Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039108.839ON72472435870.0
ZYRO0G14168g8.839ON76464324870.0
TDEL0B005808.839ON71364224710.0
CAGL0M02959g8.839ON75864224690.0
NCAS0C004208.839ON72564624320.0
NDAI0K004208.839ON77869423240.0
Kpol_1068.98.839ON74564822920.0
TPHA0I002408.839ON73264722810.0
TBLA0D032608.839ON76868122690.0
Skud_13.4498.839ON73465722620.0
YMR277W (FCP1)8.839ON73265822480.0
Smik_13.4908.839ON73265622430.0
Suva_13.4658.839ON73265722190.0
KNAG0J002808.839ON74266021700.0
SAKL0D01496g8.839ON68865020690.0
Kwal_27.102638.839ON74364720260.0
Ecym_46108.839ON75165120250.0
ABL127W8.839ON72860620010.0
KLTH0C03894g8.839ON74561519880.0
KLLA0D01595g8.839ON71964319100.0
NCAS0A068005.202ON473511064e-04
TPHA0E030705.202ON494511020.001
NDAI0D018605.202ON51451990.003
Kpol_478.165.202ON35092980.003
ZYRO0B10428g5.202ON48240950.009
YLR019W (PSR2)5.202ON39745940.010
Kpol_1010.615.94ON93280950.010
Smik_12.825.202ON39245930.013
SAKL0G12870g5.202ON39960920.015
TPHA0N006705.202ON45241900.030
Skud_12.875.202ON39245890.037
AAL158W5.202ON47840880.056
NDAI0I021705.202ON39145870.063
Kpol_2002.1005.202ON47745860.10
NCAS0D027405.202ON39845860.10
Suva_10.995.202ON38541850.11
Skud_12.575.202ON41551850.12
Suva_10.655.202ON41551850.14
TDEL0E042705.202ON45340850.15
CAGL0D03234g5.202ON41040840.15
YLL010C (PSR1)5.202ON42751840.16
Smik_12.535.202ON41440830.19
Skud_8.492.530ON447106830.20
Ecym_71045.202ON49240820.27
KNAG0M017405.202ON48140820.27
TBLA0I014602.530ON393161820.30
KAFR0J009905.202ON48340820.30
Kwal_33.151405.202ON41042810.36
TPHA0H010705.94ON101571820.37
TBLA0C060905.202ON484124810.38
CAGL0D05610g5.202ON44745810.41
NDAI0C032305.94ON103468800.54
Smik_8.532.530ON446106800.55
KNAG0C058502.530ON443106800.57
SAKL0A09416g2.530ON385103790.61
KLLA0F15620g5.202ON41440790.65
KAFR0E021405.94ON95171790.80
YHR004C (NEM1)2.530ON446106771.1
NDAI0G016203.196ON73949761.6
Kwal_47.180664.197ON48287751.9
Ecym_44607.111ON731143742.8
AEL338C7.100ON53383742.9
Kpol_348.82.530ON422103733.9
SAKL0G15620g5.94ON87981733.9
KAFR0A065604.156ON55538734.0
Suva_8.582.530ON452106724.3
KLLA0E15621g5.94ON89187724.9
TPHA0I013802.136ON105888724.9
Suva_2.2338.195ON898138717.8
Kpol_2001.61.214ON589153707.9
Ecym_24524.197ON482122699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03910
         (724 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...  1386   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   962   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   956   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   955   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   941   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   899   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   887   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   883   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   878   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   875   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   870   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   868   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   859   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   840   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   801   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   785   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   784   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   775   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   770   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   740   0.0  
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    45   4e-04
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    44   0.001
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     43   0.003
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    42   0.003
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    41   0.009
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    41   0.010
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    41   0.010
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    40   0.013
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    40   0.015
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    39   0.030
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    39   0.037
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    39   0.056
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     38   0.063
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    38   0.10 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    38   0.10 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    37   0.11 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    37   0.12 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    37   0.14 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    37   0.15 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    37   0.15 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    37   0.16 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    37   0.19 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    37   0.20 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    36   0.27 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    36   0.27 
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    36   0.30 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    36   0.30 
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    36   0.36 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    36   0.37 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    36   0.38 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    36   0.41 
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    35   0.54 
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    35   0.55 
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    35   0.57 
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...    35   0.61 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    35   0.65 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    35   0.80 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    34   1.1  
NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.1...    34   1.6  
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    33   1.9  
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    33   2.8  
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    33   2.9  
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...    33   3.9  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    33   3.9  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    33   4.0  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...    32   4.3  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    32   4.9  
TPHA0I01380 Chr9 (311109..314285) [3177 bp, 1058 aa] {ON} Anc_2....    32   4.9  
Suva_2.233 Chr2 (394035..396731) [2697 bp, 898 aa] {ON} YDR074W ...    32   7.8  
Kpol_2001.6 s2001 (19755..21524) [1770 bp, 589 aa] {ON} (19755.....    32   7.9  
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    31   9.8  

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score = 1386 bits (3587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/724 (93%), Positives = 678/724 (93%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
           ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420
           EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH
Sbjct: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420

Query: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480
           SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG
Sbjct: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480

Query: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540
           ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI
Sbjct: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540

Query: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600
           TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE
Sbjct: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600

Query: 601 DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLNXXXXXXXXXXXXXXXXXX 660
           DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN                  
Sbjct: 601 DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLNDEDEDEIPSSDEDDESSS 660

Query: 661 XXXXXXXXXXGTGLPKRRVSEDSAAEELLSHKKIHLQNDKXXXXXXXXXXXXXXXXXXMN 720
                     GTGLPKRRVSEDSAAEELLSHKKIHLQNDK                  MN
Sbjct: 661 DEEEIKENDSGTGLPKRRVSEDSAAEELLSHKKIHLQNDKEEDDEEEEDSESGLEDELMN 720

Query: 721 VLDD 724
           VLDD
Sbjct: 721 VLDD 724

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/643 (69%), Positives = 543/643 (84%), Gaps = 10/643 (1%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M TPV+APE LPYPITID+LI PIG+ ++KG RLFAYKFWYMVEIASSPD+ND    +  
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDEND---GNGG 57

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
           A H KK +RESIEFF++PFEG L+SW +D GDE++SA QVICEI RPCNHD+VYGGLCT 
Sbjct: 58  AQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CGKEVDE++Q +  +N  +SHTDTNLK+SRKEA D+    K+RLR  KKLVLVVDLDQTV
Sbjct: 118 CGKEVDENDQME--ANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTV 175

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTIGEWK DP+NPNY+TLKDVQMF+LEEEP++P MYMGP+   RKCWY+VKVRP
Sbjct: 176 IHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRP 235

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GL+EFF ++APL+EMHIYTMATR YALEI KIIDP G LFG+RILSRDENGSLT KSLER
Sbjct: 236 GLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLER 295

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFPTDQSMVI+IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP+QQ+ +LQLGRR+ 
Sbjct: 296 LFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTH 355

Query: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420
           +K +E+DELLTDIMDTEK+LQEKIDEEVKRQE+ LSHQ+   +E V  E+KE+ TKKLE+
Sbjct: 356 KKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEY 415

Query: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480
           SAS+EVQQQNRPLA LQ+H+HNQRLL+DDDDELY+LKDTLAK+H +YY +L+    +E+ 
Sbjct: 416 SASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEG--NENS 473

Query: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540
           ADI+ ++P +K  VF+ C+FVFSGLIPL T+IRRADIV+WT MFGA +SSEI+E TTHVI
Sbjct: 474 ADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVI 533

Query: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600
           TKTPGT+KAR+AK FN ++K+VHPDWVFECL+ WTHVDEKPY LI+++P ++ E++ F+ 
Sbjct: 534 TKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKR 593

