Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039208.840ON62462432930.0
SAKL0D01474g8.840ON62462219500.0
YMR278W (PGM3)8.840ON62262219370.0
Smik_13.4918.840ON62261819370.0
Suva_13.4668.840ON62261619150.0
CAGL0M02981g8.840ON61761619140.0
NCAS0C004108.840ON62561419120.0
NDAI0K004108.840ON62662519060.0
TDEL0B005708.840ON63061419050.0
Skud_13.4508.840ON62261418770.0
KNAG0J002708.840ON62562018570.0
TPHA0I002508.840ON62962518290.0
ZYRO0G14190g8.840ON61061417940.0
Ecym_46118.840ON63062617820.0
KLTH0C03872g8.840ON62163217800.0
Kpol_1068.88.840ON63263217780.0
Kwal_27.102588.840ON62062217760.0
TBLA0B032508.840ON64364417580.0
ABL126W8.840ON62462117370.0
KLLA0D01573g8.840ON60761916900.0
TDEL0A022102.445ON5722991305e-07
ZYRO0G02508g2.445ON5692941296e-07
TDEL0E00210singletonON5703021208e-06
Skud_13.2632.445ON5693001208e-06
Smik_13.2912.445ON5692961172e-05
Kpol_1033.542.445ON5701281153e-05
YMR105C (PGM2)2.445ON5693001144e-05
Kwal_26.76282.445ON5701031144e-05
KNAG0A062802.445ON5702961128e-05
CAGL0K03421g2.445ON5682951118e-05
KNAG0E023902.445ON5693001092e-04
Suva_13.2822.445ON5692761063e-04
NCAS0F014702.445ON5692911055e-04
Kpol_1018.1612.445ON5694171030.001
KLTH0D04796g2.445ON5701271020.001
TBLA0B090102.445ON5692971000.002
KLLA0B12694g2.445ON568296980.003
ABL029W2.445ON568299980.003
Ecym_24752.445ON567291980.003
CAGL0K07480g2.445ON567296970.005
NDAI0K028906.11ON56175960.005
SAKL0E03630g2.445ON571292960.006
TBLA0I013802.445ON571134950.008
NDAI0H023502.445ON569299930.011
KAFR0D030102.445ON569131930.014
NCAS0A043502.445ON569296920.015
Skud_11.1022.445ON570309920.016
Kpol_1032.26.11ON53928920.019
Suva_11.982.445ON570128890.043
CAGL0J11220g2.76ON247137870.045
Smik_11.1122.445ON570299880.050
TDEL0G046006.11ON52827880.053
CAGL0B03597g6.11ON54027870.065
ACR015W6.11ON55247870.065
KAFR0L003406.11ON54027860.091
TBLA0G009806.11ON55828850.12
YEL058W (PCM1)6.11ON55768840.13
Smik_5.296.11ON55568840.15
YKL127W (PGM1)2.445ON570297840.15
TPHA0G029002.445ON569166840.17
Skud_5.316.11ON55727830.22
Suva_5.106.11ON55327820.25
KLLA0D00858g6.11ON54118820.27
NCAS0F002006.11ON54927810.34
Kwal_56.223556.11ON54123810.39
KLTH0C11506g6.11ON54418800.46
Ecym_40355.685ON24597780.48
KNAG0E009406.11ON53818790.61
ZYRO0F00506g6.11ON55023790.67
SAKL0E00902g6.11ON54418780.75
TPHA0G024702.445ON569128761.2
ADR225W5.685ON236134741.7
TPHA0J015305.685ON24568732.3
TPHA0M002106.11ON54599742.5
Kpol_1030.325.685ON24296713.4
TDEL0B023805.685ON240176713.4
Ecym_30146.11ON55118724.0
SAKL0D04026g3.246ON38992724.2
NDAI0A030607.286ON507114715.0
CAGL0K05533g5.685ON24197689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03920
         (624 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...  1273   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   755   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   750   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   750   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   742   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   741   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   741   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   738   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   738   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   727   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   719   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   709   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   695   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   691   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   690   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   689   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   688   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   681   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   673   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   655   0.0  
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    55   5e-07
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    54   6e-07
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    51   8e-06
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    51   8e-06
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    50   2e-05
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    49   3e-05
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    49   4e-05
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    49   4e-05
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               48   8e-05
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    47   8e-05
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    47   2e-04
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    45   3e-04
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    45   5e-04
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    44   0.001
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    44   0.001
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    43   0.002
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    42   0.003
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    42   0.003
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    42   0.003
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    42   0.005
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    42   0.005
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    42   0.006
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    41   0.008
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    40   0.011
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    40   0.014
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    40   0.015
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    40   0.016
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    40   0.019
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    39   0.043
CAGL0J11220g Chr10 complement(1092254..1092997) [744 bp, 247 aa]...    38   0.045
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    39   0.050
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.053
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    38   0.065
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    38   0.065
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    38   0.091
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    37   0.12 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    37   0.13 
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    37   0.15 
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    37   0.15 
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               37   0.17 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.22 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    36   0.25 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.27 
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    36   0.34 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.39 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    35   0.46 
Ecym_4035 Chr4 complement(80853..81590) [738 bp, 245 aa] {ON} si...    35   0.48 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    35   0.61 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    35   0.67 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    35   0.75 
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    34   1.2  
ADR225W Chr4 (1097826..1098536) [711 bp, 236 aa] {ON} Syntenic h...    33   1.7  
TPHA0J01530 Chr10 (350766..351503) [738 bp, 245 aa] {ON} Anc_5.6...    33   2.3  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    33   2.5  
Kpol_1030.32 s1030 complement(66758..67486) [729 bp, 242 aa] {ON...    32   3.4  
TDEL0B02380 Chr2 complement(432420..433142) [723 bp, 240 aa] {ON...    32   3.4  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    32   4.0  
SAKL0D04026g Chr4 (326569..327738) [1170 bp, 389 aa] {ON} highly...    32   4.2  
NDAI0A03060 Chr1 (685219..686742) [1524 bp, 507 aa] {ON} Anc_7.2...    32   5.0  
CAGL0K05533g Chr11 (542446..543171) [726 bp, 241 aa] {ON} simila...    31   9.8  

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 1273 bits (3293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/624 (97%), Positives = 610/624 (97%)

Query: 1   MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP 60
           MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP
Sbjct: 1   MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP 60

Query: 61  FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADIT 120
           FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADIT
Sbjct: 61  FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADIT 120

Query: 121 VATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNG 180
           VATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNG
Sbjct: 121 VATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNG 180

Query: 181 CQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYV 240
           CQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYV
Sbjct: 181 CQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYV 240

Query: 241 FTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTV 300
           FTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTV
Sbjct: 241 FTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTV 300

Query: 301 SFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLF 360
           SFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLF
Sbjct: 301 SFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLF 360

Query: 361 AIFKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQ 420
           AIFKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQ
Sbjct: 361 AIFKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQ 420

Query: 421 QGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYG 480
           QGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYG
Sbjct: 421 QGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYG 480

Query: 481 VFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTI 540
           VFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTI
Sbjct: 481 VFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTI 540

Query: 541 DFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXX 600
           DFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIES           
Sbjct: 541 DFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANL 600

Query: 601 XXXTWNVLRREWFRPEITGLKTSF 624
              TWNVLRREWFRPEITGLKTSF
Sbjct: 601 AHLTWNVLRREWFRPEITGLKTSF 624

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/622 (60%), Positives = 455/622 (73%), Gaps = 17/622 (2%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           VP+ LK S + WL YD+N ETRSE+L ++  K W+EL  RL+ RI FGTAGLR RMEAGF
Sbjct: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
           +RMN+L +LQ SQGLA YI  +FP+NLSV+VGHDHRYHS EFA +TV  FL  GFKV+YL
Sbjct: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127

Query: 135 NTENE-----FVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDK 189
           N  ++     FVHTP+VP+++++L ++ G+MITASHNPK DNGYKVYYSNGCQIIPPHD+
Sbjct: 128 NLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 190 NIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLK 249
            I+ TI++NL PW+K W+  ++  T   +G L     K+   Y++ ++  +     PML 
Sbjct: 188 LISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR--VPMLD 245

Query: 250 TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKG 309
             KPWFVYTPMHGVG +IF QIA   LGL E   Y  VPEQ  PDP+FPTVSFPNPEEKG
Sbjct: 246 CDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKG 305

Query: 310 ALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK 369
           ALD++I LAE + + L+IANDPDADRFS AVK+     W QL+GNEIG LFA ++ Q+++
Sbjct: 306 ALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQDYQ 363

Query: 370 EKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426
           +   S K   PLAM+NSTVSSQM+K +A+ E FHYE+TLTGFKW+GNRA +LE QGY V 
Sbjct: 364 KLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVP 423

Query: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486
           F YEEAIGYMFP +EHDKDGI A+VVFL MY +WL  + + PL VLD  F KYGVF EYN
Sbjct: 424 FAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYN 483

Query: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546
           GYY V   +L + VF YIR++Y P    YP  +G EF + SFRDLT GYQSDTID  P L
Sbjct: 484 GYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNL 543

Query: 547 PVDASSQMITATLKP----ERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXX 602
           PVDASSQMITATL+P    E T G E++RFTIRGSGTEPKLKVYIE+             
Sbjct: 544 PVDASSQMITATLRPSNGKESTSG-EQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLAR 602

Query: 603 XTWNVLRREWFRPEITGLKTSF 624
            TW VLRREWFRPE TGL+T F
Sbjct: 603 ETWQVLRREWFRPERTGLETKF 624

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/622 (58%), Positives = 447/622 (71%), Gaps = 4/622 (0%)

Query: 7   ILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGL 66
           +L  I E VP  LK     W + D+N +T  E+  +  + DW EL  R + RI FGTAGL
Sbjct: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60

Query: 67  RGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLN 126
           R +M+AGF+RMN+LV++Q SQGLA Y+ ++FP NL  VVGHDHR+HSKEFA  T A FL 
Sbjct: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120

Query: 127 AGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPP 186
            GFKV YLN ++EFVHTPLVP++VDKL+++ GVMITASHNPK DNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 187 HDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITR-YVFTNGS 245
           HD  I+ +I+ NL PW+  W++ D+ +   + G L ++  +M   Y++++++  V  N  
Sbjct: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240

Query: 246 PMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNP 305
            +    KPWFVYTPMHGVG  IF  I K+ L L E  DY  VPEQ  PDPSFPTV FPNP
Sbjct: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 306 EEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKL 365
           EEKGALD+ I LAE+  + L++ANDPDADRFS AVKD +S EWRQL+GNEIG LFA ++ 
Sbjct: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360

Query: 366 QEHK---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQG 422
           Q++K   ++     PLAMLNSTVSSQM+KKMA++EGFHYE+TLTGFKWIGNRA+ LE++G
Sbjct: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420

Query: 423 YDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVF 482
           Y V FG+EEAIGYMFP MEHDKDGI AS+VFL  Y KW     L PL+VL+  F+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480

Query: 483 SEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDF 542
            EYNGYY V  P + + +F YIR+ Y P+   YP  +G E  +  +RDLT GYQSDTI+ 
Sbjct: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540

Query: 543 KPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXX 602
           KPTLPVD +SQMIT + +P     +E IRFTIRGSGTEPKLKVYIE+             
Sbjct: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600

Query: 603 XTWNVLRREWFRPEITGLKTSF 624
            TWNVLRREWFRP+   + T F
Sbjct: 601 LTWNVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/618 (58%), Positives = 443/618 (71%), Gaps = 8/618 (1%)

Query: 13  EYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEA 72
           E VP  LK +   W   DQN ET  E+  +  + DW EL  R + RI FGTAGLR +M+A
Sbjct: 7   EAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQA 66

Query: 73  GFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVF 132
           GF RMN+LVI+Q SQGLA Y  ++FP NL  VVGHDHR+HSKEFA  T   FL  GFKV 
Sbjct: 67  GFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVH 126

