + IG  FN D ++  WLM  + L +   +L+ GRI  + GLK +++  +++    SL+  
Sbjct: 32  DTIGKVFN-DYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAA 90

Query: 167 FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAA 226
            A   +S+   I  R   G G + +   V  +      V    +  V++ +G+       
Sbjct: 91  LA---TSMGMLIGGRVIAGFGGSGIETLVFAV--GTRMVDEKHRARVVTILGIAYMLAEG 145

Query: 227 FGAFWAGLIATKAEKQWPWIFY 248
            G F  G  A      W W F+
Sbjct: 146 AGPFIGGAFAEHV--SWRWCFF 165

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 71/178 (39%), Gaps = 15/178 (8%)

Query: 71  NPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLV 130
            PS   S  K  + + +  L   L     T  ++ M  IGS FN       W+  S+ L 
Sbjct: 386 EPSVEMSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVP-WVATSYLLS 444

Query: 131 SGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAF 190
           S  F  + G++ DI+G K  +I   ++     +ICG +N   S+   +  R   G+G   
Sbjct: 445 SAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSN---SLNMLVWGRFVAGIGGGG 501

Query: 191 VLPNVMGLVGNIYKVGSLRKNIVISCIGMCA---PTGAAFGAFWAGLIATKAEKQWPW 245
           +       V +I     LR   V    G+C      G AFG    G+     + Q+ W
Sbjct: 502 ITSMTTITVSDIVP---LRSRAVYQ--GICNFFFGLGTAFGGVIGGIF---VDHQYGW 551

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 53/268 (19%), Positives = 111/268 (41%), Gaps = 13/268 (4%)

Query: 3   EIISSDNSITSASGEQKQEKV--NVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE 60
           E  S +N     +G+ K +++   VA K  +  LN   S + + +    S+        E
Sbjct: 13  EAGSIENLTREYTGDNKPKELIEAVASKDGLYHLNGTLSRATTREIDGDSLQSSDEEKNE 72

Query: 61  KFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK 120
           + S++ +P+   +Y   +W     +  C      +  G       +  +   F  D +  
Sbjct: 73  QASESTSPYTLLTY-KQKWGMVALLTMC---GFWSSLGSPIYYPALRQLEKQFGLDENKV 128

Query: 121 TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIIC 180
              +  + L  G    +SG + D++G +  ++ G+++ ++ S+  G A  + S    +  
Sbjct: 129 NVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI--GLA-CAPSYGVIVFL 185

Query: 181 RAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAE 240
           R  Q +GI+  +    G+VG+ + +   R   V +  G+    G  FG+    ++A  A 
Sbjct: 186 RIIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGLVL-LGQCFGSLIGAVLA--AA 241

Query: 241 KQWPWIFYAYAFAGILNLVLAIYSIPDT 268
             W  IF+        + ++A   +P+T
Sbjct: 242 WNWRAIFWFLTIGCGTSFIIAFLLLPET 269

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 74/166 (44%), Gaps = 23/166 (13%)

Query: 103 TSTMNVIGSAFNADSSSKT-WLMASFPLVSGSFILVSGRIG-DIYGLKRTMIGGLIVMII 160
           T+ +N +G+ F  D+ +KT W++A + L +    L+ GRI     G K  M+  +++  I
Sbjct: 79  TTIINDVGAHF--DAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEI 136

Query: 161 WSLICGFANYSSSVTFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVI 214
            SLIC  AN   S+   I  R   G+G      ++FV+ + +        V    +  +I
Sbjct: 137 GSLICALAN---SMDMLIGGRVIAGIGGSGIQSLSFVIGSTL--------VSPRGRGFII 185

Query: 215 SCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVL 260
           + +       +  G F  G  A  +   W W F+     G + LV+
Sbjct: 186 AFMSASFGIASVIGPFIGG--AFTSHVTWRWCFWINLPVGAVALVI 229

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 91/439 (20%), Positives = 169/439 (38%), Gaps = 45/439 (10%)

Query: 80  KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSG 139
           K  +  L+  L   L  A  T  ++ M  I S FN +    +W+  ++ L S +F  + G
Sbjct: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYG 135

Query: 140 RIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLV 199
           ++ DI+G K  ++   IV ++  L+CG    + S    +  R   G+G   V       +
Sbjct: 136 KLSDIFGRKPLLMLNNIVFLVGCLMCGL---TPSFWGLVGARFISGIGGGGVTSMCSITI 192

Query: 200 GNIYKVGSLRKNIVISCIGMCA---PTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGIL 256
            +I     LR   +    GMC      G A G    G  +                + + 
Sbjct: 193 SDIVP---LRDRALYQ--GMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQVPLSALS 247

Query: 257 NLVLAIYSI--PDTVPVNVHG------FSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKA 308
           +L++A++    P +  VN          S+DW G+   V+ L LF      A + G E A
Sbjct: 248 SLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLF---LVTASLGGKEIA 304

Query: 309 YXXXXXXXXXXXXXXXXXY----EIKFAKSPLLPQAVTHNHNIIMILSAMFMGW---GSF 361
           +                 +    E+  AK P+LP +   N +   +L + F  W    + 
Sbjct: 305 FNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRS---VLGSSFSNWFCMMAM 361

Query: 362 GIWTFY---YYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLL---F 415
              ++Y   YY+ +LN+    P   G           + +    + +KR G    L   F
Sbjct: 362 MTTSYYLPIYYSGVLNM---NPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGF 418

Query: 416 CSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMA 475
           C++    +G + +++       W+  F + +I  FG  +    + + +  A+P  +    
Sbjct: 419 CTLS--LLGHLQINLMKPDIATWRQ-FILLVIPGFGYSVLITVALLAMIAAVPHNHHAAT 475

Query: 476 GSLVNTIVNYSTSLCLGMG 494
            S+     +  ++L + +G
Sbjct: 476 TSISYAFRSTGSTLGVSIG 494

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 104 STMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSL 163
           S ++ + + ++   ++ +W + S+ +    FI   GR+GDI G  R          I SL
Sbjct: 50  SLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSL 109