Query: 601 DLNNRKLT-ERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
            +  R L  E+  EQ   +      +  D+T++LFA GTSWLN
Sbjct: 594 KIEQRHLIEEQRREQFESEALMKTAQ--DSTLNLFAGGTSWLN 634

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/642 (70%), Positives = 531/642 (82%), Gaps = 16/642 (2%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           MTTPV +PE LPYPITID+LI PIG+++EKG RLFA+KFWYMVEIASSPD+N       +
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDEN-------E 53

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
             H KK +RESIEFF+APFEG L+SWN+DVGDE+ + +Q ICEI RPCNHDIVYGGLCT 
Sbjct: 54  GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CGKEVDESEQ  F  N  +SHTD NLK+SRKEA DI  + K RLR  KKLVLVVDLDQTV
Sbjct: 114 CGKEVDESEQ--FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTV 171

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTIGEWK D +NPNY+ LKDVQ FAL+EEP+LP +YMGPKP  RKCWYYVKVRP
Sbjct: 172 IHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRP 231

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GLKEFF KVAPLFEMHIYTMATRAYALEI KIIDP G LFG+RILSRDENGS+T KSLER
Sbjct: 232 GLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLER 291

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP+QQ TMLQLGR +R
Sbjct: 292 LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGAR 351

Query: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420
           +K +E+DEL+TDIMDTEKKLQEKIDEEVKRQE+ L+HQ+   EE  + E+K++  KKLE+
Sbjct: 352 KKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEY 411

Query: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480
           SAS+EVQQQNRPLA LQ+H+HNQRLL+DDDDEL +L++ LAKVH+EYY  L   S  E  
Sbjct: 412 SASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDS--EKK 469

Query: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540
           ADIK ++P +K  VFE CHFVFSGLIPL T+I RADIV+WT+MFGA+SS EI++ TTHVI
Sbjct: 470 ADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVI 529

Query: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600
           T+TPGT+KAR+AK+FN +IK+VHPDWVFECL+ W HVDEKPY LIVE+  +D EL  +++
Sbjct: 530 TRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQ 589

Query: 601 DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
                KL  R++     ++   +    + T++LFA GTSWLN
Sbjct: 590 -----KLARRSSALAEQEMELAMESAKNGTINLFAGGTSWLN 626

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/642 (70%), Positives = 539/642 (83%), Gaps = 3/642 (0%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M+TPVL P GLPYPIT+DEL+ PIG+Y+EKG RLFAYKFWYMVEIA+SPDDND      +
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
               K+K+RESIEF++APFEG L+SWN+D  DE++  +  +CEIKRPCNHDIVYGGLCT 
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CGKEVDE +Q    +N T+SHTDTNL++SRKEA+D+ +    RL+NEKKLVLVVDLDQTV
Sbjct: 121 CGKEVDEYDQ--VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTV 178

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTIGEWK+DP+NPNY+TLKDV+ F+LEEEP+LP +YMGPKP  R CWYYVK+RP
Sbjct: 179 IHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRP 238

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GLKEFF+K+APL+EMHIYTMATRAYALEI KIIDP   LFG+RILSRDENGSLT KSL R
Sbjct: 239 GLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTR 298

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLPKQQTTMLQLGRR+R
Sbjct: 299 LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTR 358

Query: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420
           +K KE++ELLTDIMDTEKKLQEKIDEEVKRQE+ L+HQ+   EES   E+KE+  KKLE 
Sbjct: 359 QKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEF 418

Query: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480
           SAS+EVQQQNRPLA LQ+HLH+QRLLIDDDDEL++LKDTLA +H E+Y +LE+ S D++ 
Sbjct: 419 SASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDAS-DQNE 477

Query: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540
           ADI +++PKLK+ VF+ CHFVFSGLIPL TDI+RADIV+WTS+FGAES+S+I+E TTHV+
Sbjct: 478 ADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVV 537

Query: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600
           TKTPGT+KARLAK+FN DIK+VHPDW+FECL  W  +DEKPY LIVE+P+S+ EL +F++
Sbjct: 538 TKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKK 597

Query: 601 DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
            L  +K      E    +         + T+ LF   TSWLN
Sbjct: 598 KLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLN 639

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/646 (69%), Positives = 543/646 (84%), Gaps = 14/646 (2%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M+T +LAP GLPYPITID+LI  +G  ++KG RL AYKFW++V++ASSPDDND ++  T 
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
               KK IRESIEFF++P++G LISWN+D+GDE++S +QV+ EI RPCNHD+VYGGLCT 
Sbjct: 61  G---KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117

Query: 121 CGKEVDE--SEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQ 178
           CG+EVDE  ++ S  G+N T+SHTDTNLKIS +EALDIG + + RLR EKKLVLVVDLDQ
Sbjct: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177

Query: 179 TVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKV 238
           TVIHCGVDPTIGEWK+DP NPN++TLKDV+ F+LEEEP+LP +YMGPKP  RKCWYYVKV
Sbjct: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237

Query: 239 RPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSL 298
           RPGLKEF +K+APLFEMHIYTMATRAYA EI KIIDP G+LFG+RILSRDENGS+T+KSL
Sbjct: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297

Query: 299 ERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRR 358
           ERLFPTDQSMVI+IDDRGDVWNWSPNLIKVVPY+FFVGVGDINSNFLPKQQ TMLQLGRR
Sbjct: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357

Query: 359 SREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEE--SVSNETKEEWTK 416
           SREK+K+ ++LL DIMD+EKKL+EKID+EVKRQE+ LSHQ   TEE  + + E KEE +K
Sbjct: 358 SREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISK 417

Query: 417 KLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSL 476
           K+E+SAS+EVQQQNRPLAALQ+H H+QRLLIDDDDELY LKDTL ++H++YY++L+    
Sbjct: 418 KIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDG- 476

Query: 477 DESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVT 536
            E  ADIKLIMP +KQ+V + C FVFSGLIPL TDI+RADIV+WT+ FGA S+S+I+E T
Sbjct: 477 -ELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKT 535

Query: 537 THVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELK 596
           THVITKTPGT+KARLAKSFN  IKI+HPDWVFECL  W HVDEKPY LIVE+P+S+ EL+
Sbjct: 536 THVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELE 595

Query: 597 KFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
           +F++ L  R+L    NE N     GT        ++LF+ G SWL+
Sbjct: 596 EFKKKLAKRQLLATANE-NLSPANGT----NSAELELFSGGMSWLD 636

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/694 (65%), Positives = 541/694 (77%), Gaps = 56/694 (8%)