Query: 133 YLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIA 192
           YLN ++EFVHTPLVP++VDKL+++ GVM+TASHNPK DNGYKVYYSNGCQIIPPHD  I+
Sbjct: 127 YLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAIS 186

Query: 193 LTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLK--- 249
            +I+ NL PW+  WN+ D+ +   + G L ++  ++   Y+ ++++ +   G+  LK   
Sbjct: 187 DSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLV--GTDPLKFEV 244

Query: 250 TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKG 309
             KPWFVYTPMHGVG  IF  I K+ + L E  DY  VPEQ +PDPSFPTV+FPNPEEKG
Sbjct: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKG 304

Query: 310 ALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK 369
           ALD+ I LAE  G+ L+IANDPDADRFS A+KD RS EWRQL+GNEIG LFAIF+ Q+ K
Sbjct: 305 ALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFK 364

Query: 370 ---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426
              ++     PLAML+STVSSQM+KKMA+VEGFHYEETLTGFKWIGNRA+ LE++GY V 
Sbjct: 365 SMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVP 424

Query: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486
           FG+EEAIGYMFP MEHDKDG+ AS+VFL  Y +W     L P+ +L+  F+KYGVF EYN
Sbjct: 425 FGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYN 484

Query: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546
           GYY V  P +   +F YIR+ Y PK   YP  +G+E  + ++RDLT+GYQSDT + KPTL
Sbjct: 485 GYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTL 544

Query: 547 PVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWN 606
           P+D SSQMIT + KP      E IRFTIRGSGTEPK+KVYIE+              TWN
Sbjct: 545 PIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWN 604

Query: 607 VLRREWFRPEITGLKTSF 624
           VL+REWFRPE   + T F
Sbjct: 605 VLKREWFRPEKMDIVTHF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/616 (58%), Positives = 436/616 (70%), Gaps = 4/616 (0%)

Query: 13  EYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEA 72
           E VP  LK     W   D+N ET  E+ T+    DW EL  R + RI FGTAGLR  M+A
Sbjct: 7   ETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQA 66

Query: 73  GFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVF 132
           GF+RMN+LVI+Q +QGLA YI ++FP NL VVVGHDHR+HSKEFA  T   FL  GFKV 
Sbjct: 67  GFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVH 126

Query: 133 YLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIA 192
           YLN ++EFVHTPLVP++VDKL+++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD  I+
Sbjct: 127 YLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAIS 186

Query: 193 LTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITR-YVFTNGSPMLKTG 251
            +I+ NL PW+  W + D+ +   + G L ++  +M   Y +++++  V TN   +    
Sbjct: 187 DSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEIKA 246

Query: 252 KPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGAL 311
           KPWFVYTPMHGVG  IF  I K+ + L E  DY  VPEQ  PDPSFPTV FPNPEEKGAL
Sbjct: 247 KPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGAL 306

Query: 312 DMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK-- 369
           D+ ++LAE   + L++ANDPDADRFS AVKD +S +WRQL+GNEIG LFA F+ Q +K  
Sbjct: 307 DIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNK 366

Query: 370 -EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFG 428
            E+     PLAML+STVSSQM+KKMA+VEGF YE+TLTGFKWIGNRA+ LE++GY V FG
Sbjct: 367 DEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFG 426

Query: 429 YEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGY 488
           +EEAIGYMFP MEHDKDGI A+VV L  Y KW     L P+D+L+  F+KYGVF EYNGY
Sbjct: 427 FEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGY 486

Query: 489 YTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPV 548
           Y V  P +   +F YIR+ Y P   PYP  +G E  +  +RDLT GYQSDT D KP LPV
Sbjct: 487 YVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPV 546

Query: 549 DASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWNVL 608
           D +SQMIT + KP    G+E IRFTIRGSGTEPKLKVYIE+              TW+VL
Sbjct: 547 DPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVL 606

Query: 609 RREWFRPEITGLKTSF 624
           RR WFRPEI  + T F
Sbjct: 607 RRGWFRPEIMNITTDF 622

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/616 (56%), Positives = 437/616 (70%), Gaps = 10/616 (1%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           +P  L+ + + WL+ D+NEETR+E++ +   ++W EL  R + RI FGTAGLR RMEAG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
            R+N LVILQ SQGLA YI +KFPQNL+ VVGHDHRYHS+EFA +T ATF+ AGFKV+YL
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194
           N  +EFVHTP+VPYSVD L ++ GVMITASHNPK DNGYKVYY+NGCQIIPPHD  IA T
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTN--GSPMLKTGK 252
           I  NL PWS DWN+  + S  E +G +E+   +M  +Y+  +   +      +P     K
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAP---DEK 242

Query: 253 PWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALD 312
           PWFVYTPMHGVGH+IF  I  + L L +N+DY +VPEQ  PDPSF TVSFPNPEEKGAL+
Sbjct: 243 PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALN 302

Query: 313 MAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKL---QEHK 369
           +AI LAE  G+ L++ANDP+ADRFS AV+D   +EW+QL+GNEIG LFA ++    Q+  
Sbjct: 303 LAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAA 362

Query: 370 EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGY 429
           +K    KPLAMLNSTVS+Q++K+MA+ EGF Y++TLTGFKWIGN A +LE++GY V FGY
Sbjct: 363 DKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422

Query: 430 EEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYY 489
           EEAIGYMFP MEHDKDG+ A++VFL  Y+ WL+     P+D++  C++KYGV +EYNGYY
Sbjct: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQ-SSSNPIDIIHECYDKYGVSAEYNGYY 481

Query: 490 TVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVD 549
            V +P+  + VF  IR  Y      +PE +G  F +T FRDLT+G+ S T D KP LPVD
Sbjct: 482 IVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVD 541

Query: 550 ASSQMITATLKPERTVGH-EEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWNVL 608
            +SQMIT T  P       E +RFTIRGSGTEPKLKVYIE                W  L
Sbjct: 542 KNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETL 601

Query: 609 RREWFRPEITGLKTSF 624
           + EWF+P   GL T F
Sbjct: 602 KHEWFKPSSNGLSTDF 617

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/614 (58%), Positives = 447/614 (72%), Gaps = 5/614 (0%)

Query: 16  PERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGFT 75
           PE L+   + WLR DQNEETR E+L +   K+W EL  R + RI FGTAGLR RMEAGF+
Sbjct: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGFS 71

Query: 76  RMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYLN 135
           RMNSL+ILQ++QGLA YI E+FP NL+ VVGHDHR+HSKEFA +T + FL AGFKVFYL 
Sbjct: 72  RMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYLT 131

Query: 136 TENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTI 195
            +++FVHTPLVP+SV  L+++ GVMITASHNPK DNGYKVYY N CQIIPPHDKNIA  I
Sbjct: 132 PDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMI 191

Query: 196 EKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKTGK-PW 254
           +KNL PWS  W+W   F        L F  + M   Y+  + R +  +    LK  K P+
Sbjct: 192 QKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDVKTPF 251

Query: 255 FVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMA 314
           FVYTPMHGVG +IF +++ ++L L ENVDY  V EQ  PDPSFPTVSFPNPEEKGAL +A
Sbjct: 252 FVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLA 311

Query: 315 IQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHKEK-AA 373
           I+LA+  GL+L+IANDPDADRFSAAV +K++ +WRQL+GNEIG L   ++ Q ++++  A
Sbjct: 312 IKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVA 371

Query: 374 SRK--PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYEE 431
            RK  PLAM+NSTVSSQM+K+MA + GFHYE+TLTGFKWIGN+A+ L Q+GY V FG+EE
Sbjct: 372 FRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFGFEE 431

Query: 432 AIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYTV 491
           AIGYMFP ME DKDGI A+ VFL  Y  W+    + P D+++  F K+GVF EYNGYY +
Sbjct: 432 AIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGYYIL 491

Query: 492 EEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDAS 551
           ++ ++ ++VF +IR EY    + YP ++G E  +T FRDLT+GYQS+T D  P LPVD +
Sbjct: 492 KDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPT 551

Query: 552 SQMITATLKPERTVGHE-EIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWNVLRR 610
           SQMIT   KP      E  +R T+RGSGTEPKLKVYIE+              TW++L+R
Sbjct: 552 SQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDILKR 611

Query: 611 EWFRPEITGLKTSF 624
           EWFRPE+TGL TSF
Sbjct: 612 EWFRPEVTGLTTSF 625

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/625 (57%), Positives = 455/625 (72%), Gaps = 5/625 (0%)

Query: 5   SNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTA 64
           S+I S+I +  P  L+ + D WLR D+ EETR+E++ +    +W EL  R + RI FGTA
Sbjct: 2   SSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTA 61

Query: 65  GLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATF 124
           GLR RMEAGF+RMN LVILQ SQGLA+YI  +FP NL+ VVGHDHR+HSK+FA IT + F
Sbjct: 62  GLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVF 121

Query: 125 LNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQII 184
           L  GFKV+YLN E+ FVHTPLVP+SV+ L ++ GVMITASHNPK DNGYKVYYSNGCQII
Sbjct: 122 LRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQII 181

Query: 185 PPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNG 244
           PPHDKNIA TI++NL PWS DWNW   F    +   L +   +M   Y+Q +   + ++ 
Sbjct: 182 PPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSS 241

Query: 245 --SPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSF 302
              P     KPWFVYTPMHGVG+ IF +I+K +L   EN+DYF V EQ+ PDP+FPTVSF
Sbjct: 242 ISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSF 301

Query: 303 PNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAI 362
           PNPEEKGAL +A +LAE   ++L+IANDPDADRFS A K++++ +W+QLSGNEIG LFA 
Sbjct: 302 PNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFAS 361

Query: 363 FKLQEHKEKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLE 419
           F+L+++  +    +   PLAM+NSTVSSQM+KKMAQVE FHYE+TLTGFKWIGNRAL L+
Sbjct: 362 FELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQ 421

Query: 420 QQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKY 479
            QGY V FG+EEAIGYMFP M  DKDG+ A+VVFL  YS WL  +G  P D+L+  F+K+
Sbjct: 422 GQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKF 481

Query: 480 GVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDT 539
           G F EYNGYY  ++P   + +F ++R +Y     PYP+ +G+EF +  FRDLT GYQS+T
Sbjct: 482 GFFKEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNT 541

Query: 540 IDFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXX 599
           ID  P LPVD  S+MIT    P++ +G  ++RFT+RGSGTEPKLK+YIE+          
Sbjct: 542 IDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAID 601

Query: 600 XXXXTWNVLRREWFRPEITGLKTSF 624
                WNVL++EW RP++TGL T+F
Sbjct: 602 LAYEMWNVLKKEWIRPDVTGLTTTF 626

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/614 (58%), Positives = 445/614 (72%), Gaps = 4/614 (0%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           VP  L      WL  D N++TR EIL +   KDW EL  RL+ RI FGTAGLR RMEAGF
Sbjct: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
           +RMN+LV+LQ +QGLAQ+I ++FP  L+ VVGHDHR++S+EFA  TVATFL AGFKV +L
Sbjct: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136

Query: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194
           N  ++FVHTP+VP++V+++ ++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD  IA +
Sbjct: 137 NDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQS 196

Query: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGS-PMLKTGKP 253
           IE+NLT W K W W +L         L + G +M   Y + + + +    +    K GKP
Sbjct: 197 IEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKP 256

Query: 254 WFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDM 313
           WFVYTP+HGVG+ IF QIA++ + L    DY  V EQ  PDPSFPTV FPNPEEKGALDM
Sbjct: 257 WFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDM 316

Query: 314 AIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHKEKAA 373
           AI +A++ G++L++ANDPDADRFSAAVKD ++  WRQL+GNEIG+LFA ++ Q++++K  
Sbjct: 317 AISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKYQKKNE 376

Query: 374 SRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYE 430
             K   PLAMLNSTVSSQ++ KMA++E FHY +TLTGFKWIGNR L LE   Y V FG+E
Sbjct: 377 EYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFE 436