Query: 164 ICGF-ANYSSSVTFFIICRAFQGLGIA 189
           +CG   N+ +    F + RA QG+  A
Sbjct: 110 LCGLMPNFEA----FAVMRALQGIAAA 132

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 55/137 (40%), Gaps = 7/137 (5%)

Query: 379 TPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPV--HQT 436
           +PL AG      I+   I  F       R+ P   +         GSI+L+      +  
Sbjct: 340 SPLMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVTLGFFLALSGSIILTQLRAVKYDV 399

Query: 437 YWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLG---- 492
           +WK+ F  ++++ FG+ + +P +  +     P E +G+A  +  T       +       
Sbjct: 400 FWKIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQTFGQLGIEIAFSIMAS 459

Query: 493 -MGTTAEIQVNKNGTDL 508
            +G   EI+   + ++L
Sbjct: 460 VLGNIEEIRGRPDASEL 476

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142
           + +L+  L   L     T  ++T   + S FN   S  +W+  S+ L S +F  + G++ 
Sbjct: 112 VIMLSMYLGIFLAAIDNTIVSTTSAHVASEFN-QLSKVSWIATSYLLSSATFQPLYGKVS 170

Query: 143 DIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187
           DI+G K  ++   +  +I  L+CG    S S  + +I R   G+G
Sbjct: 171 DIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWLVIARFVAGVG 212

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 61/152 (40%), Gaps = 20/152 (13%)

Query: 103 TSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWS 162
           ++ +  +   FN  S S  WL+  + L +    LV GR   I G K +M+  +I+  + S
Sbjct: 64  STIIETVSRDFNEYSKSG-WLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGS 122

Query: 163 LICGFANYSSSVTFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISC 216
           L+   AN   S+   I  R   G+G      + F++ + +        V    + + IS 
Sbjct: 123 LVSALAN---SMNMLIGGRVISGVGGSGLQTLCFLIISTL--------VNERSRGMAISV 171

Query: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248
           +       +  G F  G   T     W W FY
Sbjct: 172 LSCSFAVASIVGPFLGGAFTTHV--TWRWCFY 201

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 62/145 (42%), Gaps = 18/145 (12%)

Query: 109 IGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFA 168
           IG  F  D +   WL+  + L +  F L+ GR+  I GLK ++   +++  I SLI   +
Sbjct: 34  IGEKFK-DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVS 92

Query: 169 NYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS-----LRKNIVISCIGMCAPT 223
           N   S+   I  R   G G +       G+   ++ VG+       + +VI+ +G+    
Sbjct: 93  N---SMGMIIGGRVVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 224 GAAFGAFWAGLIATKAEKQWPWIFY 248
             A G    G  A      W W FY
Sbjct: 143 AFAVGPVIGG--AFTENVSWRWCFY 165

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 83  LFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIG 142
           + +L+  L   L     T  ++ +  I S FN +    +W+  ++ L S +F  + G+I 
Sbjct: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKIS 180

Query: 143 DIYGLKRTMIGGLIVMIIWSLICGFA 168
           DI+G K  +I   I   + SLICG +
Sbjct: 181 DIFGRKVVLIFCNITFFVGSLICGLS 206

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 60/151 (39%), Gaps = 20/151 (13%)

Query: 104 STMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSL 163
           + ++V+   F  + S   WL+  + L +    L+ GR   I G + ++I  +++    SL
Sbjct: 59  TIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 164 ICGFANYSSSVTFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISCI 217
           I   A   SS+   I  R   G+G      + FV+   M        VG   + +VIS +
Sbjct: 118 IAALA---SSMNMLIFGRVVAGVGGSGLQTLCFVIGCTM--------VGERSRPLVISIL 166

Query: 218 GMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248
                  A  G    G   T     W W FY
Sbjct: 167 SCAFAVAAIVGPIIGGAFTTHVT--WRWCFY 195

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 136 LVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFV 191
           L+ GR+G+ +G +RT+  G ++ +I  L  GFA+    +   II R   GLG+  +
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFAD---KMMHLIIGRTISGLGVGLL 215

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 52/273 (19%), Positives = 109/273 (39%), Gaps = 19/273 (6%)

Query: 17  EQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSP-----DAEKFSDNNTPWQ- 70
           ++  ++    V +++ +L    S + +++  + S  E  SP     D  +  D   P + 
Sbjct: 40  DEYADEYPAGVPSSLGSLQQAVSRTRTKEIGSDSGDESGSPSGIKQDGHESEDEGQPEEV 99

Query: 71  --NPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFP 128
              P    S  +++  +    +    +  G       +  +   F+ + S     +  + 
Sbjct: 100 STAPYTLLSYSQKWGMVAVLTMCGFWSSLGSPIYYPALRQLEKEFHLNESQVNVTVVVYL 159

Query: 129 LVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGI 188
           L  G     SG + D YG +  ++GG++V ++ S+  G A  + S    +  R  Q +GI
Sbjct: 160 LFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASI--GLAR-APSYGVIVFLRIVQSIGI 216

Query: 189 AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPW--I 246
           +  +    G+V + Y +   R   V +  G     G   G     +IA +    W W  I
Sbjct: 217 SPTIAISSGVVSD-YTLKRERGTFVGATSGFVL-IGQGIGPLLGAVIAAR----WDWRAI 270

Query: 247 FYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMD 279
           F+        ++++A + +P+T    V   S++
Sbjct: 271 FWFLVIGCGTSMLIAFFLLPETKRTIVGNLSIE 303

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 60/147 (40%), Gaps = 18/147 (12%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
             IG  FN D +   WL+  + L S  F L+ GR+  + GLK  ++  +++  I SLI  
Sbjct: 68  ETIGEKFN-DYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAA 126