Query: 1   MTTPVL--APEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDD------- 51
           M TP +  AP GLPYPITIDEL+ PIGT + K  RL AYKFWY+VEIA+SPD+       
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 52  ------------------------NDPA------NTDTQA--SHPKKKIRESIEFFDAPF 79
                                   N P+      NT T A     KK +RESIEFFD P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 80  EGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQCGKEVDESEQSQF-GSNFT 138
           +G L SW ++ GD++   +Q +CEI+RPCNHD++YGGLCT CGKEVDE++     G N T
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 139 VSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNN 198
           +SHTDTNLKIS +EA+DIG+  KKRLR++KKL+LVVDLDQTVIHCGVDPTIGEWK DP N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 199 PNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIY 258
           PN++TLKDV+ FALEEEP+LP MYMGPKP  RKCWYYVKVRPGLK+FF+KVAPLFEMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 259 TMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLERLFPTDQSMVIIIDDRGDV 318
           TMATRAYA EI KIIDPTG+LFGNRILSRDENGSLT+KSLERLFPTDQSMVIIIDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 319 WNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRR-----SREKAKEADELLTDI 373
           WNWSPNLIKV+PY+FFVGVGDINSNFLPKQQ TMLQLGRR     S+   KE D+LLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 374 MDTEKKLQEKIDEEVKRQEKNLSHQVVPTEE--SVSNETKEEWTKKLEHSASVEVQQQNR 431
           MDTEK LQ KI+EEVKRQE+ L+HQ+   EE  + + E KEE +KK+E+SAS+EVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 432 PLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILE--NKSLDESGADIKLIMPK 489
           PLA LQ+H H+QRLLIDDD+ELY LKDTL+K+H++YY +L+  N++ D    DIK IMP+
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 490 LKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVITKTPGTFKA 549
           +KQ+V + CHFVFSGLIPL T+I+++DIV+WT+MFGA S+++I+E TTHVITKTPGT+KA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 550 RLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFREDLNNR-KLT 608
           RLAKS++ DIKIVHPDWVFECL+RW HV+EKPY L+VE+ +SD+EL  F   L  R +L+
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 609 ERNNEQNSGDITGTIVENFD-NTVDLFATGTSWL 641
           E  +E   G        N D N V+LFA GTSWL
Sbjct: 661 ELKDE---GLYNKLPDGNIDINEVNLFAGGTSWL 691

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/648 (66%), Positives = 518/648 (79%), Gaps = 18/648 (2%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M+TPV AP GLPYPITI +LI  IG+++EKG RLFAYKFWY+VEIA SPD+ND    D  
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVND-- 58

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
             H KK IRESIEFFD+PFEG L+SWN+DVGDE+   +Q ICEI RPCNHDIVY G+CT 
Sbjct: 59  -EHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CGKEVDES+Q    +N T+SHTDTNLK+SR+EA DIG+  KKRL  EKKL+LVVDLDQTV
Sbjct: 118 CGKEVDESDQ--VSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTV 175

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTI EWK+DP NPN++TL+DV+ F LEEEP+LP MYMGPKP   KCWYYVK+RP
Sbjct: 176 IHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRP 235

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GLKEFF++V+ L+EMHIYTMATR+YA EI KIIDP G LF +RILSR+ENGSLT KSLER
Sbjct: 236 GLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLER 295

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFPTDQSMV++IDDRGDVWNW PNLIKV PY+FFVG+GDINSNFLP+QQTTMLQLGRR+ 
Sbjct: 296 LFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNH 355

Query: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNET-KEEWTKKLE 419
           +K ++ DELLTDIMDTEKKLQEKIDEEVKRQE+NLSHQ     E +S++  KE+ TKK+E
Sbjct: 356 KKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415

Query: 420 HSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDES 479
            SAS+EVQQQNRPLA LQ+H+HNQ+LL DDDDEL++LKD L  V  +YY  L+     + 
Sbjct: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKT----DK 471

Query: 480 GADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHV 539
              I+ +MPKLK+ V EGC+FVFSGLIPL T+I++ADIV+WT+MFGA+SS++I E TTHV
Sbjct: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531

Query: 540 ITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFR 599
           ITKTP T+KA++AK+F SDIK++HPDWVFECL+ W ++ E PY   +    +D+EL +F+
Sbjct: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFK 591

Query: 600 EDLNNRKLTER------NNEQNSGDITGTIVENFDNTVDLFATGTSWL 641
           E L  RK  E       + E   GD      +    +VDLFA+G SWL
Sbjct: 592 EALERRKKKETKTKITVSEESLEGDSNSPSSQG--ASVDLFASGASWL 637

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/647 (66%), Positives = 519/647 (80%), Gaps = 8/647 (1%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M TPV  P+G+PYPITI +LI P+G+YI KG RLFAYKFWY+VEIA SPD+ D       
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
               KK IRESI+FFDAPFEGT+I WN+DVGDE+    +++CE+KRPC+HDIVY G+CT 
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CGKEVDE  + Q  +N T+SHTDTNLK+SR+EA +IG+  K RL   KKL+LVVDLDQTV
Sbjct: 121 CGKEVDE--RDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTV 178

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTI EWK+DP+NPNY+TL++V+ F LEEE +LP MYMGPKP   KC YYVKVRP
Sbjct: 179 IHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRP 238

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GLKEFF+KVAP++EMHIYTMATRAYA EI KIIDP G LFGNRILSRDENGSLT KSLER
Sbjct: 239 GLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLER 298

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFPTDQSMV+IIDDRGDVWNWSPNLIKV PY+FFVG+GDINSNFLP+QQ TMLQ+GRR+ 
Sbjct: 299 LFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNH 358

Query: 361 EK--AKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVP-TEESVSNETKEEWTKK 417
                KE++ELLTDI+DTEKKLQEKID+EVKRQE +L+H+     EE+V+     + TKK
Sbjct: 359 NAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKK 418

Query: 418 LEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLD 477
           +E SAS+EVQQQNRPLA LQ+H+HNQ+LL DDDDEL +LK+ LA V +E+Y  LE K+ +
Sbjct: 419 IEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGN 478

Query: 478 ESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTT 537
                I+ +MPKLK+SVF+ C+FVFSGLIPL TDI++ADIV+WT MFGA S+S I E TT
Sbjct: 479 SDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTT 538

Query: 538 HVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKK 597
           HVITKTPGT KAR+AKSFN  IK+VHPDWVFECL  W HVDEK + L V++  S+REL++
Sbjct: 539 HVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEE 598

Query: 598 FREDLNNRKLTERNNEQN-SGDI-TGT-IVENFDNTVDLFATGTSWL 641
           F+++L  R   +  +  N SGD+  GT  + + DN VDLFA G+SWL
Sbjct: 599 FKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/681 (63%), Positives = 522/681 (76%), Gaps = 45/681 (6%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPA----- 55
           M+TPVL+P  LP+PITID+LI PIG+++EKG RLFAYKFWYMVEIA SPD+NDP      
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 56  -----NTDTQ-----ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIK 105
                N+D+      ASH KK IRESIEFF++PFEG LI WN+D GDE+ S +Q++C+IK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 106 RPCNHDIVYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLR 165
           RPCNHDIVY G+CTQCGKEVD+S+     ++ ++SHTDTNLKISRKEA DI +    RL+
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDI--MDASLSISHTDTNLKISRKEARDIDQSSMSRLK 178

Query: 166 NEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP 225
             KKL+LVVDLDQTVIHCGVDPTIGEWK+DP NPNY+TLKDV+ F+L+EEP+LP  YMGP
Sbjct: 179 KIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGP 238

Query: 226 KPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           +P  RKCWYYVKVRPGLKEFF K+APL+EMHIYTMATRAYALEI KIIDP G LFG+RIL
Sbjct: 239 RPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRIL 298

Query: 286 SRDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFL 345
           SRDENGSLT KSLERLFPTDQSMVIIIDDRGDVWNW  NLIKV+PY+FFVG+GDINSNFL
Sbjct: 299 SRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFL 358

Query: 346 PKQQTTMLQLGRRSREKAK----------------------EADELLTDIMDTEKKLQEK 383
           P+QQ+TMLQLG RS +K                        + +ELLTDIMDTEKKLQ+K
Sbjct: 359 PRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKK 418

Query: 384 IDEEVKRQEKNLSHQVVPTEESVSNE-TKEEWTKKLEHSASVEVQQQNRPLAALQEHLHN 442
           IDEEV+RQEK L    +P  +S+S+E +  E +KK+E SAS+EVQQQNRPLA LQ H  N
Sbjct: 419 IDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQN 478