Query: 431 EAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYT 490
           EAIGYMFP MEHDKDGI A+ VFL MY KWL       L VL+  FEKYGVF EYNGYY+
Sbjct: 437 EAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGYYS 496

Query: 491 VEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDA 550
           V +P +I+ VF +IR++Y     PYP ++G E  +  FRDLTLGYQSDT++ +P LPVD 
Sbjct: 497 VNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDP 556

Query: 551 SSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWNVLRR 610
           +SQMITA  K      +E +RFTIRGSGTEPKLKVYIE+              TW VL+R
Sbjct: 557 NSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLKR 616

Query: 611 EWFRPEITGLKTSF 624
           EWFRP++TGL T+F
Sbjct: 617 EWFRPDVTGLTTTF 630

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/614 (58%), Positives = 438/614 (71%), Gaps = 4/614 (0%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           +P  LK     W   D++ ET  E+  +  + DW EL  R + RI FGTAGLR +M+AGF
Sbjct: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
           +RMN+LVI+Q SQGLA YI ++FP NL  VVGHDHR+HSK+FA  T   FL  GFKV YL
Sbjct: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128

Query: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194
           N   EFVHTPLVP++VD+L ++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD+ I+  
Sbjct: 129 NPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNA 188

Query: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDIT-RYVFTNGSPMLKTGKP 253
           I+ NL PW+  WN+ D+ S   + G L ++  +M   Y++ I+   V T    +    KP
Sbjct: 189 IDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSKP 248

Query: 254 WFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDM 313
           WFVYTPMHGVG  IF  I K+ + L E  DY  VPEQ  PDPSFPTV FPNPEEKGAL++
Sbjct: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308

Query: 314 AIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQ---EHKE 370
            ++LAE+  ++L+IANDPDADRFS A+KD +S  W+QL+GNEIG LFA F+ +      E
Sbjct: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKFKSMDE 368

Query: 371 KAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYE 430
           +     PLAML+STVSSQM+K+MA+VEGFHYE+TLTGFKWIGNRA+ LE++GY V FG+E
Sbjct: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428

Query: 431 EAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYT 490
           EAIGYMFP MEHDKDGI ASVVFL  Y KW     L P++VL+  F+KYGVF EYNGYY 
Sbjct: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488

Query: 491 VEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDA 550
           V  P + + +F YIRD Y P+  PYP  +G E  +  +RDLT GYQSDT+D KPTLPVD 
Sbjct: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548

Query: 551 SSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWNVLRR 610
           +SQMIT   +P  + G+E IRFTIRGSGTEPKLKVYIE+              TW+VLRR
Sbjct: 549 TSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRR 608

Query: 611 EWFRPEITGLKTSF 624
           EWFRPE T + T+F
Sbjct: 609 EWFRPEKTNITTNF 622

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/620 (57%), Positives = 436/620 (70%), Gaps = 8/620 (1%)

Query: 11  IDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRM 70
           I +  PE L+     WLR D+NEETR E+L +  R+DW EL +R   RI FGTAGLR RM
Sbjct: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67

Query: 71  EAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFK 130
           EAG  R+NSLVILQ +QGLA+YI  +FP+N   VVGHDHR+HSKEFA +T A FL AGFK
Sbjct: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127

Query: 131 VFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKN 190
           V YLN  +  VHTPLVP++VD L ++ GVMITASHNPK DNGYKVY++NGCQIIPPHD N
Sbjct: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187

Query: 191 IALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKT 250
           IA +I++NL PW   W+W  +    E+   + +  ++M   Y +         G  +L+ 
Sbjct: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTK-TAELQLIGGRKVLRN 246

Query: 251 --GKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEK 308
               PWFVYTPMHGVG +IF +I++ VLG+ EN DY  VPEQ  PDPSFPTVSFPNPEEK
Sbjct: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306

Query: 309 GALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEH 368
           GALD AI+LA + G+ L+IANDPDADRFS AV D ++  WRQL+GNEIG LFA  + + +
Sbjct: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366

Query: 369 K---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDV 425
           K   +      PL +LNSTVSSQM+KKMA+VEGFHYE+TLTGFKWIGNRA  LE++G+  
Sbjct: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426

Query: 426 CFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEY 485
            FGYEEAIGYMF  MEHDKDGI AS++FL  Y  W+      PLD+L+  ++KYGVF EY
Sbjct: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486

Query: 486 NGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPT 545
           NGYY V+ P +++  F YIR++  P  + YPE +G EF + SFRDLTLG+QSDT D  PT
Sbjct: 487 NGYYIVDNPKIMKETFDYIRNDRKPGTQ-YPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545

Query: 546 LPVDASSQMITATLKPER-TVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXT 604
           LPVD +SQMIT   KP    V  + +RFTIRGSGTEPKLKVYIE+               
Sbjct: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605

Query: 605 WNVLRREWFRPEITGLKTSF 624
           W+ L+  WFRP+ TGL T F
Sbjct: 606 WDTLQEVWFRPQTTGLVTDF 625

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/625 (56%), Positives = 443/625 (70%), Gaps = 11/625 (1%)

Query: 6   NILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAG 65
           N+LS I E + E+++V    W RYD N+ET  E+  +   K   EL  R + RI FGTAG
Sbjct: 10  NLLSSIPEDLKEKIRV----WFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAG 65

Query: 66  LRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFL 125
           LR RMEAGF RMN+L +LQ++QGLA YI  +FP NL+ VVGHDHRYHSKEFA IT A FL
Sbjct: 66  LRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFL 125

Query: 126 NAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIP 185
           NAGFKV+YLN  +EFVHTP+VP+ ++   ++ GVMITASHNP+ DNGYKVYY+NGCQIIP
Sbjct: 126 NAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIP 185

Query: 186 PHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGS 245
           PHDKNIA  IEKNL P S +WN + + S    N  L ++   +   Y+ ++ +Y+     
Sbjct: 186 PHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNI 245

Query: 246 PM---LKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSF 302
            +   +K  KPWFVYTPMHGVG++IF +I+   L L E++DY  V EQI PDPSFPTVSF
Sbjct: 246 SLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSF 305

Query: 303 PNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAI 362
           PNPEEKGALD+ I+ A++  + L++ANDPDADRFS AV++  + E++QL+GNEIG LFA 
Sbjct: 306 PNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAY 365

Query: 363 FKLQEHKEKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLE 419
           F  +++    A  K   PLAM+NSTVSSQM+KKMA+VEGF+YE+TLTGFKWIGN+A +LE
Sbjct: 366 FLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELE 425

Query: 420 QQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKY 479
           ++GY V FG+EEAIGYMFP ME DKDGI A+VVFL  Y  W         D+++  F+KY
Sbjct: 426 KEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKY 485

Query: 480 GVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDT 539
           GVF EYNGYY V + +L + +F  IR+    K + Y   +G EF + +FRDLTLGYQSDT
Sbjct: 486 GVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEK-YVSHIGTEFKVITFRDLTLGYQSDT 544

Query: 540 IDFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXX 599
           I   PTLPVD SSQMIT T+ P     +  +RFTIRGSGTEPKLKVYIE+          
Sbjct: 545 IGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANR 604

Query: 600 XXXXTWNVLRREWFRPEITGLKTSF 624
               TW+VL+REWF  E TGL T+F
Sbjct: 605 LAKLTWDVLKREWFSSEKTGLTTNF 629

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/614 (55%), Positives = 429/614 (69%), Gaps = 12/614 (1%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           +PE LK     WL  D+NE+T  EI  +   ++W EL  RL  R+ FGTAGLR RMEAGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
           +RMN+LV++Q +QGLAQYI ++FP +L  VVGHDHR++S +FA  T    L AGF+V YL
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194
           N  + +VHTP+VP++VD+++++ GVMITASHNPK DNGYKVYY+NGCQIIPPHD  IA +
Sbjct: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184

Query: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKTGKPW 254
           IE NL P +  W+W          G L +  +KM   Y+  + +  F      L  GKPW
Sbjct: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCV-KDSFVTELDSLPKGKPW 243

Query: 255 FVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMA 314
           FVYTPMHGVG+++F QIA ++L L  N D+  V EQ+ PDP FPTV FPNPEEKGALD+A
Sbjct: 244 FVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLA 303

Query: 315 IQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHKEKAAS 374
           I+LAE  G+ L+IA+DPDADRFS A K    H W+QLSGN+IG LFA ++LQ+++   A 
Sbjct: 304 IKLAENHGIKLVIASDPDADRFSVAFKG--PHGWQQLSGNDIGFLFAYYELQKYRGFDAE 361

Query: 375 RK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYEE 431
            +   PLAMLNSTVSSQM+  MA +EGFH+E+TLTGFKWIGNRAL+LE +GY V FG+EE
Sbjct: 362 YQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFEE 421

Query: 432 AIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYTV 491
           AIGYMFP  EHDKDGI A+VVFL  Y  W+  +G  PLD+LD    KYGVF EYNGYY V
Sbjct: 422 AIGYMFPATEHDKDGISAAVVFLQAYHSWIS-QGKSPLDILDEASAKYGVFREYNGYYLV 480

Query: 492 EEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDAS 551
           +EP+L    F+YIR++Y PK   YP  +G +  + +FRDLT GYQSDT +  P L VD S
Sbjct: 481 DEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDPS 539

Query: 552 SQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTWNVLRRE 611
           SQMIT   +P+     E +RFT+RGSGTEPKLKVYIE+              TW++LR E
Sbjct: 540 SQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREE 599

Query: 612 WF-RPEITGLKTSF 624
           WF RP   GL T F
Sbjct: 600 WFNRP---GLTTKF 610

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/626 (53%), Positives = 429/626 (68%), Gaps = 16/626 (2%)

Query: 11  IDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRM 70
           ++E +P+ L+   D+W +YD+N +T +EI +++  ++W EL  RL  RI FGTAGLR RM
Sbjct: 9   MNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARM 68

Query: 71  EAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFK 130
           EAGF RMN+L ++Q SQGLA YI  +FP NL VVVGHDHRY+SK FA++ +A FL  GF+
Sbjct: 69  EAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFE 128

Query: 131 VFYLN------TENEFVHTPLVPYSVDKLR--SACGVMITASHNPKDDNGYKVYYSNGCQ 182
           V+YLN          +VHTP+VP++V  +   ++CG+MITASHNPK DNGYKVYYSNGCQ
Sbjct: 129 VYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188

Query: 183 IIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFT 242
           I PPHDK IA  I+ NL PW + W+ + L      N  L     ++   YVQ I   + T
Sbjct: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248

Query: 243 NGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSF 302
             S +   GK WFVYTPMHGVG++IF  I    L L E+  Y  V  Q  PDP F TVSF
Sbjct: 249 TNS-LADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSF 307

Query: 303 PNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAI 362
           PNPEE+GAL++AI+LA R G  L++ANDPDADRFSAAVKD   ++W+QL+GN++G LFA+
Sbjct: 308 PNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAV 365

Query: 363 FKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQG 422
            +L++   +  ++KPLAML STVSSQM+ KMA VEGF + ETLTGFKW+ NRA+ LE  G
Sbjct: 366 GQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425

Query: 423 YDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVF 482
           + V F YEEAIGYMF  + HDKDG+ A+  FL M ++W + EG  PLDVL+  +EKYG F
Sbjct: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGNF 484

Query: 483 SEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDF 542
            EYNGYY+V++ ++I  VF YIR+       PYP  +G EF + SFRDLT+GYQSDT + 
Sbjct: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544

Query: 543 KPTLPVDASSQMITATLKP----ERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXX 598
            P LPV   S MIT  LKP          + +RFTIRGSGTEPKLKVYIES         
Sbjct: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604

Query: 599 XXXXXTWNVLRREWFRPEITGLKTSF 624
                TW+VL+REWFRPE+TGL+T F
Sbjct: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/632 (55%), Positives = 438/632 (69%), Gaps = 25/632 (3%)

Query: 7   ILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGL 66
           ++SL +  VPE LK+  + WL+YD+NE+TR +I+ ++  K W EL NRL  RI FGTAGL
Sbjct: 1   MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL 60