Query: 167 FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS-----LRKNIVISCIGMCA 221
            +N   S+   I  R   G G +       G+   +Y VG+       + +VI  +    
Sbjct: 127 VSN---SMGMLIAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTFAF 176

Query: 222 PTGAAFGAFWAGLIATKAEKQWPWIFY 248
               A G    G  A      W W F+
Sbjct: 177 VGSNAGGPILGG--ALNEHASWRWCFF 201

>AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 500

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 61/144 (42%), Gaps = 5/144 (3%)

Query: 45  KTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATS 104
           KT    +F    P  E+F     P    S  + + K +LFI +  L+  +        + 
Sbjct: 9   KTRVTELFPEKRPSWEEFKYTMNPANVLS--NVKLKTWLFIASAFLALTVEATDFFLVSL 66

Query: 105 TMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLI 164
            +  I    +      TW +    +      +V G +GD +G + + +  + ++ +  L+
Sbjct: 67  NVVKIAEDLHVREDKVTWGITVALMTRTIGAIVYGYVGDRFGQRTSFLINIGMISVLQLV 126

Query: 165 CGFANYSSSVTFFIICRAFQGLGI 188
            GFA   +S  +F+ CRA+ G+ +
Sbjct: 127 TGFA---TSFPYFLACRAYFGVEL 147

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 57  PDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNAD 116
           P+   F  +     N S  +   K  + ++   L + L+    T  ++ +  I S  +A 
Sbjct: 17  PEIPTFDSSYDAAANHSVLTET-KTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDA- 74

Query: 117 SSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           SS  +W+  S+ L   +F  + G++ DI+G K  ++   +V  I   +CG
Sbjct: 75  SSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG 124

>TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 57/276 (20%), Positives = 103/276 (37%), Gaps = 22/276 (7%)

Query: 6   SSDNSITSASGEQKQEKVNVAVKATINT----LNYDSSTSVSEKTSAISVFEGTSPDAEK 61
           +S+ ++    GE  +  ++  V+  +       N DS    S K    + F+    D   
Sbjct: 44  NSNKNLILDEGEDNKSDISTEVEKDLEKNSCIQNCDSMAESSLKGKEGTEFDPFLVDWHG 103

Query: 62  FSDNNTP--WQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSS 119
             D   P  W+        WK+ L +   ML   +N  G +  T     I   F+     
Sbjct: 104 PDDPENPLNWK-------PWKKGLIMFEVMLLTSINYMGSSIYTPGQEEIQREFHVGHVV 156

Query: 120 KTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFII 179
            T  ++ + L  G   ++   + +     R  I  +I M ++++    A    ++   I+
Sbjct: 157 ATLNLSMYVLGYGIGPMILSPLSEYARFGRLHIY-IISMFLFTIFQIGAATVHNIGGLIV 215

Query: 180 CRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIG-MCAPTGAAF-GAFWAGLIAT 237
            R   G+  +  L    G + +     +L + I +  +G M AP  A   GA        
Sbjct: 216 IRFISGILCSPALATGGGTLADFLDPKTLPRYIGLWSLGFMSAPVSAPLLGA------CM 269

Query: 238 KAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNV 273
              K W WIF+   F  +   V+ I+  P+T   N+
Sbjct: 270 VVAKDWRWIFWLLLFMSVALFVMLIFFFPETHHGNI 305

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 14/145 (9%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           + IG  F+ D  +  WL+  + L +  F+L+ GR+ +I G    ++  +++  I SLI  
Sbjct: 33  DTIGIKFH-DFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISA 91

Query: 167 FANYSSSVTFFIICRAFQGLGI---AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPT 223
            +N   ++    +   F G GI   AFV+   +        V    + I+I+ + +    
Sbjct: 92  LSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSI--------VQENYRGIMITALAVSYVI 143

Query: 224 GAAFGAFWAGLIATKAEKQWPWIFY 248
               G F  G  A      W W FY
Sbjct: 144 AEGVGPFIGG--AFNEHLSWRWCFY 166

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 4/94 (4%)

Query: 94  LNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIG 153
           L+    T  ++ +  IGS FN +    +W+  ++ L S +F  + G+I DI+G K  +  
Sbjct: 107 LSALDNTIVSTLLARIGSEFN-ELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTF 165

Query: 154 GLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187
             +   I  LICG A    S    +I R   G+G
Sbjct: 166 CNVNFFIGCLICGTAK---SFWVLVIGRFISGVG 196

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 14/145 (9%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           + IG  F+ D  +  WL+  + L +  F+L+ GR+ +I G    ++  +I+  + SLI  
Sbjct: 33  DTIGIKFH-DFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISA 91

Query: 167 FANYSSSVTFFIICRAFQGLGI---AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPT 223
            +N   ++    +   F G GI   AFV+   +        V    +  +I+ +      
Sbjct: 92  LSNSMGTLISGRLIAGFGGSGIESLAFVVGTSI--------VQENHRGTMITALATSYVI 143

Query: 224 GAAFGAFWAGLIATKAEKQWPWIFY 248
               G F  G  A      W W FY
Sbjct: 144 AEGVGPFIGG--AFNEHLSWRWCFY 166

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 65/160 (40%), Gaps = 15/160 (9%)

Query: 15  SGEQKQEKVNVAVKATINTLNYD--SSTSVSEKTSAISVFEGTSPDAEK--FSDNNTPWQ 70
            GE  Q  +   V ++    N D  +   +S   S +  +     D E+    D  TP  
Sbjct: 2   DGEIAQPLLTRTVSSSNKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLDDETTPL- 60

Query: 71  NPSYFSSRWKEYLFILTCMLSNL-LNQAGQTQATSTMNVIGSAFNA-DSSSKTWLMASFP 128
                 SR      I   + +N+ L+    T   ST   IG+ FN  D SS  W+ AS+ 
Sbjct: 61  ------SRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLSS--WITASYL 112

Query: 129 LVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFA 168
           + S SF  + G   D+ G ++ +    ++  I  L CG +
Sbjct: 113 ITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGIS 152