Query: 443 QRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVF 502
           QRLLIDDDDEL++LKD L +VH+ +Y  L+          I+ +MP+LK SVF G +FVF
Sbjct: 479 QRLLIDDDDELFYLKDILTEVHDTFYEQLDEDK--NESVSIQTLMPRLKFSVFSGYNFVF 536

Query: 503 SGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIV 562
           SGLIPL TDIRRADIV+WT+MFGA S+++I+E TTHVITKT GT+KARLAK+FN +IK+V
Sbjct: 537 SGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVV 596

Query: 563 HPDWVFECLIRWTHVDEKPYTLIVEEPIS-DRELKKFREDLNNRKLTERNNEQNSGDITG 621
           HPDW+FECL+ W  + EKPY LI+E+P S +   +  ++     +L E+   +       
Sbjct: 597 HPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEA 656

Query: 622 TIVENFDNTVDLFATGTSWLN 642
             +   D  +DLFA+GTSWLN
Sbjct: 657 --LNTRDPAIDLFASGTSWLN 675

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/657 (64%), Positives = 521/657 (79%), Gaps = 26/657 (3%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIAS---SPDDNDPANT 57
           MTT + +PEGLPYPI ID+L+  +G+Y+ +G RL  YKFWY+VE AS     DDN+   T
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 58  DTQASH------PKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHD 111
               +       P K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 112 IVYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLV 171
           IVYGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  GE  K+ LR +KKL+
Sbjct: 121 IVYGGLCTQCGKEV--SADAFDGVPLDVV-GDMDLQISETEAIRSGEALKEHLRRDKKLI 177

Query: 172 LVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP-----K 226
           LVVDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM       K
Sbjct: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237

Query: 227 PTP-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           P P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA++I KI+DPTGELFG+RIL
Sbjct: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297

Query: 286 SRDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFL 345
           SRDENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFL
Sbjct: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357

Query: 346 PKQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEES 405
           PKQ T MLQLGR++R+K++E+ ELLTDIMD EKKLQEKID+EVKRQE+ L+HQ+   EE 
Sbjct: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP 417

Query: 406 VSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHN 465
            +NE+KEE TKKLE+SAS+EVQQQNRPLA LQ+HLH+Q+LL+DDDDELY+L  TL+ +HN
Sbjct: 418 SANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHN 477

Query: 466 EYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFG 525
            YY ++     +E   ++  I+P LKQ VF+ CHFVFSGLIPL TDI+R+DIV+WTS FG
Sbjct: 478 TYYQMISQS--NEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFG 535

Query: 526 AESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLI 585
           A S+S+I+ +TTH+ITK P T+KARLAK FN +IKI+HPDW+FECL+ W  VDEKPYTLI
Sbjct: 536 ATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLI 595

Query: 586 VEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
           V+ PISD EL+ F++ L  R+     N+Q    +T    EN    ++LFA GTSWLN
Sbjct: 596 VDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQ--EN----LNLFAAGTSWLN 646

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/658 (64%), Positives = 519/658 (78%), Gaps = 29/658 (4%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDND------P 54
           MTT + +P+GLPYPI ID+LI  +G+Y+ +G RL  YKFWY+VE AS   D+D      P
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 55  ANT--DTQASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDI 112
             +      S P K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 113 VYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVL 172
           VYGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  G+  K+ LR +KKL+L
Sbjct: 121 VYGGLCTQCGKEV--SADAFDGVPLDVV-GDVDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 173 VVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP-----KP 227
           VVDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM       +P
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237

Query: 228 TP-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILS 286
            P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+I KI+DPTGELFG+RILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297

Query: 287 RDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLP 346
           RDENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 347 KQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESV 406
           KQ T MLQLGR++R+K++E+ ELLTDIMD EKKLQEKID+EVKRQE+ L+HQ+   EE  
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417

Query: 407 SNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNE 466
           +NE+KEE TKKLE+SAS+EVQQQNRPLA LQ+HLH+Q+LL+DDDDELY+L  TL+ +H  
Sbjct: 418 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKT 477

Query: 467 YYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGA 526
           YY +L  +  +E   ++  I+P LKQ VF+ C+FVFSGLIPL TDI+R+DIV+WTS FGA
Sbjct: 478 YYDMLSQQ--NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGA 535

Query: 527 ESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIV 586
            S+ +I+ +TTH+ITK P T+KARLAK FN  IKIVHPDW+FECL+ W  VDEKPYTLIV
Sbjct: 536 TSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIV 595

Query: 587 EEPISDRELKKFREDLNNRK--LTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
           + PISD EL+ F+  L  R+  L E   +Q+      T  EN    ++LFA GTSWLN
Sbjct: 596 DSPISDEELQNFQTQLQKRQEYLEETQEQQH----MLTSQEN----LNLFAAGTSWLN 645

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/656 (65%), Positives = 518/656 (78%), Gaps = 27/656 (4%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSP--DDND----- 53
           MTT + +PEGLPYPI ID+LI  +G+Y+ +G RL  YKFWY+VE AS    DDN+     
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 54  -PANTDTQASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDI 112
                    S P K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHDI
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 113 VYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVL 172
           VYGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  G+  K+ LR +KKL+L
Sbjct: 121 VYGGLCTQCGKEV--SADAFDGVPLDVV-GDMDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 173 VVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP-----KP 227
           VVDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM       +P
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRP 237

Query: 228 TP-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILS 286
            P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+I KI+DPTG+LFG+RILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILS 297

Query: 287 RDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLP 346
           RDENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 347 KQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESV 406
           KQ T MLQLGR++R+K++E+ ELLTDIMD EKKLQEKID+EVKRQE+ L+HQ+   EE  
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417

Query: 407 SNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNE 466
           +NE+KEE TKKLE+SAS+EVQQQNRPLA LQ+HLH+Q+LL+DDDDELY+L  TL+ +H  
Sbjct: 418 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMT 477

Query: 467 YYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGA 526
           YY +L  +  +E   ++  I+P LKQ VF+ C FVFSGLIPL TDI+R+DIV+WTS FGA
Sbjct: 478 YYQMLSQE--NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGA 535

Query: 527 ESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIV 586
            S+S+I+ +TTH+ITK P T+KARLAK FN +IKIVHPDW+FECL+ W  VDEKPYTLIV
Sbjct: 536 TSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIV 595

Query: 587 EEPISDRELKKFREDLNNRK-LTERNNEQNSGDITGTIVENFDNTVDLFATGTSWL 641
           + PISD EL+ F+  L  R+   E N EQ       T  EN    ++LFATGTSWL
Sbjct: 596 DSPISDEELQNFQSQLQKRQEYLEENQEQQH---MLTSQEN----LNLFATGTSWL 644

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/657 (64%), Positives = 519/657 (78%), Gaps = 28/657 (4%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           MTT + +PEGLPYPI ID+LI  +G+++++G RL  YKFWY+VE  S   D+D  +  + 
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 61  ASHPK-------KKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIV 113
                       K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 114 YGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLV 173
           YGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  G   K+ LR +KKL+LV
Sbjct: 121 YGGLCTQCGKEV--SADAFDGVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177

Query: 174 VDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMG-----PKPT 228
           VDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM      PKP 
Sbjct: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237

Query: 229 P-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSR 287
           P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+I KI+DPTGELFG+RILSR
Sbjct: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297

Query: 288 DENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPK 347
           DENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLPK
Sbjct: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357

Query: 348 QQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVS 407
           Q T MLQLGR++R+K++E+ EL+TDIMD EKKLQEKID EVKRQE+ L+HQ+   EE  +
Sbjct: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSA 417

Query: 408 NETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEY 467
           NE+KEE TKKLE+SAS+EVQQQNRPLA LQ+HLH+Q+LL+DDDDEL++L  TL  +H  Y
Sbjct: 418 NESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTY 477