Query: 67  RGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLN 126
           R RMEAGF RMN+L +LQ SQGLA+YI   FP NLSVVVGHDHR++SK+FA++T+  FL 
Sbjct: 61  RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ 120

Query: 127 AGFKVFYLN-----TENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGC 181
            GFKV+ L      +++  VHTP+VP+ +D LR++ G+MITASHNPK DNGYKVYYSNGC
Sbjct: 121 LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC 180

Query: 182 QIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFL-AYVQDITR-Y 239
           QIIPPHD+ I+ +I  NL PW + W+   +   E     +  +  K+ +  YV  + R  
Sbjct: 181 QIIPPHDQRISQSILANLEPWDRAWDCAAV-KAEAVQSEMLIDAKKVLVDQYVDTVRRSL 239

Query: 240 VFTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPT 299
           V TN   +  T  PWFVYTP+HGVG +IF +I      L +  DY  V EQ  PDP+FPT
Sbjct: 240 VITN---VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPT 296

Query: 300 VSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSL 359
           VSFPNPEEKGALD AI+LAE+  +T ++ NDPDADRFS A   K + +WRQL+GNEIG L
Sbjct: 297 VSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFL 354

Query: 360 FAIFKLQEHK---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRAL 416
           FA +K + ++   +K     PLAM+NSTVSSQM+KKMA+VEGFHYE+TLTGFKW+GNRA 
Sbjct: 355 FAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRAR 414

Query: 417 QLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCF 476
           +LE  GY V F YEEAIGYMF  + HDKDGI A+VVFL M   W + + L P DVL   +
Sbjct: 415 ELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAY 473

Query: 477 EKYGVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQ 536
           +KYGVF EYNGYY V + +L + VFS IR  +  +    P  +G+EF + S+ DLT GYQ
Sbjct: 474 QKYGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQ 529

Query: 537 SDTIDFKPTLPVDASSQMITATLKPERTVGH----EEIRFTIRGSGTEPKLKVYIESXXX 592
           S+T D +P LPVD SSQMITATL P  + G     E +RFT RGSGTEPKLKVYIE+   
Sbjct: 530 SNTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSS 589

Query: 593 XXXXXXXXXXXTWNVLRREWFRPEITGLKTSF 624
                       W+VLRREWF+PE TGL T+F
Sbjct: 590 SEELASALAKKAWDVLRREWFKPEQTGLATNF 621

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/632 (53%), Positives = 429/632 (67%), Gaps = 9/632 (1%)

Query: 1   MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP 60
           +SS S   S++ E +P  L+     WL  D+N ET +E++ +       EL  R + RI 
Sbjct: 2   VSSNSEFDSVL-ETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL 60

Query: 61  FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADIT 120
           FGTAGLR +MEAGF+RMN+LV+LQ +QGLA YI ++FP NL  V+GHDHRYHSKEFA+I 
Sbjct: 61  FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA 120

Query: 121 VATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNG 180
            + FL+AGF V+ LN    FVHTPLVP++VD++ ++ GVMITASHNPK DNGYKVYYSNG
Sbjct: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG 180

Query: 181 CQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYV 240
           CQIIPP D +IA  I++NL PWS  W+          N  L +  N+M LAY   +   +
Sbjct: 181 CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI 240

Query: 241 FTNGS--PMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFP 298
               +     +  KPWFVYTPMHGVG++IF  +  + + L EN DY +V EQI PDP+FP
Sbjct: 241 IDKKTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFP 300

Query: 299 TVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGS 358
           T+SFPNPEEKGALDMAI LA+   ++L+IANDPDADRFSAA+ +  S EW+QL+GNEIG 
Sbjct: 301 TISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGF 360

Query: 359 LFAIFKLQEHKEKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRA 415
           LF  +   ++       K   PLAMLNSTVSS+MLK MA  E F + +TLTGFKWIGN+A
Sbjct: 361 LFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKA 420

Query: 416 LQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLC 475
           + L+++GY V FGYEEAIGYMFP MEHDKDGI ASVVFL  Y +W  L  +  +D+L+  
Sbjct: 421 IDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQG 480

Query: 476 FEKYGVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGY 535
            EKYG F EYNGYY V  P +   +F YIR+EY      YP+ +G    + SFRDLT G+
Sbjct: 481 IEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGF 540

Query: 536 QSDTIDFKPTLPVDASSQMITATLK---PERTVGHEEIRFTIRGSGTEPKLKVYIESXXX 592
           QSDT+D  P+LPVD SSQMIT T K    E       +RFT+RGSGTEPKLK+YIE    
Sbjct: 541 QSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSK 600

Query: 593 XXXXXXXXXXXTWNVLRREWFRPEITGLKTSF 624
                      TW+VL++EW RPE+TG+ TS+
Sbjct: 601 DPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/622 (55%), Positives = 440/622 (70%), Gaps = 21/622 (3%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           +P  LK S + W  +D+NEETR+EIL ++  ++W EL  RL+ RI FGTAGLR +MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
           +RMN+L +LQ SQGLA+YI EKFP+N +V VGHDHR++S++FA++T   FL   FKV+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 135 N-----TENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDK 189
                  ++ FVHTP+VP+++D+L ++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD+
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 190 NIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLK 249
            IA +I  NL PW + W+ K + +     G        M   YV++I+  + +  S +  
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS--SDIGD 245

Query: 250 TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKG 309
             KPWFVYTP+HGVG +IF +IA +VLGL E  DY+ V E  +PDP+FPTVSFPNPEE G
Sbjct: 246 RSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAG 305

Query: 310 ALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK 369
           ALD+AI LA++ G++ ++ NDPDADRFSAAVK +   +WRQL+GNEIG LFA F  ++++
Sbjct: 306 ALDLAIALADKNGISFVLGNDPDADRFSAAVKHQ--GKWRQLTGNEIGFLFAQFVWEKYQ 363

Query: 370 EKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426
           ++++  K   PLA++NSTVSSQM+KK+A VE FHYE+TLTGFKW+GNRA QLE  GY V 
Sbjct: 364 KESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVP 423

Query: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486
           F YEEAIG+MF  + HDKDG+ A+VVFL M   W + + L P+DVL   F KYGVF EYN
Sbjct: 424 FAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSW-KKQALSPIDVLQSAFGKYGVFKEYN 482

Query: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546
           GYYTV + +L + +FS IR  Y      YP+ +G +F + SF DLT G+QSDT D  P L
Sbjct: 483 GYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRL 538

Query: 547 PVDASSQMITATLKPERTVGH----EEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXX 602
           PVD SSQMI ATL P  + G     E +RFT RGSGTEPKLKVYIE+             
Sbjct: 539 PVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLAR 598

Query: 603 XTWNVLRREWFRPEITGLKTSF 624
            TWNVLR EWF+P+ TGL T F
Sbjct: 599 TTWNVLRDEWFKPKETGLSTKF 620

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/644 (52%), Positives = 431/644 (66%), Gaps = 21/644 (3%)

Query: 1   MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP 60
           MS +    +LI +Y PE L+     WL  D+++ TR EI+ +    + KEL  R + RI 
Sbjct: 1   MSDEQQFNALIKDY-PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRIT 59

Query: 61  FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYI---MEKFPQNLSVVVGHDHRYHSKEFA 117
           FGTAGLR  MEAGF+RMN+L +LQ SQGLA Y+    +   Q L  V+GHDHRYHSKEFA
Sbjct: 60  FGTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFA 119

Query: 118 DITVATFLNAGFKVFYLNTE-------NEFVHTPLVPYSVDKLRSACGVMITASHNPKDD 170
            I    FL AGFKV+YLN +       N+FVHTP+VP++V  L+++ GVM+TASHNPK D
Sbjct: 120 KIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMD 179

Query: 171 NGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFL 230
           NGYKVYYSNGCQIIPPHD  I+  I+ NL PW   WN+K++ +  E  G+L ++ + M  
Sbjct: 180 NGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLN 239

Query: 231 AYVQDITRYVFTNGSPMLKT-----GKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYF 285
            Y+  +   + +     L        KPWFVYTPMHGVG++IF +I+ ++L + E  D+ 
Sbjct: 240 DYITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFI 299

Query: 286 SVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRS 345
            V EQ  PDP FPTVSFPNPEEKGA+DM I+LAE  G++L+IANDPDADRFS AVK K S
Sbjct: 300 VVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGS 359

Query: 346 H-EWRQLSGNEIGSLFAIFKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEET 404
              W Q +GNEIG LFA F+ Q++K        L M+NSTVSSQM+KKMA++EGF+YEET
Sbjct: 360 QGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEET 419

Query: 405 LTGFKWIGNRALQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELE 464
           LTGFKWIGNRA+ L  +G  V FGYEEAIGYMFP ME DKDGI A+V+F+  +  W +++
Sbjct: 420 LTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQID 479

Query: 465 GLGPLDVLDLCFEKYGVFSEYNGYYTVEEPALIESVFSYIRDEY----CPKARPYPEKLG 520
            + P +++ L F+KYGVF EYNGYY   +  + + +F Y+R +Y        + YP+ +G
Sbjct: 480 KMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIG 539

Query: 521 REFFLTSFRDLTLGYQSDTIDFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTE 580
            EF +  +RDLT GYQSDT D KP LPVD SSQMIT  + P        IR TIRGSGTE
Sbjct: 540 EEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTE 599

Query: 581 PKLKVYIESXXXXXXXXXXXXXXTWNVLRREWFRPEITGLKTSF 624
           PKLKVYIE+               WNVL+REW RPE TG+ T+F
Sbjct: 600 PKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/621 (53%), Positives = 424/621 (68%), Gaps = 15/621 (2%)

Query: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74
           VP  LK S   WL +D+N ET+ EI  ++    W EL  RL  RI FGTAGLR RMEAGF
Sbjct: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67

Query: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134
           +RMN+L ++Q SQGLA+YI  +FP +L VV+GHDHR+HS+EFA+ T+A FL   + ++YL
Sbjct: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127

Query: 135 N------TENEFVHTPLVPYSVDKLR---SACGVMITASHNPKDDNGYKVYYSNGCQIIP 185
           N       E+ FVHTP+VP++++ +    ++CGVMITASHNPK DNGYKVYY+NGCQIIP
Sbjct: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187

Query: 186 PHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGS 245
           PHD+ I   I+ NL PW++ W+ K L     ++G L     +M   Y +D  + +    S
Sbjct: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKY-KDSIQTMLVKQS 246

Query: 246 PMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNP 305
            +   G PWFVYTPMHGVG++ F +    VLG+ E+ DY  VPEQ  PDP FPTVSFPNP
Sbjct: 247 NLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNP 306

Query: 306 EEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKL 365
           EE+GALDMA+++A+  G+T+++ANDPDADRFS AV  K   EW QL+GN+IG LFA  ++
Sbjct: 307 EERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFAQAEM 364

Query: 366 QEH-KEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYD 424
           Q + KE    RK LAML S VSSQ+L+KMA+ EGF   ETLTGFKW+GNRA +LE +GY 
Sbjct: 365 QSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYY 424

Query: 425 VCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSE 484
           V F YEEAIGYMF  + HDKDGI A+ VFL M  +W ++      +VL  C+EKYG F +
Sbjct: 425 VPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKV-AKSSQEVLQECYEKYGYFVD 483

Query: 485 YNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKP 544
           YNGYY    PA+ + VF Y R+EY P  +PYP  +G EF +   RDLT+GYQSDT    P
Sbjct: 484 YNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIP 543

Query: 545 TLPVDASSQMITATLKPERT-VGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXX 603
            LPVD +SQMIT  LKP +     E +RFT RGSGTEPKLKVYIES              
Sbjct: 544 DLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHL 603

Query: 604 TWNVLRREWFRPEITGLKTSF 624
            W+VL+REWFRP  TGL+T+F
Sbjct: 604 AWDVLKREWFRPTETGLQTNF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/619 (55%), Positives = 422/619 (68%), Gaps = 27/619 (4%)