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 96/230 (41%), Gaps = 17/230 (7%)

Query: 43  SEKTSAISVFEGTSPDAEKFSDNNTP-WQNPSYFSSRWKEYLFILTCMLSNL-LNQAGQT 100
           +E+ +    +   S + + FS    P W       S   + L I T + +N+ L+    T
Sbjct: 9   NERKNVPPSYSSISREEQMFSLTERPSW-------SERHKVLLIETALFTNVFLSGLDST 61

Query: 101 QATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMII 160
            + ST  +IG+ F  D    +W+  ++ +   SF  + G   D  G +  +        I
Sbjct: 62  ISASTYQLIGNEF-GDVKLSSWITTAYLITCTSFQPLYGSFSDTLGRRHCL---FFANTI 117

Query: 161 WSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMC 220
           ++L C     ++++   I+ RA  G+G   ++     +  +I  + + ++ I  +   + 
Sbjct: 118 FALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSDI--IPAKKRGIYQAFQNVL 175

Query: 221 APTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVP 270
             TGA  GA   GLIAT     W W F       +   ++A + + D  P
Sbjct: 176 LGTGAVVGASCGGLIATTM--GWRWCFLLQVPISVGGTLVAFFFVHDQRP 223

>ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 561

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 111/282 (39%), Gaps = 30/282 (10%)

Query: 6   SSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDN 65
            SD+S++  S  + +  V+      +  L    S  ++    ++S  +G S + +   D 
Sbjct: 38  ESDSSLSKDSTSKDESNVD------LEALEKQPSAVLANTGGSVSGGDGNSGELKDGKDA 91

Query: 66  NTPW-------QNPSYFSSRW---KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNA 115
             P+       ++P +    W   K+++ IL  ML   +   G    T     I   F  
Sbjct: 92  TDPYLVQFRGTKDPDH-PHNWLGFKKFVVILEIMLLTCVTYMGSAIYTPGQEEIQKEFGV 150

Query: 116 DSSSKTWLMASFPLVSGSFILVSGRIGD--IYGLKRTMIGGLIVMIIWSLICGFANYSSS 173
                T  ++ + L  G   +V   + +  +YG ++  I  L +  +  + C   +   +
Sbjct: 151 GHVVGTLNLSMYVLGYGLGPMVFSPLSEFAMYGRQQLYIITLFLFSMLQIGCALVH---N 207

Query: 174 VTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIG-MCAP-TGAAFGAFW 231
           +   +I R   G+  +  L      +G+I K   +   I +  IG + AP TG   GA  
Sbjct: 208 IAGLVILRFITGILCSPSLATGAASIGDIVKPELVPVFIGMWSIGAVAAPVTGPLLGA-- 265

Query: 232 AGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNV 273
               +    K W WIF+   +     L+L ++  P+T   N+
Sbjct: 266 ----SMVVAKNWRWIFWLLMWMSAALLILLVFFFPETGEDNI 303

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 136 LVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFV 191
           L+ GR+G+ +G +RT+  G  V II  L   F   ++ ++  II R   GLG+  +
Sbjct: 171 LMVGRLGEKWGRRRTIRYGSFVFIIGGL---FQTSATKLSHLIIGRVISGLGVGLL 223

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 63/155 (40%), Gaps = 4/155 (2%)

Query: 327 YEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGAS 386
           +EIKFA+ PL P+    N  I+  L  +     ++ + + Y Y  LL     +   A   
Sbjct: 324 WEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRI 383

Query: 387 HCMFILWGTIAAFTVAFTIKRVG--PSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGM 444
           + +F     I  F   F + +V      + F   V F    +M+  T    ++  +    
Sbjct: 384 NKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHVGIIVA- 442

Query: 445 QIILAFGMD-LSFPASSIILSDALPMEYQGMAGSL 478
           + IL FG   L FPA + I + A   E   +  SL
Sbjct: 443 RCILGFGNGFLKFPARASIQASAYSHEMMAVMTSL 477

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 54/263 (20%), Positives = 106/263 (40%), Gaps = 26/263 (9%)

Query: 18  QKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAE----KFSDNNTPWQNPS 73
            +QEKV++  +++    +   S    +   ++      +P  +    K + N     +P 
Sbjct: 9   NEQEKVDITPRSSDGYTHKVRSYHNDDDDESVINISDINPKNQLCQTKSNQNEPDIASPP 68

Query: 74  YFSSRW---KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLV 130
           Y  SR+   ++ + ++ C  +   +          ++VI + FN         +  + + 
Sbjct: 69  Y--SRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIF 126

Query: 131 SGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTF--FIICRAFQGLGI 188
            G    + G + D  G +  ++  ++V       C     + S T+   I+ R  Q  GI
Sbjct: 127 QGIAPSIMGGLADSMGRRPVVLSSVLVYC-----CACIGLACSHTYAQIIVLRCLQAAGI 181

Query: 189 AFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFW-AGLIATKAEKQWPW-- 245
           + V+    G++G+I       +   +  +      G+AFGA   AGL AT     W W  
Sbjct: 182 SPVIAINSGIMGDI--TTRAERGGYVGYVSGFQVIGSAFGALIGAGLSAT-----WSWRS 234

Query: 246 IFYAYAFAGILNLVLAIYSIPDT 268
           IF+  A    + LV +I  +P+T
Sbjct: 235 IFWFLAIGSGVCLVASIIILPET 257

>AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL217W (JEN1)
          Length = 500

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 51/111 (45%), Gaps = 3/111 (2%)

Query: 78  RWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILV 137
           + K +LFI +  L+  +        +  +  I    N    + TW +    +      +V
Sbjct: 40  KLKTWLFIASAFLALTVEATDFYLVSLNVVSIAQDLNVREDTVTWGITVALMTRTIGAIV 99

Query: 138 SGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGI 188
            G IGD +G + + +  + ++ +  L+ GFA   +S  +F+ CRA+ G+ +
Sbjct: 100 YGYIGDRFGQRTSFLINVGMISVLQLVTGFA---TSFPYFLACRAYFGIEL 147