Query: 468 YSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAE 527
           Y +L      E   ++  I+P LKQ VF+ C+FVFSGLIPL TDI+R+DIV+WTS FGA 
Sbjct: 478 YQMLSQPG--EIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGAT 535

Query: 528 SSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVE 587
           S+S+IN +TTH+ITK PGT+KARLAK FN +IK+VHPDW+FECL+ W  VDEKPYTLIV+
Sbjct: 536 STSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVD 595

Query: 588 EPISDRELKKFREDLNNRK--LTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
            PISD EL+ F++ L  ++  L E + +Q+       ++   +N ++LFA GTSWLN
Sbjct: 596 SPISDDELQSFQKQLQKKQEYLDEHHEQQH-------MLMPQEN-INLFAAGTSWLN 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/660 (62%), Positives = 507/660 (76%), Gaps = 26/660 (3%)

Query: 3   TPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQAS 62
           TPV++  GLPYP+T+DELI  +G  + +G RLFAYKFWY+VE+A   D     ++D   +
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGV-DAAAEGDSDGTGT 65

Query: 63  HPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQCG 122
             KK +RES+EFF++PFEGT++SW++D GDE+      +C ++RPCNHD+VY GLCT CG
Sbjct: 66  TAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCG 125

Query: 123 KEVDESE-------QSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVD 175
           +EVDE E           G N TVSH DTNL+ISR EA  +    ++RLR  +KLVLVVD
Sbjct: 126 REVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVD 185

Query: 176 LDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPK-PTPRKCWY 234
           LDQTV+HCGVDPTIGEWK DP NPNY+ L+DVQ FALEEEP+LPF+Y+G K P PRKCWY
Sbjct: 186 LDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWY 245

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLT 294
           YVKVRPGLK+FFK++APLFEMHIYTMATRAYALEI KIIDP   LFG+RILSRDENGSLT
Sbjct: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 305

Query: 295 SKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQ 354
            KSLERLFPTDQSMV +IDDRGDVWNW  NLIKVVPY+FFVGVGDINSNFLPKQQ TMLQ
Sbjct: 306 HKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQ 365

Query: 355 LGRRSR--EKAKEA---------DELLTDIMDTEKKLQEKIDEEVKRQEKNLSH-QVVPT 402
           +GRRS+  E+  E+         D LLTDIM+TEK+LQEKID+EVKRQE  L+       
Sbjct: 366 MGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGD 425

Query: 403 EESVSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAK 462
           E+    ++KEEWTKKLE SASVEVQQ+NRPLA LQ+HLHNQ+LL+D+DDEL++LKD LA 
Sbjct: 426 EQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLAD 485

Query: 463 VHNEYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTS 522
           +H  YYS L+    D    +I+ IM +LK  VF+ CHFVFSGLIPL+T+++ ADIV+WT+
Sbjct: 486 LHKRYYSTLKENPQD---TNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTN 542

Query: 523 MFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPY 582
            FGA ++++++E TTH+ITKTPGT KARLAK+FN DIKIVHPDW+FECLI+W  VD KPY
Sbjct: 543 KFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPY 602

Query: 583 TLIVEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
            LIVE+P+S+ ++++F+E L  +K  ER   Q S        +  +  +DLFA G SWLN
Sbjct: 603 LLIVEDPVSEAQVREFKEKLTRQK--ERAERQTSRTALLPANKPAEPDIDLFAGGISWLN 660

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/650 (61%), Positives = 490/650 (75%), Gaps = 33/650 (5%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           MTT +  P+ LPYPITI +L    G  I+KG RLFAYK+W   ++ +SP+D         
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDT-------- 52

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
           ++ PKK+  + I  FD+P EG L+S+N+ +GDE  +++ V+ EIK+ C HD+ YGGLC  
Sbjct: 53  STKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112

Query: 121 CGKEVDE------SEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVV 174
           CGK V+E      S+ SQ  +  T+SHT+TN+KIS ++A  I E  +K+LR  KKLVLVV
Sbjct: 113 CGKSVEEYSSNSASDPSQ--NKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVV 170

Query: 175 DLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWY 234
           DLDQTVIHCGVDPTIGEW  DP NPNY+ LKD++ FAL EEP+LP  YMGPKP  RKCWY
Sbjct: 171 DLDQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWY 230

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLT 294
           YVK+RPGLKEFF+K+AP FE+HIYTMATRAYALEI KIIDP G+LFG+RILSRDENGS+T
Sbjct: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSIT 290

Query: 295 SKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQ 354
            KSLERLFP DQSMV+IIDDRGDVWNW  NLIKVVPYSFFVGVGDINSNFLP+QQ +ML 
Sbjct: 291 HKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLH 350

Query: 355 LGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNET--KE 412
           LGRR R+KA+E +ELLTDI+DTEKKLQEKIDEEVKRQE+ LS     TEE    +T  KE
Sbjct: 351 LGRRHRKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLSKM---TEEKQPEDTNSKE 406

Query: 413 EWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILE 472
           +  KKLEHSAS+EVQQQNRPLA LQ+HLHNQ+LLIDDDDEL  L   L +VH +YY  L 
Sbjct: 407 DLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLS 466

Query: 473 NKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEI 532
             S   S  +IK +MP+LK+ VF  C FVFSGLIPL TD+R+ADI +WTSMFGA+++++I
Sbjct: 467 KHS---SPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADI 523

Query: 533 NEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISD 592
           +E TTH+ITKTPGTFKARLAK+FN +IK+VHPDW+FECL+ W  VDEK Y L++E+P+S+
Sbjct: 524 DEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSE 583

Query: 593 RELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
            EL  F++ L         NE+    I   +     + ++L A   SWL+
Sbjct: 584 EELDDFKKKL--------ENEKKDAQIQEEVDRVSSDEINLLAGNDSWLD 625

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/647 (58%), Positives = 489/647 (75%), Gaps = 26/647 (4%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           MTTP+  P  LP+PITI +L    G  + KG RLF YK+W + ++ ++P++        +
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------E 52

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
           AS  K+++ + I  FD+P EGTL+S  + VGDE  + S +I E+++PC+H++ YG LC  
Sbjct: 53  ASKKKRRV-DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVV 111

Query: 121 CGKEVDESEQSQFGSN-----FTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVD 175
           CGK VDE + +  GS       TV+H +TN+K+S ++A  I +  +K LR  KKLVLVVD
Sbjct: 112 CGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVD 171

Query: 176 LDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYY 235
           LDQTVIHCGVDPTI EW +DP+NPNYD LK+V+ F+L+E+P+LP  YMGP+P PR+C YY
Sbjct: 172 LDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYY 231

Query: 236 VKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTS 295
           VK+RPGL+EFF KVAP FE+HIYTMATRAYALEI KIIDPT  LFG+RILSRDENGSLT 
Sbjct: 232 VKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTH 291

Query: 296 KSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQL 355
           KSLERLFP DQSMV+IIDDRGDVW+W  NLIKVVPY+FFVGVGDINSNFLP+QQ +ML +
Sbjct: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHM 351

Query: 356 GRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWT 415
           GRR R+KA+E +ELLTDIMDTEKKLQEKID+EVK+QE+   +++    +   + +KE+ T
Sbjct: 352 GRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKF-NKISEENQPDRSMSKEDLT 409

Query: 416 KKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKS 475
           KKLEH+AS+EVQQQNRPLA LQ+H++NQ+LLIDDDDEL  L + L  VH  YY   E  +
Sbjct: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYY---EELA 466

Query: 476 LDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEV 535
             E   DIKL+MP++K  VF  CHFVFSGLIPL T+IR ADIV+WT+MFGA++SS+I+E 
Sbjct: 467 KTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDEN 526