Query: 13  EYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEA 72
           E +P  L+     WL+YD+ EETR+EIL +  + D  EL  RL+  I FGTAGLRGRMEA
Sbjct: 8   ESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEA 67

Query: 73  GFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVF 132
           GF RMN+L + Q SQGLA+YI ++FP+NL+VVVGHDHR++S+ F  +TV TFL  GFKVF
Sbjct: 68  GFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVF 127

Query: 133 YLNTENE--FVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKN 190
           +LN ENE   VHTPLVP++V+   ++ G+MITASHNPK DNGYKVYY+NGCQIIPPHDK 
Sbjct: 128 HLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKL 187

Query: 191 IALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKT 250
           IA +I  NL P+S             + G +     KM   Y+ D       +G+   KT
Sbjct: 188 IAESIIHNLEPFSS-----------PQTGTIIDCKEKMTKKYI-DAIGSTLIDGAVNKKT 235

Query: 251 GKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGA 310
            +PWFVYTPMHGVG +IF  I+KQ+L L E  DY  V EQ  PD  FPTVSFPNPEEKGA
Sbjct: 236 NEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGA 295

Query: 311 LDMAIQLAER-EGLTLIIANDPDADRFSAAVKDKRSH---EWRQLSGNEIGSLFAIFKLQ 366
           LD+A++   + + + LIIANDPDADRFS AV+D   +    WRQL+GNEIG LFA ++ +
Sbjct: 296 LDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWE 355

Query: 367 EHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426
            +K      +PLAMLNSTVSSQM+K+MA++EGFHYE+TLTGFKW+GNRAL+LEQ+GY   
Sbjct: 356 RYKHSPID-EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTP 414

Query: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486
           F YEEAIGYMF  + HDKDGI A++VFL  YSKW    G   LD+L     KYG F E+N
Sbjct: 415 FAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDILATASLKYGHFKEFN 473

Query: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546
           GYY V + A+ + VF  IR        PYP+KLG  F +  FRDLT GYQSDT D  P L
Sbjct: 474 GYYIVPDLAITKQVFDAIRS----IESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPEL 529

Query: 547 PVDASSQMITA-TLKPERTVGHEEIRFTIRGSGTEPKLKVYIESXXXXXXXXXXXXXXTW 605
             D SSQMIT   L  E+      +RFTIRGSGTEPKLKVYIE+              TW
Sbjct: 530 ASDPSSQMITCEMLLVEQPTSR--VRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTW 587

Query: 606 NVLRREWFRPEITGLKTSF 624
           +VLR+EWF+PE+TGL T F
Sbjct: 588 DVLRQEWFKPELTGLLTPF 606

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 128/299 (42%), Gaps = 44/299 (14%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +    +         ++   Q I++  P+   + ++VVG D RY++ +   
Sbjct: 19  GTSGLRKKTKVFMEKP------HYTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSV----DKL--RSACGVMITASHN---PKD 169
           I  +     G     +  ++  + TP   + +    DK   +   G+++TASHN   P +
Sbjct: 73  IIASISAANGVGKLVIG-QHGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 170 DNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL-FST--EERNGNLEFNGN 226
           D G K   SNG    P    N    I K LT +    N   L  ST  E++ GNLE +  
Sbjct: 132 DIGIKYNLSNGGP-APESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEIDVV 190

Query: 227 KMFLAYVQ---------DITRYVFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVL 276
            +  AYV+          I ++V T      ++ K W  ++  ++GV       I    L
Sbjct: 191 DVTQAYVEFLKEIFDFDLIKKFVDTQ-----RSTKHWKLLFDGLNGVTGPYGKAIFVDEL 245

Query: 277 GLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           GL EN     V +   P P F  +  P+P    A  + ++  ++E +    A+D D DR
Sbjct: 246 GLPEN----EVLQNCHPKPDFGGI-HPDPNLTYARTL-VERVDKEKIEFGAASDGDGDR 298

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 123/294 (41%), Gaps = 37/294 (12%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLS---VVVGHDHRYHSKEFAD 118
           GT+GLR R +      N       ++   Q I+E  P+ +    ++VG D RY++     
Sbjct: 19  GTSGLRKRTKVFAEEPN------YTENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPY---SVDKLRSACGVMITASHN---PKDDNG 172
              A     G K   +  +N  + TP   +   S  K +   G+++TASHN   P +D G
Sbjct: 73  KIAAIGAANGVKRLVVG-QNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 173 YKVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDLFSTEERN-GNLEFNGNKMF 229
            K   +NG    P +  N      K LT +    D+   DL +  E+  G+L  +     
Sbjct: 132 IKYNLANGGP-APENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDST 190

Query: 230 LAYVQDITRYVFTNGSPMLKT-------GKPW-FVYTPMHGVGHKIFGQIAKQVLGLSEN 281
            AYV D  + +F    P++K+        K W  ++  ++GV       I    LGL E+
Sbjct: 191 KAYV-DFLKTIFD--FPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLPED 247

Query: 282 VDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
                V +   P P F  +  P+P    A  + +   +RE +    A+D D DR
Sbjct: 248 ----EVLQNCHPKPDFGGLH-PDPNLTYARTL-VDRVDRENIAFGAASDGDGDR 295

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 125/302 (41%), Gaps = 50/302 (16%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR +  A F  MN++     ++   Q I++  P+   +  +VVG D RY++ +   
Sbjct: 17  GTSGLR-KKTAVF--MNNV---HYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSV------DKLRSACGVMITASHN---PKD 169
           I  A     G +   +  ++  + TP   + +      D  +   G+++TASHN   P++
Sbjct: 71  IIAAISAANGVRKLVIG-QHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 170 DNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMF 229
           D G K   SNG    P    N    I K LT +     + ++        NL   G K +
Sbjct: 130 DIGIKYNLSNGGP-APESVTNAIWDISKKLTHYKIVKGFPEI--------NLSVKGEKSY 180

Query: 230 LAYVQDIT----RYV-FTNG----------SPMLKTGKPW-FVYTPMHGVGHKIFGQIAK 273
            + V D+      YV F  G              ++ K W  ++  ++GV       I  
Sbjct: 181 GSLVIDVVDTTQEYVDFLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIFV 240

Query: 274 QVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDA 333
             LGL EN     V +   P P F  +  P+P    A  + +   ++E +    A+D D 
Sbjct: 241 DELGLPEN----EVLQNCHPKPDFGGI-HPDPNLTYARTL-VDRVDKEKIEFGAASDGDG 294

Query: 334 DR 335
           DR
Sbjct: 295 DR 296

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 123/300 (41%), Gaps = 49/300 (16%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQN---LSVVVGHDHRYHSKEFAD 118
           GT+GLR + +    + N       ++   Q IME  P+     ++VVG D RY++    +
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G K   +  +   + TP   + +      C  G+++TASHN   P++D G 
Sbjct: 73  KIAAIGSANGIKKLVIG-QYGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLEFNGNKMF 229
           K   SNG    P    N    I K LT +   KD+   DL      ++ G L  +   + 
Sbjct: 132 KYNLSNGGP-APESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVIDIT 190

Query: 230 LAYVQ--------DITRYVFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSE 280
            AYV         D+ +    N     ++ K W  ++  M+GV     G   K +     
Sbjct: 191 KAYVDFLKKIFDFDLIKKFIDN----QRSTKNWKLLFDSMNGV----TGPYGKAIF---- 238

Query: 281 NVDYFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
            VD F +P     +   P P F  +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 239 -VDEFGLPAEEVLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDR 295

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 126/296 (42%), Gaps = 41/296 (13%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQN---LSVVVGHDHRYHSKEFAD 118
           GT+GLR + +    + N       ++   Q IME  P+     ++VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G K   +  ++  + TP   + +      C  G+++TASHN   P++D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLE---FNGN 226
           K   SNG    P    N+   I K LT +   KD+   DL      ++ G L     +  
Sbjct: 132 KYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDIT 190

Query: 227 KMFLAYVQDITRY-VFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
           K ++ ++++I  + +        ++ K W  ++  M+GV     G   K +      VD 
Sbjct: 191 KDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVT----GPYGKAIF-----VDE 241

Query: 285 FSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           F +P     +   P P F  +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 242 FGLPADEVLQNWHPSPDFGGMH-PDPNLTYASTL-VKRVDREKIEFGAASDGDGDR 295

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 16/128 (12%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +   +  N       ++   Q I+   P   +N ++VVG D R+++    D
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC---GVMITASHN---PKDDNG 172
             +      G +   +  +N  + TP   Y +   + +C   G+++TASHN   P++D G
Sbjct: 73  KIMQISAANGVRKLVIG-QNGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 173 YKVYYSNG 180
            K   SNG
Sbjct: 132 IKYNLSNG 139

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 121/300 (40%), Gaps = 49/300 (16%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQN---LSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q IME  P+     ++VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDEPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G K   +  ++  + TP   + +      C  G+++TASHN   P++D G 
Sbjct: 73  KIAAIGAANGIKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLEFNGNKMF 229
           K   SNG    P    N    I K LT +   KD+   DL      ++ G L  +   + 
Sbjct: 132 KYNLSNGGP-APESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDIT 190

Query: 230 LAYVQ--------DITRYVFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSE 280
             YV         D+ +    N     ++ K W  ++  M+GV     G   K +     
Sbjct: 191 KDYVNFLKEIFDFDLIKKFIDN----QRSTKNWKLLFDSMNGV----TGPYGKAIF---- 238

Query: 281 NVDYFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
            VD F +P     +   P P F  +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 239 -VDEFGLPADEVLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDR 295

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 9/103 (8%)

Query: 86  SQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYLNTENEFVH 142
           ++   Q I+E  P+   N ++VVG D RY++ E   I  A     G +   L  +N  + 
Sbjct: 37  TENFIQAILEAIPEGSENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILG-QNGILS 95

Query: 143 TPLVPYSVDKLRSAC--GVMITASHN---PKDDNGYKVYYSNG 180
           TP   + +      C  G+++TASHN   P++D G K   SNG
Sbjct: 96  TPAASHIIRSYPEKCTGGIILTASHNPGGPENDFGIKYNLSNG 138

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 127/296 (42%), Gaps = 41/296 (13%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR +  A F +         ++   Q I+E  P+   + ++V+G D R+++    +
Sbjct: 20  GTSGLR-KKTAVFMKEP-----HYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDVVIN 73

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVD--KLRSACGVMITASHN---PKDDNGY 173
              A     G +   +  +N  + TP   Y +   K ++  G+++TASHN   P++D G 
Sbjct: 74  KIAAISAANGVRKLVIG-QNGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPENDMGI 132

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLE---FNGN 226
           K   +NG    P    N    I K LT +   KD+   DL     +++ G L     +  
Sbjct: 133 KYNLANGGP-APESVTNAMWEISKKLTSYKIIKDFPTLDLSKIGNDQKYGPLLVDIIDTT 191

Query: 227 KMFLAYVQDITRYVFTNG--SPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
           K ++ +++ I  +       +   +T     ++  ++G    I G   K +      VD 
Sbjct: 192 KEYVEFLKTIFDFPLIKAFITKQRETNNWKLLFDSLNG----ITGPYGKAIF-----VDE 242

Query: 285 FSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           F +P     +   P P F  +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 243 FGLPAEEALQNWHPQPDFGGLH-PDPNLTYAKTL-VERVDREKIQFGAASDGDGDR 296

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 119/295 (40%), Gaps = 39/295 (13%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLS---VVVGHDHRYHSKEFAD 118
           GT+GLR + +    + N +      +   Q +ME  P+      +VVG D RY++     
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G K   +  +N  + TP   + +   +  C  G+++TASHN   P++D G 
Sbjct: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDLFSTEE--RNGNLEFNGNKMF 229
           K   SNG     P    I   I K LT +   KD+   DL    E  + G L  +     
Sbjct: 131 KYNLSNGGPAPEPVTNKI-WEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189