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 58/137 (42%), Gaps = 12/137 (8%)

Query: 32  NTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLS 91
           N   YDS    +  T+     E +S +A+    NNT              YL I    L 
Sbjct: 90  NASGYDSIKKNTVATAKTIDLETSSIEAK----NNTGLSPARIKIIMGSMYLGIFLASLD 145

Query: 92  NLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTM 151
           N       T  ++ +  I S FN +    +W+  ++ L S +F  + G+I DI+G K  +
Sbjct: 146 N-------TIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLL 197

Query: 152 IGGLIVMIIWSLICGFA 168
           I   ++  +  LICG +
Sbjct: 198 IFSNVMFALGCLICGLS 214

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 69/160 (43%), Gaps = 18/160 (11%)

Query: 328 EIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSF-GIWTFYYY-----AFLLNLRGYTPL 381
           E   +K P+LP A   N  I   L +    W S  G+ T  Y+     A +LN++   P 
Sbjct: 382 ETYVSKDPILPVAFLKNRTI---LGSSLANWFSMMGMMTTSYFLPVYWAGVLNMK---PT 435

Query: 382 EAGASHCMFILWGTIAAFTVAFTIKRVGPS---VLLFCSMVAFTVGSIMLSITPVHQTYW 438
           + G           + +    + +K+ G     ++ FC++    VG + +S+   +   W
Sbjct: 436 DMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALA--VVGQLQISLIEPNIAVW 493

Query: 439 KMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSL 478
           +  + + +I  FG+ +    + + +  A+P E+Q    S+
Sbjct: 494 RQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSI 532

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 84/200 (42%), Gaps = 16/200 (8%)

Query: 53  EGTSPDA---EKFSDNNTPWQNPSYFSSRWKEYLFILTCMLS-NLLNQAGQTQATSTMNV 108
           E + PD    E+ S+ + P+   +Y   +W    F++  + S    +  G       +  
Sbjct: 54  EESFPDGSKQEQLSEEDVPYTLLTY-RQKW----FMVALLTSAGFWSSLGSPIYYPALKE 108

Query: 109 IGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFA 168
           + + F+ +       +  + L  G    +SG + D+YG +  ++ G+++ +I S+    +
Sbjct: 109 LEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVIASIGLACS 168

Query: 169 NYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFG 228
               +V F    R  Q  GI+ ++    G+ G+ + V S R   V +  G     G AFG
Sbjct: 169 KSYGAVVFL---RCLQSAGISPIIAINSGVAGD-FTVKSERGTFVGAVSGFTL-MGQAFG 223

Query: 229 AFWAGLIATKAEKQWPWIFY 248
           +      A  A   W  IF+
Sbjct: 224 SLIGA--ALTAAYDWRAIFW 241

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 103 TSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWS 162
           ++++ VI   FN D S   W+++ + L      L+ GR   I+G K +++  +++    S
Sbjct: 62  SASIEVISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGS 120

Query: 163 LICGFANYSSSVTFFIICRAFQGLG------IAFVLPNVMGLVGNIYKVGSLRKNIVISC 216
           LI   +N   S+   I  R   G+G      + FV+ + +             + + IS 
Sbjct: 121 LISAVSN---SMNVLIGGRVVAGIGGSGIQSLCFVIASTL--------TTERSRGVAISV 169

Query: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFY 248
           +       A  G F  G   T     W W FY
Sbjct: 170 LSCAYAVAAVAGPFMGGAFTTHV--TWRWCFY 199

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 45/114 (39%), Gaps = 3/114 (2%)

Query: 159 IIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIG 218
           I W L+      S+SV    I R F G+  A      M L G+ +K G + +      +G
Sbjct: 160 ICWGLLTIGTGKSTSVRQIKILRFFTGVFEAPSYIAYMYLFGSFFKSGEVARRSGFMIVG 219

Query: 219 MCA---PTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTV 269
             A    TGA   A +  L  +     W W F       I+  +L  YS+P  +
Sbjct: 220 QYAGLMSTGAMQSAIFGALNTSHGLSGWRWYFIIVGAISIVVALLGFYSLPGDI 273

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 107/256 (41%), Gaps = 20/256 (7%)

Query: 18  QKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFS----DNNTPWQNPS 73
            +Q + N ++  + +    D     +EK+ +        PD E  +    D + P   P 
Sbjct: 116 DRQSQTNASISGSNS--ESDEYQKETEKSGSSGEENDLDPDIEFVTFVTNDPDNPHNWPL 173

Query: 74  YFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGS 133
           +   RW  Y  IL+ ++  +    G    T  + ++   F+  S     L  S  ++  S
Sbjct: 174 WL--RWV-YTVILSILV--ICVAYGSACITGGLGLVSEKFHVGSEVAI-LSVSLMVLGFS 227

Query: 134 F-ILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVL 192
           F  L+   + D++G +      + + +I+++ C     S +V   +ICR F G+  +  L
Sbjct: 228 FGPLLWSPVSDLFGRRVAYFVSMGLYVIFNIPCAV---SKNVQTLMICRFFCGVWSSSGL 284

Query: 193 PNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAF 252
             V G + +++   S  +   I+        G  FG    G I+    +     +   AF
Sbjct: 285 CLVGGSIADMFP--SETRGRAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLIFWVNMAF 342

Query: 253 AGILNLVLAIYSIPDT 268
           AG++ LV+A+  IP+T
Sbjct: 343 AGVMWLVVAL--IPET 356

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 115 ADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSV 174
            D +   W++  + L +  F L+ GR+  + G + ++I  +I+    SLI   A    S+
Sbjct: 76  GDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAK---SM 132

Query: 175 TFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGL 234
              I  R   G+G + +    + LV     V    + +V+S +       +  G F  G 
Sbjct: 133 NMLISGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGA 190