Query: 536 TTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDREL 595
           TTHVITKTPGTFKARLAKS+N DIKIVHPDW+FECL++W   DEKPY LI+E+ +S  EL
Sbjct: 527 TTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDEL 586

Query: 596 KKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
           ++F+ +L  R++ E+   ++    TG         ++L A    WL+
Sbjct: 587 EEFQRNLKKRQMAEKAARESLQQETG-------EELNLLAGNDMWLD 626

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/651 (58%), Positives = 483/651 (74%), Gaps = 22/651 (3%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M+TP+  P+ LPYPIT+ +L    G  +E+G RLFAYK+W   +I +SP D      ++ 
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGD------ESA 54

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
               K++  + +  FD+P  G ++S NI +GDE  ++   + EIK+PC HD+ YGGLC Q
Sbjct: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114

Query: 121 CGKEVDESEQS----QFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDL 176
           CG+ V++ + S       +  T+SHT+ N++IS K+A  + +  +K+LR  +KLVLVVDL
Sbjct: 115 CGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174

Query: 177 DQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYV 236
           DQTVIHCGVDPTIGEW  DP+NPNY++LKDV+ F+L EEPVLP  YMGPKP  RKCWYYV
Sbjct: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYV 234

Query: 237 KVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSK 296
           K+RPGL++FF  +AP FE+HIYTMATR YALEI KIIDP G LFG+RILSRDENGSLT K
Sbjct: 235 KLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQK 294

Query: 297 SLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLG 356
           SLERLFP DQSMV+IIDDRGDVWNW  NLIKVVPY FFVG+GDINSNFLP+QQ +ML LG
Sbjct: 295 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLG 354

Query: 357 RRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQE---KNLSHQVVPTEESVSNETKEE 413
           RR+R+K K+ +ELLTDI+DTEKKL+ KI EEVKRQE   + LS + +P   +    +KE+
Sbjct: 355 RRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTT----SKED 410

Query: 414 WTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILE- 472
             KKLEH+AS+EVQQQNRPLA LQ+HLHN+RLLIDDDDEL  L D L +VH+ YY  LE 
Sbjct: 411 IAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEK 470

Query: 473 NK-SLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSE 531
           NK    E   DIK ++P LK+ VF+GC+FVFSGLIPLHT+I RADIV+WT+ FGA+++  
Sbjct: 471 NKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTIN 530

Query: 532 INEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPIS 591
           I+  TTH+ITKTPGT KARLA SFN DIKIVHPDW+FEC++ W  VDEKPY LIVEEP+S
Sbjct: 531 IDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVS 590

Query: 592 DRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
              L+ F+++L     TE++      +I+    E F++ + L     SWL+
Sbjct: 591 KEYLENFKKELEE---TEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD 638

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/606 (60%), Positives = 471/606 (77%), Gaps = 16/606 (2%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           M+TP+  P+ LPYPITI +L    G  +EKG RL AYK+W +V++ ++P +        +
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEE-------E 53

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
           A   +K+  + +  FD+P  GT++S ++ VGDE  ++ + + EI++ C HD+ YGGLC Q
Sbjct: 54  AGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQ 113

Query: 121 CGKEVDESEQSQFG---SNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLD 177
           CG+ V++   +  G   +  TVSHT+T++++S ++A  +G+  + +LR  +KLVLVVDLD
Sbjct: 114 CGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLD 173

Query: 178 QTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVK 237
           QTVIHCGVDPTIGEW  DPNNPNY+ LKDVQ F+L+EEPVLP  YMGPKP  RKCWYYVK
Sbjct: 174 QTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVK 233

Query: 238 VRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKS 297
           +RPGLKEFF K+AP FE+HIYTMATRAYALEI KIIDP G+LFG+RILSRDENGSLT KS
Sbjct: 234 LRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKS 293

Query: 298 LERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGR 357
           LERLFP DQSMV++IDDRGDVWNW  NLIKVVPY FFVG+GDINSNFLP QQ +ML LGR
Sbjct: 294 LERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGR 353

Query: 358 RSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKK 417
           R+R+K K+ +ELLTDI+DTEKKL+EKI+EEVKRQE  + H++  T+E + +    +  KK
Sbjct: 354 RNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRL--TDEKLPD--TRDIAKK 408

Query: 418 LEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILEN-KSL 476
           LEH+AS+EVQQQNRPLA LQ+H+ N+RLL DDDDEL  L + L KVH+ YY  L+   S 
Sbjct: 409 LEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSG 468

Query: 477 DESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVT 536
           ++   DIK++MPKLK++VFEGC FVFSGLIPLHT+I RADIV+WT+MFGA +++ ++  T
Sbjct: 469 EDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNT 528

Query: 537 THVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELK 596
           TH+IT+TPGT KARLAKSFN  IKIVHPDW+FECL+ W  V+E PY LIVEEP+ +  L+
Sbjct: 529 THLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLE 588

Query: 597 KFREDL 602
            F+ DL
Sbjct: 589 NFKRDL 594

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/615 (60%), Positives = 475/615 (77%), Gaps = 19/615 (3%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           MTTP+  P  LP+P+TI +L    G  ++KG RLF YK+W + +I ++P++  P      
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPK----- 55

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
               KK+  + I  FD+P EGTL+S NI +GDE  + + VI E+ + C+H++ YGGLC  
Sbjct: 56  ----KKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVV 111

Query: 121 CGKEVDESEQ--SQFG---SNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVD 175
           CGK V+E +Q  S  G   S  TV+H +TN+K+S ++A  I +  +K LR  KKLVLVVD
Sbjct: 112 CGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVD 171

Query: 176 LDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYY 235
           LDQTVIHCGVDPTI EW +DP+NPNYD LK+V+ F+L+E+P+LP  YMGP+P PRKC YY
Sbjct: 172 LDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYY 231

Query: 236 VKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTS 295
           VK+RPGL+EFF K+AP FE+HIYTMATRAYALEI KIIDP GELFG+RILSRDENGSLT 
Sbjct: 232 VKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTH 291

Query: 296 KSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQL 355
           KSLERLFP DQSMV+IIDDRGDVW+W  NLIKVVPY+FFVGVGDINSNFLP+QQ +ML L
Sbjct: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHL 351

Query: 356 GRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWT 415
           GRR+R+KA+E +ELLTDIMDTEKKLQEKID+EVK+QE+  + ++    +     +KE+ T
Sbjct: 352 GRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEENQPERPISKEDLT 409

Query: 416 KKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKS 475
           KKLEH+AS+EVQQQNRPLA LQ+H++NQ+LL DDDDEL  L + L  VH  YY  L  + 
Sbjct: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQG 469

Query: 476 LDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEV 535
                 DIK +MP++K  VF+ CHFVFSGLIPL T++R+ADIV+WTSMFGA +S +++E 
Sbjct: 470 ---QPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEA 526

Query: 536 TTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDREL 595
           TTHVITKTPGTFKARLAK++N +IK++HPDW+FECL++W  V+EKPY L  E+ +S  EL
Sbjct: 527 TTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEEL 586

Query: 596 KKFREDLNNRKLTER 610
           ++F++ L+ +K +E+
Sbjct: 587 EEFKKRLDKKKQSEK 601

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/643 (56%), Positives = 467/643 (72%), Gaps = 19/643 (2%)

Query: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60
           + T V     LPYPIT+ +L    G ++EKG RLFAY++W   ++    ++         
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK-------- 54

Query: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120
               KK+  + +  FD+P  GT+  W+  V DE +SA+  +  I++ CNHDI YGGLC Q
Sbjct: 55  ---TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111