Query: 230 LAYVQDITRYVFT-----NGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVD 283
            AY+Q + + +F            +  K W  +   M+GV     G  AK +      +D
Sbjct: 190 DAYIQ-LLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGV----TGPYAKAIFVDEFGLD 244

Query: 284 YFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAER---EGLTLIIANDPDADR 335
              V +   P P F  +  P+P     L  A  L ER   E +    A+D D DR
Sbjct: 245 SKEVLQNWHPQPDFGGLH-PDPN----LTYAHTLVERVNKEKIEFGAASDGDGDR 294

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 124/300 (41%), Gaps = 49/300 (16%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNL---SVVVGHDHRYHSKEFAD 118
           GT+GLR +  A FT          ++   Q +ME  P+     ++VVG D RY++     
Sbjct: 19  GTSGLR-KKTAVFTNEP-----HYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G +   +  +N  + TP   + +   +  C  G+++TASHN   PK+D G 
Sbjct: 73  KIAAIGAANGVRKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYV 233
           K   SNG     P    I   + K L  +    +  +L + +    N+++      L  V
Sbjct: 132 KYNLSNGGPAPEPVTNKI-WEVSKQLDHYKIIPDLPEL-ALDTLAENVQYG---PLLVDV 186

Query: 234 QDITR-YV-FTN---GSPMLK-------TGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSE 280
            D TR YV F       P++K       + K W  ++  M+GV     G   K +     
Sbjct: 187 VDTTRDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGV----TGPYGKAIF---- 238

Query: 281 NVDYFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
            VD F +P     +   P P F  +  P+P    A  + +   +RE +    A+D D DR
Sbjct: 239 -VDEFELPAEEVLQNWHPQPDFGGIH-PDPNLTYARSL-VDRVDRENIEFGAASDGDGDR 295

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 114/276 (41%), Gaps = 43/276 (15%)

Query: 86  SQGLAQYIMEKFPQN---LSVVVGHDHRYHSKEFADITVATFLNAGFKVFYLNTENEFVH 142
           ++   Q +++  P+     ++VVG D RY++        A     G K   +  ++  + 
Sbjct: 37  TENFIQSVLDAIPEGSKGATLVVGGDGRYYNDVILHKIAAISAANGVKKLVIG-QHGLLS 95

Query: 143 TPLVPYSVDKLRSAC--GVMITASHN---PKDDNGYKVYYSNGCQIIPPHDKNIALTIEK 197
           TP   + +      C  G+++TASHN   P++D G K   SNG    P    N    I K
Sbjct: 96  TPAASHIMRTYEDKCTGGIILTASHNPGGPENDMGIKYNLSNGGP-APESVTNAIWEISK 154

Query: 198 NLTPWS--KDWNWKDL--FSTEERNGNLEFNGNKMFLAYVQ--------DITRYVFTNGS 245
            LT +   KD+   DL     + + G L  +   +  AYV+        ++ +    N  
Sbjct: 155 KLTSYKIVKDFPELDLQTIGKDRKYGPLLIDIIDVTKAYVELMEEIFDFNLIKKFIDN-- 212

Query: 246 PMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVP-----EQIKPDPSFPT 299
              ++ K W  ++  M+GV     G   K +      VD F +P     +   P P F  
Sbjct: 213 --QRSTKNWKLLFDSMNGV----TGPYGKAIF-----VDKFGLPAEEVLQNWHPSPDFGG 261

Query: 300 VSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 262 MH-PDPNLTYASSL-VKRVDREQIEFGAASDGDGDR 295

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 120/291 (41%), Gaps = 31/291 (10%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQN---LSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q IM+  P+     ++VVG D RY++     
Sbjct: 19  GTSGLRKKTKIFKDTPN------YTENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKL--RSACGVMITASHNP---KDDNGY 173
              A     G K   +  +   + TP   + +     ++  G+++TASHNP   K+D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QRGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNL---EFNGN 226
           K   SNG     P    I   I K +T +   KD+   +L      ++ G L     +  
Sbjct: 132 KFNLSNGGPAPEPVTNKI-WEISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTT 190

Query: 227 KMFLAYVQDITRY-VFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
           K ++ +V+ I  + +        +  K W  ++  M+GV       I    LGL  +   
Sbjct: 191 KAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPAD--- 247

Query: 285 FSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
             V +Q  P P F  V  P+P    A  + +   +RE +    A+D D DR
Sbjct: 248 -EVLQQWHPSPDFGGVH-PDPNLTYAKAL-VDRVDRENIEFGAASDGDGDR 295

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 89/417 (21%), Positives = 169/417 (40%), Gaps = 50/417 (11%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNL---SVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q  M+  P+     ++VVG D RY++    +
Sbjct: 19  GTSGLRKKTKVFAEEPN------YTENFIQATMDAIPEGCKGATLVVGGDGRYYNDVIMN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
             V+     G +   +   N  + TP   + +   +  C  G+++TASHN   PK+D G 
Sbjct: 73  KIVSIAGANGVRKLIIG-HNGILSTPAASHVIRSYKEKCTGGIILTASHNPGGPKNDIGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGNLE---FNGN 226
           K   +NG    P    N      K LT +       +L     + + + G L     +  
Sbjct: 132 KYNLANGGP-APESVTNAIWEASKKLTEYKVIEGLPELDTSKIAVDIKYGPLLVDIIDST 190

Query: 227 KMFLAYVQDITRY-VFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
           + ++ Y+++I  + +        +  K W  ++  ++GV       I  + LGL  +   
Sbjct: 191 EAYVDYLKEIFDFKLIKEFVTKQRETKGWKLLFDSLNGVTGPYGEAIFVKELGLPAD--- 247

Query: 285 FSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR---FSAAVK 341
             V +   P P F  +  P+P    A  + ++  ++E +    A+D D DR   + A   
Sbjct: 248 -EVLQNWHPLPDFGGL-HPDPNLTYAHTL-VERVDKENIQFGAASDGDGDRNMIYGAGPA 304

Query: 342 DKRSHEWRQLSGNEIGSLFAIFKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHY 401
                +          S+  I +  +     A +    +  S  +S  L ++A+ +G + 
Sbjct: 305 FVSPGD----------SVAIISEYADEIPYFAKQGIYGVARSFPTSSALDRVAKAKGLNC 354

Query: 402 EETLTGFKWIGNRALQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYS 458
            E  TG+K+        + Q   +C   EE+ G     +  +KDG+ A V +L++ +
Sbjct: 355 YEVPTGWKFF---CALFDDQKVSICG--EESFGTGSNHI-REKDGVWAIVAWLNILA 405

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +     MN       ++   Q IME  P   Q+  +VVG D RY++ E   
Sbjct: 19  GTSGLRKKTK---VFMNEP---HYTENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKL--RSACGVMITASHN---PKDDNGY 173
                    G K   +  +N  + TP   + +     +S  G+++TASHN   P++D G 
Sbjct: 73  KIGEIGAANGVKKLIVG-QNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 174 KVYYSNG 180
           K   SNG
Sbjct: 132 KYNLSNG 138

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 122/297 (41%), Gaps = 43/297 (14%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q IM+  P+   + ++VVG D R+++    +
Sbjct: 19  GTSGLRKKTKVFMDEPN------YTENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVD--KLRSACGVMITASHN---PKDDNGY 173
              A     G K   +  +N  + TP   + +   K +   G+++TASHN   P +D G 
Sbjct: 73  KIAAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDLFSTEE--RNGNLE---FNGN 226
           K    NG    P    +      K LT +    D+   DL +  E  + GNL     +  
Sbjct: 132 KYNLGNGAP-APEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDIIDST 190

Query: 227 KMFLAYVQDITRYVFTNGSPMLKT-------GKPW-FVYTPMHGVGHKIFGQIAKQVLGL 278
           + ++ Y+++I  +      P++K         K W  ++  ++GV       I     GL
Sbjct: 191 EAYVKYMKEIFDF------PLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADEFGL 244

Query: 279 SENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
             +     V +   P P F  +  P+P    A  + +   ++E +    A+D D DR
Sbjct: 245 PAD----EVLQNYVPKPDFGGLH-PDPNLTYAKTL-VSRVDKEKIEFGAASDGDGDR 295

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 126/296 (42%), Gaps = 43/296 (14%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q IME  P   Q  ++V+G D RY++     
Sbjct: 19  GTSGLRKKTKVFEETPN------YTENFIQAIMEAIPEGSQGATLVIGGDGRYYNDVVIQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G +   +   N  + TP   + +      C  G+++TASHN   P +D G 
Sbjct: 73  KIAAIGSANGVRKIVIG-HNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDFGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTI---EKNLTPWS--KDWNWKDL--FSTEERNGNLEFNGN 226
           K   +NG     P  +++  +I    + LT +   + +   DL     +++ G+L  +  
Sbjct: 132 KYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVDIV 187

Query: 227 KMFLAYVQDITRYVFTNGSPMLKT-----GKPWF--VYTPMHGVGHKIFGQIAKQVLGLS 279
               AYV+ + + +F    P++K+      K  F  ++  M+GV       +  + LGL 
Sbjct: 188 DSTAAYVE-LMKEIFD--FPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKELGLP 244

Query: 280 ENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           E     S  +   P P F  +  P+P    A  + ++  ++ G+    A+D D DR
Sbjct: 245 E-----SSLQNYHPKPDFGGLH-PDPNLTYAHTL-VERVDKYGIQFGAASDGDGDR 293

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 121/299 (40%), Gaps = 48/299 (16%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQT---SQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKE 115
           GT+GLR + +         V  QT   ++   Q IME  P+   N  +V+G D RY++  
Sbjct: 19  GTSGLRKKTK---------VFEQTEHYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDA 69

Query: 116 FADITVATFLNAGFKVFYLNTENEFVHTPLVPYSV----DKLRSACGVMITASHN---PK 168
                       G +   +  +N  + TP   + +    DK+    G+++TASHN   P 
Sbjct: 70  VMQKIAEVGSANGVRKLIIG-QNGLLSTPAASHIIRTYHDKVTG--GIILTASHNPGGPD 126

Query: 169 DDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGNLEFN 224
           +D G K   +NG    P    N      +NLT +        L        ++ GNL  +
Sbjct: 127 NDFGIKYNLANGAP-APEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLLVD 185

Query: 225 GNKMFLAYVQDITRYVFTNGSPMLK-----TGKPW---FVYTPMHGVGHKIFGQIAKQVL 276
                 AYV+ + + +F    P++K       K +    ++  ++G+       I    L
Sbjct: 186 VIDPTEAYVR-LMKEIFD--FPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDEL 242

Query: 277 GLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           GLSE+       +   P P F  +  P+P    A  + +   +RE +    A+D D DR
Sbjct: 243 GLSED-----SLQNFVPKPDFGGLH-PDPNLTYAHTL-VSRVDRENIAFGAASDGDGDR 294

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 118/291 (40%), Gaps = 33/291 (11%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +  F + +       ++   Q I+E  P   Q+  +VVG D RY++     
Sbjct: 19  GTSGLRKKTKV-FQQEH------YTENFIQAILEAIPEGCQDAILVVGGDGRYYNDVVMQ 71

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKL--RSACGVMITASHN---PKDDNGY 173
                    G K   +  +N  + TP   + +     +   G+++TASHN   P +D G 
Sbjct: 72  KIAEVGSANGVKKLIIG-QNGLMSTPAASHLIRTYAEKVTGGIILTASHNPGGPDNDLGI 130

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGNLEFNGNKMF 229
           K   +NG    P    +    I K LT +     +  L      T+++ G+L  +     
Sbjct: 131 KYNLANGAP-APEKVTSAMYEISKKLTHYKIVEPFPKLDLSRIGTDQKYGDLLVDIIDTT 189

Query: 230 LAYVQDITR-YVFTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVP 288
            AYV+ +   + F      L+  +  + +  +    + I G   + +      VD   +P
Sbjct: 190 AAYVKLVKEIFDFDLIKSFLQKAQSEYDFKILFDALNGITGPYGRAIF-----VDELGLP 244