Query: 235 IATKAEKQWPWIFY 248
             T     W W FY
Sbjct: 191 FTTHVT--WRWCFY 202

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 9/127 (7%)

Query: 143 DIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNI 202
           DIYG +      L + +I+++ C     S +++  +ICR   G+  +  L  V G + ++
Sbjct: 197 DIYGRRAAYFVSLGLYVIFNIPCAI---SPNISGHMICRFLCGVYASSGLCLVGGSIADM 253

Query: 203 YKVGSLRKNIVISCIGMCAP-TGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLA 261
           +   +  K I        AP  G  FG    G ++    +    I++  AFAG++ L++A
Sbjct: 254 FPAETRGKAIAFFAF---APYCGPVFGPLVNGFVSVSTGRMDYIIWFNMAFAGVMWLLVA 310

Query: 262 IYSIPDT 268
           +  IP+T
Sbjct: 311 L--IPET 315

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 61/306 (19%), Positives = 119/306 (38%), Gaps = 33/306 (10%)

Query: 6   SSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISV----FEGTSPDAEK 61
           S  +SI S S  Q    +    +  ++ LN+D +    E+ +   V     +G+S ++ +
Sbjct: 5   SYQSSILSESDAQSANHL----EKEVHQLNHDGNKHKYEQDAPSRVTTHEMKGSSSESIE 60

Query: 62  FSD---NNTP--WQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNAD 116
             D   +N P     P    S  +++  +     +   +  G       +  +   F+  
Sbjct: 61  GHDIAHDNAPLPQHAPYTLLSNAQKWCMVALLTSAGFWSSLGSPIYYPALKQLEKQFSVS 120

Query: 117 SSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTF 176
                  +  + +  G    +SG + D+YG +  ++ G+++ +  S+    +N    + F
Sbjct: 121 EELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVF 180

Query: 177 FIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIA 236
               R  Q  GI+ ++    G+VG+ + V   R   V +  G     G AFG+      A
Sbjct: 181 L---RCLQSAGISPIIAINSGVVGD-FTVKQERGTFVGAVSGFTL-MGQAFGSLIGA--A 233

Query: 237 TKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFV 296
             A   W  IF+         +++    +P+T              S+VG + +   +FV
Sbjct: 234 LTAAFDWRAIFWFLTIGCGTCMLVNFLLLPET------------KRSIVGNMSIKPKSFV 281

Query: 297 WNEAPI 302
            N API
Sbjct: 282 -NRAPI 286

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 56/131 (42%), Gaps = 11/131 (8%)

Query: 57  PDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNAD 116
           PD      N  P ++ ++          +    + + L     T  T+ +  I S  +A 
Sbjct: 16  PDQAAHDKNVEPLRDVNWI---------VFALFVGSYLAALDTTIVTTLLPTIASELDA- 65

Query: 117 SSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTF 176
           S+  +W+  S+ L   +F  + G++ D++G K  +I   +      ++CG A ++ S+  
Sbjct: 66  SNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWM 124

Query: 177 FIICRAFQGLG 187
             I R   G+G
Sbjct: 125 LCIGRFIAGVG 135

>KLTH0F17798g Chr6 (1437309..1440704) [3396 bp, 1131 aa] {ON}
           similar to uniprot|P36161 Saccharomyces cerevisiae
           YKR082W NUP133 Subunit of the Nup84p subcomplex of the
           nuclear pore complex (NPC) localizes to both sides of
           the NPC required to establish a normal nucleocytoplasmic
           concentration gradient of the GTPase Gsp1p
          Length = 1131

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 429 SITPVHQTYWKMTFGM--QIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYS 486
           +++ V   + K++  +  QI+ +      F  SS++L D+ P++ +G A  ++++I NY 
Sbjct: 277 NLSAVSNCHRKISINLYDQILESLQDLYPFAHSSLLLLDSHPLDTEGSAHMVLSSITNYD 336

Query: 487 TSLCLGMGTTAEIQVNKNGTDLLKGYR 513
            + C  + TT +I  + N   +   YR
Sbjct: 337 GA-CYYILTTIKIDESTNSFAIFSTYR 362

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 102/264 (38%), Gaps = 29/264 (10%)

Query: 17  EQKQEKVNVA----------VKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNN 66
           ++K EKVN             KAT   +  D  +  S  +  +   +G S   +  ++  
Sbjct: 32  DEKSEKVNFEGAYTNSHGTLSKATTREIEGDLESETSSHSGDV---KGDS-TQQITTEIG 87

Query: 67  TPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMAS 126
            P+   SY   +W     +  C      +  G       +  +   FN D +     +  
Sbjct: 88  APYTLLSY-GQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVV 143

Query: 127 FPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGL 186
           + L  G    VSG + D +G +  ++ G+++ ++ S+  G A  + S    I  R  Q +
Sbjct: 144 YLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASI--GLAC-APSYGVIIFLRCIQSI 200

Query: 187 GIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPW- 245
           GI+  +    G+VG+ + +   R   V +  G     G  FG+    LI      +W W 
Sbjct: 201 GISPTIAISSGVVGD-FTLKHERGTFVGATSGFVL-LGQCFGS----LIGAVLTARWDWR 254

Query: 246 -IFYAYAFAGILNLVLAIYSIPDT 268
            IF+          ++A   +P+T
Sbjct: 255 SIFWFLTIGCGSCFLIAFLILPET 278

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

Query: 136 LVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNV 195
           L+   + DIYG +      + + +I+++ C  A    ++   +ICR F G+  +  L  V
Sbjct: 223 LIWSPVSDIYGRRVAYFVSMFLYVIFNIPCAVAKNPQTL---MICRFFCGVWASSGLCLV 279

Query: 196 MGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGI 255
            G + +++   +  +   I+        G  FG    G I+    +     +   AFAG+
Sbjct: 280 GGSIADMFPNDT--RGRAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLIFWVNMAFAGV 337

Query: 256 LNLVLAIYSIPDT 268
           + +++A+  IP+T
Sbjct: 338 MWIIVAL--IPET 348