Query: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180
           CG  VDE + S+   N T+SH +TN+K+S ++A  +      RLR EKKLVLVVDLDQTV
Sbjct: 112 CGNTVDEEDNSK---NLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTV 168

Query: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240
           IHCGVDPTIGEW  DP NPNY  L+DV+ F LE+EP++P  Y GPKP  RK WYYVK+RP
Sbjct: 169 IHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRP 228

Query: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300
           GLKEFF+ V+P FEMHIYTMATR+YA EI KIIDPTGELFG+RILSRDENGSLT+KSLER
Sbjct: 229 GLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLER 288

Query: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360
           LFP DQSMV++IDDRGDVWNW  NLIKVVPYSFFVG+GDINSNFLP+QQ ++L LGR  R
Sbjct: 289 LFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHR 348

Query: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSH-QVVPTEESVSNETKEEWTKKLE 419
            K +E ++L++DI+D EKKL+EKIDEEVKRQE+ +SH     T +      KE+ +KKLE
Sbjct: 349 RK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLE 407

Query: 420 HSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDES 479
           HSAS+EVQQQNRPLA LQ+HLHNQ LLIDDDDEL  L   L +VH EY++  +     ++
Sbjct: 408 HSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFN--QYTEAPKN 465

Query: 480 GADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHV 539
             DIK ++P++K  VF+GCHFVFSGLIPL TD+R+ADIV+WT MFGA +SS+IN  TTH+
Sbjct: 466 PPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHI 525

Query: 540 ITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFR 599
           IT T  TFKARLAKSFN DIKIVHPDW+FECL++W  V E PY L++++P+ + ++K+F+
Sbjct: 526 ITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFK 585

Query: 600 EDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642
           E L ++K++  ++  N  +      E   +   L A   SWL+
Sbjct: 586 EKL-DKKISNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWLD 627

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           YV  RPG++EF K+V  LFE+ ++T +   Y   +  I+DP  +L  +R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           YV  RPG+ EF K+V+ L+E+ ++T +   Y   +  I+DP   +  +R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           YV  RPG+ EF +KV  LFE+ I+T +   Y   +   +DP G+   +R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLT 294
           YV  RPG+  F +  + LFE+ I+T +   Y   +  I+D T +L  +R+  RD   +  
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 295 SKSLERLFPTDQSM--VIIIDDRGDVWNWSPN 324
              ++ L    + +  +II+D+    + + PN
Sbjct: 276 GNYIKNLAQLGRPLSDIIILDNSPTSYLFHPN 307

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF KKV  LFE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 510 TDIRRADIVVWTSM---FGAESSSEINEVTTHVITKTPG--TFKARLAKSFNSDIKIVHP 564
           T   R + ++++ +    G   S  I+  TTH+I+  P      A +A   +S IK V+P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 565 DWVFECLIRWTHVDEKPYTL 584
            W+ +C +   +VDEK + L
Sbjct: 193 AWLCQCFLEVKYVDEKNFIL 212

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF  +V  L+E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTG----ELFGNRILSRDEN 290
           YV  RPG+ EF ++V  L+E+ ++T +   Y   +  I+DP G     LF +   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDP 275
           YV  RPG+ EF K V  L+E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF  +V+ ++E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF K+V  LFE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF ++VA L+E+ ++T +   Y   +  I+D +  +
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF K+V  +FE+ ++T +   Y   +  I+D +  +
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF K+V  L+E+ ++T +   Y   +  I+D +  +
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDP 275
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D T ++  +R+ 
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TNKVIHHRLF 332

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D T ++  +R+ 
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TDKVIHHRLF 332

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF K+V  L+E+ ++T +   Y   +  I+D
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF K+V  L+E+ ++T +   Y   +  I+D
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D T ++  +R+ 
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TDKVIHHRLF 344

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 22/106 (20%)

Query: 161 KKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPF 220
           K  L  +KK  LV+DLD+T+IH     T         N +   L +V+ F +   P L  
Sbjct: 243 KSILNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGISGIPTL-- 293

Query: 221 MYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
                        Y++  RP    F  KV+  +++ I+T + + YA
Sbjct: 294 -------------YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF ++V  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF ++V  L+E+ ++T +   Y   +  I+D
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 23/161 (14%)

Query: 164 LRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYM 223
           L+  K+  L++DLD+T+IH     ++    S     NY  L +V+       P       
Sbjct: 187 LKTNKRKKLILDLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPT-----S 235

Query: 224 GPKPT-PRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPT------ 276
            P P+ P    YYV  RP    F   V+  +++ I+T + + YA  +   ++ +      
Sbjct: 236 APGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQ 295

Query: 277 GELFGNRILSRDENGSLTSKSLERLFPTDQSM---VIIIDD 314
             L+ N  + RD  G +  K L  L   +QS    +I+ID+
Sbjct: 296 KRLYRNHCILRDGIGYI--KDLSVLNTDNQSTLNELILIDN 334

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF K+V  +FE+ ++T +   Y   +  ++D
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPT 276
           YV  RPG+ EF K V  L+E+ ++T +   Y   +  ++D T
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQT 319

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 524 FGAESSSEINEVTTHVITKTPG--TFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKP 581
            G  +   I+ +TTH+IT  P      A +A     +I  V+P W+ +C    T V+E  
Sbjct: 147 LGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNESD 206

Query: 582 YTLIVEEPISD 592
           + + ++    D
Sbjct: 207 HLINIQSSAED 217

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 27/124 (21%)

Query: 162 KRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFM 221
           K  +++ K  L++DLD+T++H              NNP++               +LP  
Sbjct: 305 KDSKDKHKKCLILDLDETLVHSSFKFI--------NNPDF---------------ILPIE 341

Query: 222 YMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFG 281
               +        YV  RPG+  F ++V   +E+ I+T +   YA  +  ++D    L  
Sbjct: 342 IEDGQIHN----VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLIN 397

Query: 282 NRIL 285
           +R+ 
Sbjct: 398 HRLF 401

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGEL 279
           YV  RPG+ EF ++V  L+E+ ++T +   Y   +  ++D +  +
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNI 359

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 524 FGAESSSEINEVTTHVITKT---PGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEK 580
            G   +  IN  TTH+I      P     +     N+ IK V+P W+ +C     ++DE 
Sbjct: 160 LGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYIDES 219

Query: 581 PYTLIVEE 588
           P+ LI E+
Sbjct: 220 PH-LITED 226

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 22/106 (20%)

Query: 161 KKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPF 220
           K  L  +KK  LV+DLD+T+IH     T        +N +   L +V+           F
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-----------F 285

Query: 221 MYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
              G      +  Y++  RP    F  KV+  +E+ I+T + + YA
Sbjct: 286 GISGI-----RTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 22/106 (20%)

Query: 161 KKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPF 220
           K  L  EKK  LV+DLD+T+IH     ++    + PN+         Q   +E    + F
Sbjct: 241 KSILNREKKKTLVMDLDETLIH-----SVSRGTTHPNSS--------QGHIVE----VKF 283

Query: 221 MYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
              G         YYV  RP    F  KV+  +++ I+T + + YA
Sbjct: 284 SISGV-----STLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYA 324

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 164 LRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYM 223
           L NEKK +LV+DLD+T+IH     T              +    Q   +E    + F   
Sbjct: 195 LNNEKKKILVLDLDETLIHSMSRGT-------------SSSNSSQGHMVE----VKFAVS 237

Query: 224 GPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
           G         Y+V  RP    F  KVA  + + ++T + + YA
Sbjct: 238 GI-----SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYA 275

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIID 274
           YV  RPG+ EF +++  L+E+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILD 321