Query: 289 EQI----KPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           E       P P F  +  P+P    A D+  ++ E E +    A+D D DR
Sbjct: 245 EHFLQHCTPLPDFGGLH-PDPNLTYAHDLVSRVDE-EQIAFGAASDGDGDR 293

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 123/296 (41%), Gaps = 41/296 (13%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q IM+  P+   +  +VVG D R+++     
Sbjct: 17  GTSGLRKKTKVFMEEPN------YTENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
              A     G +   +  +N  + TP   + +      C  G+++TASHN   P++D G 
Sbjct: 71  KIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLE---FNGN 226
           K   +NG     P   N    + K LT +   KD+   D      +++ G L     +  
Sbjct: 130 KYNLANGGPAPEPV-TNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188

Query: 227 KMFLAYVQDITRY-VFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
           + ++ ++++I  + +        +  K W  ++  ++G    I G   K +      VD 
Sbjct: 189 EDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNG----ITGPYGKAIF-----VDE 239

Query: 285 FSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           F +P     +   P P F  +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 240 FDLPADEVLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVDREKIEFGAASDGDGDR 293

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 14/75 (18%)

Query: 110 RYHSKEFADITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKD 169
           R ++K    +   T + A  +   L T N+               SA GVM+TASHNP +
Sbjct: 35  RDNAKRLDTVMFTTGIVACLRSLTLQTSNK--------------HSAIGVMVTASHNPPE 80

Query: 170 DNGYKVYYSNGCQII 184
           DNG K+   NG  ++
Sbjct: 81  DNGVKIIEPNGSMLL 95

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 118/292 (40%), Gaps = 32/292 (10%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q +M+  P   Q+ ++VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFMEEPN------YTENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSA---CGVMITASHNP---KDDNG 172
              A     G     +  +N  + TP   + +     A    G+++TASHNP   K+D G
Sbjct: 73  KIAAIGAANGVHKLVIG-QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131

Query: 173 YKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGNLEFNGNKM 228
            K   SNG    P    N      K LT +    N+  L      T++R G L  +    
Sbjct: 132 IKYNLSNGGP-APESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDIIDS 190

Query: 229 FLAYVQDI-TRYVFTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQV----LGLSENVD 283
             AYV+ + + + F      +KT K    +  +    + + G   K +    LGLS    
Sbjct: 191 TEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDELGLSAEES 250

Query: 284 YFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
                +   P P F  +  P+P    A  + ++  +++ +    A+D D DR
Sbjct: 251 L----QNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAASDGDGDR 296

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 16/134 (11%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNL---SVVVGHDHRYHSKEFAD 118
           GT+GLR +  A F +  +      ++   Q IME  P+     ++VVG D RY++     
Sbjct: 20  GTSGLR-KKTAIFEKEPNY-----TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSA---CGVMITASHN---PKDDNG 172
              A     G K   +  +N  + TP   + +          G+++TASHN   PK+D G
Sbjct: 74  NIAAIGAANGVKKLIVG-QNGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 173 YKVYYSNGCQIIPP 186
            K    NG     P
Sbjct: 133 IKYNIQNGAPAPEP 146

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 122/299 (40%), Gaps = 47/299 (15%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNL---SVVVGHDHRYHSKEFAD 118
           GT+GLR +      +         ++   Q IM+  P+     ++VVG D RY++     
Sbjct: 19  GTSGLRKKTRVFKDKP------HYTENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKL--RSACGVMITASHNP---KDDNGY 173
              A     G K   +  ++  + TP   + +     ++  G+++TASHNP   ++D G 
Sbjct: 73  KIAAIGAANGVKKLVVG-QHGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLEFNGNKMF 229
           K   SNG     P    I   I K +T +   KD+   +L      ++ G L  +   + 
Sbjct: 132 KYNLSNGGPAPEPVTNKI-WEISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDIT 190

Query: 230 LAYVQDITRYVFTNGSPMLKT-------GKPW-FVYTPMHGVGHKIFGQIAKQVLGLSEN 281
            AYV D  + +F     ++K         K W  ++  M+GV     G   K +      
Sbjct: 191 KAYV-DFLKEIFD--FELIKKFIHNQREKKHWKLLFDGMNGV----TGPYGKAIF----- 238

Query: 282 VDYFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           VD F +P     +Q  P P F  V  P+P    A  + +    RE +    A+D D DR
Sbjct: 239 VDEFGLPADEVLQQWHPQPDFGGVH-PDPNLTYAKAL-VDRVNREKIEFGAASDGDGDR 295

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 23/131 (17%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQT----SQGLAQYIMEKFPQN---LSVVVGHDHRYHSK 114
           GT+GLR +           VI +     ++   Q IME  P+     ++VVG D RY++ 
Sbjct: 19  GTSGLRKKT----------VIFKDEPNYTENFIQAIMESIPEGSDGATLVVGGDGRYYND 68

Query: 115 EFADITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKL--RSACGVMITASHN---PKD 169
              +         G K   +  +N  + TP   + +     +   G+++TASHN   PK+
Sbjct: 69  VILEKIAKIGAANGVKKLVVG-QNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKN 127

Query: 170 DNGYKVYYSNG 180
           D G K   +NG
Sbjct: 128 DMGIKYNLANG 138

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 123/296 (41%), Gaps = 41/296 (13%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR +        N       ++   Q +++  P   Q+ ++VVG D R+++    +
Sbjct: 19  GTSGLRKKTAIFMNEPN------YTENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKL--RSACGVMITASHN---PKDDNGY 173
              A     G K   +  +N  + TP   + +     +   G+++TASHN   P++D G 
Sbjct: 73  KIAAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGNLE---FNGN 226
           K   +NG    P    N    + K LT +    N+  L       +++ G L     +  
Sbjct: 132 KYNLANGGP-APESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIIDVT 190

Query: 227 KMFLAYVQDITRY-VFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
           K ++ ++++I  + +        +  K W  ++  ++G    I G   K +      VD 
Sbjct: 191 KDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNG----ITGPYGKAIF-----VDE 241

Query: 285 FSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           F +P     +   P P F  +  P+P    A  + ++  +RE +    A+D D DR
Sbjct: 242 FDLPANEVLQNWHPKPDFGGLH-PDPNLTYAKTL-VERVDREKIEFGAASDGDGDR 295

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 119/309 (38%), Gaps = 55/309 (17%)

Query: 59  IPF-----GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQN---LSVVVGHDHR 110
           +PF     GT+GLR + +     MN       ++   Q +ME  P      ++VVG D R
Sbjct: 11  VPFKDQKPGTSGLRKKTK---VFMNEP---HYTENFIQAMMESIPNGPDGATLVVGGDGR 64

Query: 111 YHSKEFADITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC---GVMITASHN- 166
           +++    +   A     G +   +  +   + TP   + +      C   G+++TASHN 
Sbjct: 65  FYNDVIMNKIAAVGAANGIRKLIIG-QGGLLSTPAASHIIRTYEDRCNGGGIILTASHNP 123

Query: 167 --PKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGN 220
             P++D G K    NG    P    N      K LT +    N+ +L        +  G 
Sbjct: 124 GGPENDLGIKYNLRNGGP-APESVTNAIWEASKKLTHYKIVTNFPELDMNKLGKNQNYGP 182

Query: 221 LEFNGNKMFLAYVQ--------DITRYVFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQI 271
           L  +      AYVQ        D+ +   T      +  K W  ++  ++G    I G  
Sbjct: 183 LLVDIIDPARAYVQFLKEIFDFDLIKSFLTE----QRRTKGWKLLFDSLNG----ITGPY 234

Query: 272 AKQVLGLSENVDYFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLI 326
            K +      VD F +P     +   P P F  +  P+P    A  + +   +RE +   
Sbjct: 235 GKAIF-----VDEFGLPAEEVLQNWHPLPDFGGLH-PDPNLTYARTL-VSRVDREKIAFG 287

Query: 327 IANDPDADR 335
            A+D D DR
Sbjct: 288 AASDGDGDR 296

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 156 ACGVMITASHNPKDDNGYKVYYSNGCQI 183
           A GVMITASHNP +DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 16/128 (12%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLS---VVVGHDHRYHSKEFAD 118
           GT+GLR + +     MN       ++   Q +ME  P+  S   +VVG D R+++    +
Sbjct: 19  GTSGLRKKTK---VFMNEP---HYTENFIQAMMECIPEGPSGATLVVGGDGRFYNDVIMN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC---GVMITASHN---PKDDNG 172
              A     G K   +  +   + TP   + +      C   G+++TASHN   P++D G
Sbjct: 73  KIAAVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGGGIILTASHNPGGPENDLG 131

Query: 173 YKVYYSNG 180
            K    NG
Sbjct: 132 IKYNLPNG 139

>CAGL0J11220g Chr10 complement(1092254..1092997) [744 bp, 247 aa]
           {ON} highly similar to uniprot|P05750 Saccharomyces
           cerevisiae YNL178w RPS3
          Length = 247

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 54/137 (39%), Gaps = 20/137 (14%)

Query: 74  FTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVG---HDHRYHSKEFADITVATFLNAGFK 130
           F  +N L I + + G+ +Y+ME   +   VVV       R  + +FAD         GF 
Sbjct: 107 FKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFAD---------GFL 157

Query: 131 VFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKN 190
           +      N+F+   +    V   +   G+ +    +P  + G      +   I+ P D+ 
Sbjct: 158 IHSGQPVNDFID--VATRHVLMRQGVLGIKVKIMRDPATNRGGPRALPDAVSIVEPKDE- 214

Query: 191 IALTIEKNLTPWSKDWN 207
                E  LTP  +D+ 
Sbjct: 215 -----EPVLTPTVRDYR 226

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 118/299 (39%), Gaps = 46/299 (15%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQN---LSVVVGHDHRYHSKEFAD 118
           GT+GLR +             L  ++   Q  +E  P     +++VVG D R+++    +
Sbjct: 19  GTSGLRKKTRVFMDE------LHYTENFIQATIESIPNGPGGVTLVVGGDGRFYNDVIMN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC---GVMITASHN---PKDDNG 172
              A     G +   +  +   + TP   + +      C   G+++TASHN   P++D G
Sbjct: 73  KIAAVGAANGVRKLVIG-QGGLLSTPAASHVIRTYEDKCSGGGIILTASHNPGGPENDLG 131

Query: 173 YKVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDL--FSTEERNGNLEFNGNKM 228
            K    NG    P    N      K LT +   KD+   +L      +R G L  +  + 
Sbjct: 132 IKYNLPNGGP-APESVTNAIWEASKKLTHYKIIKDFPELNLNKLGKNQRYGPLLVDIIEP 190

Query: 229 FLAYVQ---DITRYVFTNGSPMLKTG---KPW-FVYTPMHGVGHKIFGQIAKQVLGLSEN 281
             AYVQ   +I  +    G   LK     K W  ++  ++G    I G   K +      
Sbjct: 191 AKAYVQLLKEIFDFDLIRG--FLKEQRRVKGWKLLFDSLNG----ITGPYGKALF----- 239

Query: 282 VDYFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
           VD F +P     +   P P F  +  P+P    A  + +   +RE +    A+D D DR
Sbjct: 240 VDEFGLPAEEVLQNWHPLPDFGGLH-PDPNLTYAHTL-VDRVDREKIEFGAASDGDGDR 296

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184
           GVMITASHNP  DNG KV   +G  +I
Sbjct: 58  GVMITASHNPSGDNGVKVVEPDGSMLI 84

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184
           GVMITASHNP  DNG K+  S+G  ++
Sbjct: 55  GVMITASHNPPRDNGVKIVESDGSMLL 81

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 8/47 (17%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSK 204
           GVM+TASHNP +DNG K        ++ PH + +A   EK+ T  + 
Sbjct: 59  GVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALAN 97

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184
           GVMITASHNP  DNG K+   +G  +I
Sbjct: 60  GVMITASHNPPQDNGVKIVEPSGAMLI 86