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 417 SMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAG 476
           S V F +G+I+ + T   +++W+M  G ++++ FG+ +    S + +S+  P EY+G   
Sbjct: 154 SNVMFLIGAILQACT---RSFWQMAAG-RLLMGFGIGIGSLLSPLFISEIAPSEYRGRL- 208

Query: 477 SLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYR 513
               T+VN   S C+  G      +    + +  G+R
Sbjct: 209 ----TVVN---SACITGGQLIAYGIGAGTSKIDNGWR 238

>ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 529

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 90/220 (40%), Gaps = 15/220 (6%)

Query: 53  EGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSA 112
           E   P   +F+    P ++P  +S+  K ++ +   M+   +   G +  T   ++I   
Sbjct: 58  EDVDPFLVEFNGPTDP-EHPHNWSTI-KRFVVVFNVMVLTCVTYMGTSFYTPGQDLIEKE 115

Query: 113 FNADSSSKTWLMASFPLVSGSFILVSGRIGDI--YGLKRTMIGGLIVMIIWSLICGFANY 170
           F+      T  ++ + L  G   LV G + +   +G +R  I  L +  +  + C     
Sbjct: 116 FHVGHVVGTLNLSLYILGFGLGPLVFGPLSEFVAFGRQRLFIVTLFLFAMLQIGCALVK- 174

Query: 171 SSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCA--PTGAAFG 228
             ++   +I R   G+  +  L N    VG++ +   +   + +  IG  A   TG   G
Sbjct: 175 --NIAGLVILRFLSGIFCSPSLANGAAAVGDVVRPRHIPVVLGLWAIGALAGPSTGPLLG 232

Query: 229 AFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
           A      +    K W ++F+   +     L+L ++S P+T
Sbjct: 233 A------SMVVAKNWRYMFWLLMWISSATLLLMVFSYPET 266

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 67/163 (41%), Gaps = 12/163 (7%)

Query: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166
           NV  +  NA  S    + A  PL  G F  V GR       K   I  +++M+I +++  
Sbjct: 100 NVSSTVINATVSVFMAVFAVGPLFWGLFADVGGR-------KVLYICSILLMVIVNIL-- 150

Query: 167 FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAA 226
            A+  + ++   + R  Q  G + V+    G V +I       + I    IG     G  
Sbjct: 151 LASIPAHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMIG--PNMGPV 208

Query: 227 FGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTV 269
                AGLI  K    W W+F      G + L+L +  +P+T+
Sbjct: 209 LAPIIAGLILMKGN-YWRWLFGLTGIMGGVGLLLIVAFLPETL 250

>KAFR0D05140 Chr4 (1010805..1012529) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 102/272 (37%), Gaps = 32/272 (11%)

Query: 20  QEKVNVAVKATINTLN--------YDSSTSVSEKTSAISVFEGTSP--------DAEKFS 63
           +EK+  AV+    ++N        +D + S  EKT   S+ E   P        + +   
Sbjct: 59  EEKLPDAVEVERLSINESKNIFSKHDITNSDVEKTEDGSIAESEDPFDPFFVQWNGDDDP 118

Query: 64  DNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWL 123
           DN   W N       +K+ L ++  ML   +   G +  +   + I   F       T  
Sbjct: 119 DNPQNWSN-------FKKVLIMIEIMLLTCITYMGASIYSIGQSSIQETFGVGQVVATLN 171

Query: 124 MASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAF 183
           ++ + L  G   ++     ++  + R +I  L   +      G A    ++   I+ R  
Sbjct: 172 LSLYALGYGIGPVIFSPFSEVAMVGRQVIYTLTFFVFTMFQIGAAT-VQNIGGLIVLRFL 230

Query: 184 QGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMC-APT-GAAFGAFWAGLIATKAEK 241
            G+  +  L      VG+I    +L   + I  +G   AP  G   GA      +    K
Sbjct: 231 TGIVCSPALATGGATVGDIITPKNLPLCLSIWDLGPTFAPIIGPLLGA------SMMVAK 284

Query: 242 QWPWIFYAYAFAGILNLVLAIYSIPDTVPVNV 273
            W WIF+   +     L+  I+  P+T P N+
Sbjct: 285 NWRWIFWFMTWISGFTLITMIFLFPETSPDNI 316

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 100 TQATSTMNVIGSAFNA-DSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVM 158
           T  ++ +  IGS FN+ D +S  W+  S+ L S +   + G++ D  G K  ++    V 
Sbjct: 104 TIVSTLLTHIGSEFNSLDKAS--WIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161

Query: 159 IIWSLICGFAN 169
            I  LICG +N
Sbjct: 162 AIGCLICGLSN 172

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 101/253 (39%), Gaps = 25/253 (9%)

Query: 21  EKVNVAVKATINTLNYDSSTSVS--EKTS-AISVFEGTSPDAEKFSDNNTPWQNPSYFSS 77
           E +++    + N ++ +S +++S  E+T   +S  E   PD E  +  + P     Y SS
Sbjct: 3   ESISMKDSDSCNQIDAESKSALSANEQTEFEVSFSEDGDPDPENIA-RHLPLVRKYYISS 61

Query: 78  RWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILV 137
                L  LT  +  +++      + + M     +    +   T  +  F L  G   L 
Sbjct: 62  -----LITLTSTVITIISSCWSLASPNIMKHFHISHEVSTLGITLYI--FGLGFGPLFL- 113

Query: 138 SGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMG 197
              I ++YG + T +  L + IIW  +     +S ++   +  R   G   +  L    G
Sbjct: 114 -SPISELYGRRITFVSSLFLSIIWQCL---TTWSKTIEGVLFGRFLSGFFGSVFLSVAGG 169

Query: 198 LVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKA--EKQWPWIFYAYAFAGI 255
            + +I+     +K I I    M   T AAF     G I + A     + W F     A  
Sbjct: 170 AISDIFS----KKQIGIP---MAIYTTAAFLGPSLGPIISGALYHANYKWTFVTLLIASG 222

Query: 256 LNLVLAIYSIPDT 268
           + L L + S+P+T
Sbjct: 223 VCLTLIVISVPET 235

>ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conserved
           hypothetical protein
          Length = 682

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 136 LVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFV 191
           LV+ R+G+  G +RT+  G +V II  L   FA     + + I  R   G+G+  +
Sbjct: 166 LVTSRLGEKLGRRRTIKYGSLVFIIGGLFQAFA---GGIGYLIAGRLISGVGVGLL 218

>SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]
           {ON} similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 730

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 136 LVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFV 191
           L+ GR+G+ +G +RT+  G ++ +    I  FA   S ++  II R   GLG+  +
Sbjct: 177 LMVGRLGEKWGRRRTIKYGSLIFVFGGAIQTFA---SRMSDLIIGRIVSGLGVGLL 229

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 91/242 (37%), Gaps = 20/242 (8%)

Query: 34  LNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSY--FSSRWKEYLFILTCMLS 91
           L   +S  +        V E  S  +    +N    Q P Y  F    K  L +L C  +
Sbjct: 30  LEQHASNEIQCTDDNQKVIEQISKPSSANPNNEKTCQEPPYSRFGKSEKSILAVL-CASA 88

Query: 92  NLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTM 151
            L +          + +I   FN         +  + ++ G   ++ G + D  G +  +
Sbjct: 89  GLFSTISAPIYYPALTIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIV 148

Query: 152 IGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKN 211
           +  + +  +  +    A     V F    R  Q  GI+ V+    G++G+I       K 
Sbjct: 149 LCSIALYAVACIGLASAQNYGEVLFL---RCLQSAGISPVVAVNNGIIGDITT-----KA 200

Query: 212 IVISCIGMCAPT---GAAFGAFWAGLIATKAEKQWPW--IFYAYAFAGILNLVLAIYSIP 266
                +G+ A T   G+AFGA    LI      +W W  IF+  A     +L +A + +P
Sbjct: 201 ERGGYLGLMAGTQVIGSAFGA----LIGAGITARWGWRAIFWFLAIGSGFSLAVASFLLP 256

Query: 267 DT 268
           +T
Sbjct: 257 ET 258

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 81/212 (38%), Gaps = 25/212 (11%)

Query: 66  NTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMA 125
           NT    P     R ++ L I+ C  +   +          + VI   FN         + 
Sbjct: 84  NTTDSPPYSRFGRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKFNITEELVNITVV 143

Query: 126 SFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQG 185
            + +  G      G + D  G +R ++  L  ++++   C     S + T  ++ R  Q 
Sbjct: 144 VYFIFQGLAPSFMGGLADSLG-RRPVV--LFSILVYCCACIGLALSQNYTQIVVLRCLQA 200

Query: 186 LGIAFVLPNVMGLVGNIYK-------VGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATK 238
            GI+ V+    G+ G+I         VG +   IVI         G+AFGA    LI   
Sbjct: 201 AGISPVIAINSGICGDITTRAERGAYVGYVSGFIVI---------GSAFGA----LIGAG 247

Query: 239 AEKQWPW--IFYAYAFAGILNLVLAIYSIPDT 268
               W W  IF+       + L+++I  +P+T
Sbjct: 248 LSSTWGWRSIFWFLTIGSGICLMISIIVLPET 279

>KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease ureidosuccinate permease
           expression is constitutive but sensitive to nitrogen
           catabolite repression
          Length = 551

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 50/115 (43%), Gaps = 4/115 (3%)

Query: 158 MIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS--LRKNIVIS 215
           +I W L+    +   S   FI+ R   G+  + + P ++  +   YK      R +I+I+
Sbjct: 178 IIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQWYKKDEQFFRTSILIA 237

Query: 216 CIGMCAPTGA--AFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDT 268
           C  +    GA  ++  +   L  T +   W  +F       I+  ++ ++ IPDT
Sbjct: 238 CNAVGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVTGLMVLFIIPDT 292

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 80  KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSG 139
           K  + +L  ++ + L+    T   + +  I S  +A SS  +W+  ++ L   +F  + G
Sbjct: 39  KVRITVLALLMGSFLSALDTTIVATLLPTIASDLDA-SSQMSWIATAYLLSCSAFQPLYG 97

Query: 140 RIGDIYGLKRTMIGGLIVMIIWSLICG 166
           ++ DI+G K  +I   +   +   ICG
Sbjct: 98  KLSDIFGRKILLILSNLTFALGCAICG 124

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 7/134 (5%)

Query: 115 ADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSV 174
            D +   W++  + L +  F L+ GRI    G + +++  +++    SLI   A    S+
Sbjct: 75  GDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLISALAR---SM 131

Query: 175 TFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGL 234
              I  R   G+G + +    + LV     V    + +V+S +       +  G F  G 
Sbjct: 132 NMLIAGRVVSGVGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGA 189

Query: 235 IATKAEKQWPWIFY 248
             T     W W FY
Sbjct: 190 FTTHV--TWRWCFY 201

>AGL277W Chr7 (185070..187085) [2016 bp, 671 aa] {ON} NOHBY715; No
           homolog in Saccharomyces cerevisiae
          Length = 671

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 11/49 (22%), Positives = 25/49 (51%)

Query: 426 IMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGM 474
           ++  + P     W+  F M+ +L FG+ +     ++ L++  P E +G+
Sbjct: 240 LLQGVGPAGPAGWRYLFAMRFLLGFGLGIKSATVNVYLAECAPKELRGI 288

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,740,253
Number of extensions: 1969248
Number of successful extensions: 8185
Number of sequences better than 10.0: 258
Number of HSP's gapped: 8317
Number of HSP's successfully gapped: 276
Length of query: 555
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 440
Effective length of database: 40,294,809
Effective search space: 17729715960
Effective search space used: 17729715960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)