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 156 ACGVMITASHNPKDDNGYKVYYSNGCQI 183
           A GVM+TASHNP  DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 123 TFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSA------CGVMITASHNPKDDNGYKVY 176
           ++  AGF+    N +     T ++      LRS        GVMITASHNP  DNG K+ 
Sbjct: 24  SYGTAGFRTLAKNLDTVMFSTGILAV----LRSLKLQGQYVGVMITASHNPYQDNGVKIV 79

Query: 177 YSNGCQII 184
             +G  ++
Sbjct: 80  EPDGSMLL 87

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 123 TFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSA------CGVMITASHNPKDDNGYKVY 176
           ++  AGF+    N +     T ++      LRS        GVMITASHNP  DNG K+ 
Sbjct: 24  SYGTAGFRTLAKNLDTVMFTTGILAI----LRSLKLQGQYVGVMITASHNPYQDNGVKIV 79

Query: 177 YSNGCQII 184
             +G  ++
Sbjct: 80  EPDGSMLL 87

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 117/297 (39%), Gaps = 42/297 (14%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFP---QNLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +              ++   Q  M+  P   +  ++VVG D R+++    +
Sbjct: 19  GTSGLRKKTKVFMDEP------HYTENFIQATMQSIPNGSEGTTLVVGGDGRFYNDVIMN 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC---GVMITASHN---PKDDNG 172
              A     G +   +  +   + TP   + +      C   G+++TASHN   P++D G
Sbjct: 73  KIAAVGAANGVRKLVIG-QGGLLSTPAASHIIRTYEEKCTGGGIILTASHNPGGPENDLG 131

Query: 173 YKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDL----FSTEERNGNLE---FNG 225
            K    NG    P    N      K LT +    N+  L        ++ G L     + 
Sbjct: 132 IKYNLPNGGP-APESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKYGPLLVDIIDP 190

Query: 226 NKMFLAYVQDITRY-VFTNGSPMLKTGKPW-FVYTPMHGVGHKIFGQIAKQVLGLSENVD 283
            K ++ ++++I  + +  +     +  K W  ++  ++G    I G   K +      VD
Sbjct: 191 AKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNG----ITGPYGKAIF-----VD 241

Query: 284 YFSVP-----EQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADR 335
            F +P     +   P P F  +  P+P    A  + +   +RE +    A+D D DR
Sbjct: 242 EFGLPAEEVLQNWHPLPDFGGLH-PDPNLTYARTL-VDRVDREKIAFGAASDGDGDR 296

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 18/166 (10%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q I++  P+   N ++VVG D R+++     
Sbjct: 19  GTSGLRKKSKVFMNEPN------YTENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
           +        G +   +  +   + TP   + +         G+++TASHN   P++D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 174 KVYYSNGCQIIPPHDKNIALTIEKNLTPWS--KDWNWKDLFSTEER 217
           K   +NG    P    N      KNLT +   KD+   D+ +  E 
Sbjct: 132 KYNLANGGP-APESVTNAIWEASKNLTTYKTMKDFPKIDINTISEN 176

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (88%)

Query: 158 GVMITASHNPKDDNGYKV 175
           GVMITASHNP +DNG KV
Sbjct: 55  GVMITASHNPPEDNGVKV 72

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184
           GVM+TASHNP  DNG KV    G  +I
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLI 87

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 158 GVMITASHNPKDDNGYKVYYSNG 180
           GVMITASHNP +DNG K+    G
Sbjct: 59  GVMITASHNPPEDNGVKIVDPKG 81

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 16/18 (88%)

Query: 158 GVMITASHNPKDDNGYKV 175
           GVMITASHNP +DNG K+
Sbjct: 59  GVMITASHNPPEDNGVKI 76

>Ecym_4035 Chr4 complement(80853..81590) [738 bp, 245 aa] {ON}
           similar to Ashbya gossypii ADR225W
          Length = 245

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 139 EFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKN 198
           +++   L    + KLR  C V        +DDNG++ +  +     P H K I    +++
Sbjct: 10  KYISKQLKARGLQKLRYYCQV---CKKQCRDDNGFQSHIKS-----PSHLKRIGQVTKED 61

Query: 199 LTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQD 235
           +  ++K + +  L   +  +G  +   NK +  Y+QD
Sbjct: 62  IEEYTKRFEYDFLKLLKMTHGEKKIEANKFYNEYIQD 98

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 16/18 (88%)

Query: 158 GVMITASHNPKDDNGYKV 175
           GVM+TASHNP +DNG KV
Sbjct: 59  GVMVTASHNPPEDNGVKV 76

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 158 GVMITASHNPKDDNGYKVYYSNG 180
           GVM+TASHNP  DNG KV   +G
Sbjct: 60  GVMVTASHNPPVDNGVKVVEPDG 82

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 158 GVMITASHNPKDDNGYKV 175
           GVMITASHNP  DNG K+
Sbjct: 59  GVMITASHNPPQDNGVKI 76

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 15/128 (11%)

Query: 62  GTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKEFAD 118
           GT+GLR + +      N       ++   Q I++  P+   + ++VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFMNEPN------YTENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 119 ITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSAC--GVMITASHN---PKDDNGY 173
           +        G +   +  +   + TP   + +         G+++TASHN   P++D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 174 KVYYSNGC 181
           K   +NG 
Sbjct: 132 KYNLANGA 139

>ADR225W Chr4 (1097826..1098536) [711 bp, 236 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR077W (RTS2)
          Length = 236

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 22/134 (16%)

Query: 139 EFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKN 198
           +++   L    + KLR  C +        +DDNG++ +  +     P H + I+    K+
Sbjct: 10  KYISNQLKARGLQKLRFYCQI---CQKQCRDDNGFQSHIKS-----PSHLRKISTITPKD 61

Query: 199 LTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQD-------ITRYVFTNG--SPMLK 249
           +  ++K +    L      +G  +   NK +  Y+QD        TRY         + K
Sbjct: 62  IDQYTKQFERDFLRLLHMGHGEKKIEANKFYNEYIQDKHHIHMNATRYTSLTKFIQHLSK 121

Query: 250 TGKPWFVYTPMHGV 263
           TGK       +HGV
Sbjct: 122 TGK-----IRVHGV 130

>TPHA0J01530 Chr10 (350766..351503) [738 bp, 245 aa] {ON} Anc_5.685
           YOR077W
          Length = 245

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 168 KDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNK 227
           +DDNG+K++  +     P H K I+   +K++  +SK +    L      +G  + + NK
Sbjct: 36  RDDNGFKLHIKS-----PHHLKKISTVTKKDIEGFSKSFEESFLKLLRNNHGEKKISANK 90

Query: 228 MFLAYVQD 235
            +  ++QD
Sbjct: 91  FYNEFIQD 98

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 24/99 (24%)

Query: 156 ACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTE 215
           A GVMITASHN   DNG K+   +G  +                     D +W+  F+TE
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSML---------------------DQSWEP-FATE 94

Query: 216 ERNGNLEFNGNKMFLAYVQD-ITRYVFTNG-SPMLKTGK 252
             N     +  + F  Y+Q+   +Y   +G +P+L  G+
Sbjct: 95  LANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGR 133

>Kpol_1030.32 s1030 complement(66758..67486) [729 bp, 242 aa] {ON}
           complement(66758..67486) [729 nt, 243 aa]
          Length = 242

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 40/96 (41%), Gaps = 8/96 (8%)

Query: 140 FVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNL 199
           FV   L    + KL+  C V        +DDNG+K +  +     P H   I+    +++
Sbjct: 11  FVSKQLKARGLQKLKFYCQV---CQKQCRDDNGFKSHIRS-----PSHLHKISTVTSEDI 62

Query: 200 TPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQD 235
             +SK +    L      +G  +   NK +  ++QD
Sbjct: 63  DKYSKQFETNFLRLLRLSHGEKKIGANKFYNEFIQD 98

>TDEL0B02380 Chr2 complement(432420..433142) [723 bp, 240 aa] {ON}
           Anc_5.685 YOR077W
          Length = 240

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 26/176 (14%)

Query: 139 EFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKN 198
           +F+   L    + KLR  C V        +D+NG+K +  +     P H KNI+   + +
Sbjct: 10  KFLSNQLKAKGLQKLRLYCQV---CQKQCRDENGFKSHIRS-----PFHMKNISKVSDSD 61

Query: 199 LTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKTGKPWFVYT 258
           +  +++ +    L      +G  E   NK +  ++QD   ++  N +      K +  + 
Sbjct: 62  VEEYTRQFEEDFLRLLRLTHGEKEIGVNKFYNEFIQD-KHHIHMNATKFTSLTK-FIQHL 119

Query: 259 PMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMA 314
              G   KI      +V GL + +D        + DPS  T+S+ +   +  L  A
Sbjct: 120 SKEG---KI------KVRGLEDLLDQ-------EVDPSQLTISYIDRSHQNVLRKA 159

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (77%)

Query: 158 GVMITASHNPKDDNGYKV 175
           G MITASHNP  DNG K+
Sbjct: 59  GAMITASHNPPQDNGVKL 76

>SAKL0D04026g Chr4 (326569..327738) [1170 bp, 389 aa] {ON} highly
           similar to gnl|GLV|KLLA0B06754g Kluyveromyces lactis and
           similar to YDR019C, uniprot|P48015 Saccharomyces
           cerevisiae YDR019C (GCV1),
          Length = 389

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 9/92 (9%)

Query: 200 TPWSKDWNWKDLFSTEERNGNL-EFNGNKMFL------AYVQDITRYVFTNGSPMLKTGK 252
           TP     NW  L S   R G L EFNG    +      +Y Q  T + FT   P  +TG 
Sbjct: 262 TPVEASLNW--LISKSRRTGGLGEFNGFPRIMDQIKNKSYAQVRTGFQFTGRGPAARTGA 319

Query: 253 PWFVYTPMHGVGHKIFGQIAKQVLGLSENVDY 284
             F+   +  VG    G  +  + G++    Y
Sbjct: 320 TLFLEDGVTEVGTVTSGSASPSLGGVNIGQGY 351

>NDAI0A03060 Chr1 (685219..686742) [1524 bp, 507 aa] {ON} Anc_7.286
           YDL178W
          Length = 507

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 9/114 (7%)

Query: 322 GLTLIIANDPDADRFSAAVKDKRSHEWRQL---SGNEIGSLFAIFKLQEHKEKAASRKPL 378
           GL +++A+    +   AA KD   ++W+QL   S   +G + A+  L   K K  +   L
Sbjct: 210 GLEVVLADGRILNSLDAARKDNTGYDWKQLFIGSEGTLGIITAVSILTVPKPKCNNVAFL 269

Query: 379 AMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQ--GYDVCFGYE 430
           A+ N       + K A++E     E L+ F+++ N++  L Q+    D+ F  E
Sbjct: 270 AV-NEFKDVLKVFKRAKME---LNEILSAFEFMDNKSQVLTQEYLSKDIAFPLE 319

>CAGL0K05533g Chr11 (542446..543171) [726 bp, 241 aa] {ON} similar
           to uniprot|P40962 Saccharomyces cerevisiae YOR077w Zinc
           finger protein
          Length = 241

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 139 EFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKN 198
           +F++  L    + KLR  C V    +   +D NG+K +  +     P H KNI+   + +
Sbjct: 9   KFLNKQLKARGLQKLRFYCQV---CNKQCRDQNGFKSHVKS-----PSHLKNISTVTQDD 60

Query: 199 LTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQD 235
           +  ++K +    L + +  +G  +   NK++   ++D
Sbjct: 61  ILEFTKLFEENFLNTLKTNHGEKKIAVNKLYNEIIKD 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,081,216
Number of extensions: 3020959
Number of successful extensions: 6945
Number of sequences better than 10.0: 87
Number of HSP's gapped: 7035
Number of HSP's successfully gapped: 87
Length of query: 624
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 508
Effective length of database: 40,180,143
Effective search space: 20411512644
Effective search space used: 20411512644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)