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 524 FGAESSSEINEVTTHVITKTP--GTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKP 581
            G      IN  TTH+IT  P    F+  L ++  + IK ++P W+  C+     +DE  
Sbjct: 152 MGGTCVENINNKTTHIITTNPKESCFEI-LKRNGTTSIKYIYPTWLIHCVKESQLIDESE 210

Query: 582 YTLIVEEPISD 592
           + ++   P +D
Sbjct: 211 HEIV---PFTD 218

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 22/106 (20%)

Query: 161 KKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPF 220
           K  L  +KK  LV+DLD+T+IH     T        +N +   L +V+ F L        
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGL-------- 287

Query: 221 MYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
                  +  +  Y++  RP    F  KV+  +++ I+T + + YA
Sbjct: 288 -------SGIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

>NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.196
           YBR007C
          Length = 739

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 8/49 (16%)

Query: 174 VDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMY 222
           + +D+ V+HC VDP   E K++         +D  M+ +  EP+ P +Y
Sbjct: 607 ISIDKDVLHCHVDPMEIEKKNN--------FRDKSMYQIMREPLAPALY 647

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 373 IMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEHSASVEVQQQNRP 432
           I + E  L    DE +K     +S  ++ T+E ++  +K+E   + +  A V    Q  P
Sbjct: 42  IAEKELGLSVVTDEAIK----EMSQHLIITDEEIAEASKQEAIVRHDVMAHVHTFGQTCP 97

Query: 433 LAALQEHLHNQRLLIDDDDELYFLKDT 459
            AA   HL      + D+ +L FL+D 
Sbjct: 98  SAAGIIHLGATSCFVTDNADLIFLRDA 124

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 69/143 (48%), Gaps = 12/143 (8%)

Query: 237 KVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDP-TGELFGNRILSRDENGSLTS 295
           K+RP  ++F K++    +    T+  +   + +    DP  G L   R LS+ +   L +
Sbjct: 50  KLRPKPRQFKKQIIMAPKKKRLTIDLKK-QIRVFPFKDPFVGGLTSLRGLSKSKPNRL-A 107

Query: 296 KSLERLFPTDQSMVIIIDDRGDVWNWSP---NLIKVVPYSFFVGVGDINSNFLPKQ-QTT 351
             LER      S+V + D R +++N+ P   N+IK+  ++F     D  + F+P    + 
Sbjct: 108 HGLERCLFEPMSIVPLKDRRSNIYNFKPFLENIIKLKDFNF-----DAITGFVPPSLDSR 162

Query: 352 MLQLGRRSREKAKEADELLTDIM 374
           +L+L R+  +K   +   +T ++
Sbjct: 163 LLELARKHSKKYVSSTSSITGML 185

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 460 LAKVHNEYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVV 519
           +A+V +   S+L+N +L++  A++       K++VFE   F  SG +P         + V
Sbjct: 457 VARVLSSIASLLDNSNLNDLVAEVSTRENVPKKAVFEAMRFALSGSVP------GLKLPV 510

Query: 520 WTSMFGA-ESSSEINEVTTHVIT 541
             S  G  E+ + +NE   +++T
Sbjct: 511 LISTLGLEETKARLNEAAQYLVT 533

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 22/103 (21%)

Query: 164 LRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYM 223
           L + +K  LV+DLD+T+IH     +I   +S PN+ N       Q   +E    + F   
Sbjct: 187 LHSGRKKKLVLDLDETLIH-----SIS--RSTPNSNN------AQAHLVE----VKFPIS 229

Query: 224 GPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
           G         YYV  RP    F  KV   +++ I+T + + YA
Sbjct: 230 GIS-----TLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYA 267

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 536 TTHVITKTPGT-FKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTL-IVEEPISDR 593
            TH+IT  P     A +      DIK V P W+     +  HVDE P+ L   ++P + +
Sbjct: 158 ATHIITLDPQDPAIAAVTHIGKKDIKFVLPTWLVSVFKKGQHVDETPHLLDPYDKPETTK 217

Query: 594 E-LKKFREDLNNRKLTERNNE 613
           + L    E++N  K+T  N +
Sbjct: 218 DKLLGLWEEVNTFKITNNNGQ 238

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 536 TTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIR 573
           TTH I        A L ++ NS+I IV P+W+  C + 
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVE 249

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 22/106 (20%)

Query: 161 KKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPF 220
           K  L  +KK  LV+DLD+T+IH     T        +N +   L +V+ F +     L  
Sbjct: 248 KSILNTQKKKKLVIDLDETLIHSASRGTTH------SNSSQGHLVEVK-FGISGISTL-- 298

Query: 221 MYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266
                        Y++  RP    F  K +  +++ I+T + + YA
Sbjct: 299 -------------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 522 SMFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKI-VHPDWVFECLIRWTHVDEK 580
           S+FG      ++   TH+IT        +  + F+    I + P+W+ +CL    ++ E 
Sbjct: 147 SVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKED 206

Query: 581 PYTLIVEEPISDRELKKFREDLNNRKL 607
            Y + V E   D  LK+  + L +R L
Sbjct: 207 EYLINVNE--DDLALKEKSQKLWDRTL 231

>TPHA0I01380 Chr9 (311109..314285) [3177 bp, 1058 aa] {ON} Anc_2.136
           YNL132W
          Length = 1058

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 324 NLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSREKAKEA-DELLTDIMDTEKKLQE 382
           N ++    SFFV VGD   N LP     M+    +  +    A    L+      KK ++
Sbjct: 16  NGVQTKQRSFFVIVGDNARNQLPNLHYLMMSADLKMNKSVLWAYKNKLSGFTSHRKKREQ 75

Query: 383 KIDEEVKRQEKNLSHQVVPTEESVSNET 410
           KI +E+KR  ++++ Q  P E  +SN++
Sbjct: 76  KIKKEIKRGTRDVNEQ-DPFETFISNQS 102

>Suva_2.233 Chr2 (394035..396731) [2697 bp, 898 aa] {ON} YDR074W
           (REAL)
          Length = 898

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 52/138 (37%), Gaps = 26/138 (18%)

Query: 430 NRPLAALQEHLHNQRLLIDDDDELY--FLKDTLAKVHN-EYYSILENKSLDE-------S 479
           NRP+         +RL + D D      +KD  A + +   Y+IL+  S D        S
Sbjct: 560 NRPVLLENYKQAKRRLFLFDYDGTLTPIVKDPAAAIPSARLYTILQKLSADPHNQIWIIS 619

Query: 480 GADIKLI-------MPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEI 532
           G D K +       +P+L  S   GC            D+   D V  T          +
Sbjct: 620 GRDQKFLNKWLGGKLPQLGLSAEHGC---------FMKDVSCEDWVNLTEKVDMSWQVRV 670

Query: 533 NEVTTHVITKTPGTFKAR 550
           NEV     T+TPG+F  R
Sbjct: 671 NEVMEEFTTRTPGSFIER 688

>Kpol_2001.6 s2001 (19755..21524) [1770 bp, 589 aa] {ON}
           (19755..21524) [1770 nt, 590 aa]
          Length = 589

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 60/153 (39%), Gaps = 26/153 (16%)

Query: 371 TDIMDTEKKLQEKIDE----------------EVKRQEKNLSHQVVPTEESVSNETKEEW 414
           T I+DTEK + E++DE                E K  +K L+   V     +  E  + +
Sbjct: 343 TTILDTEKPVYEQLDEGSTDIDKEDKISYVEVEDKEHDKKLAKTCVTNTRQIVKEYVDGY 402

Query: 415 TKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENK 474
           T   E SA    Q  N  L A+ +++ +   L + D    +L D      +  +SI  +K
Sbjct: 403 T--FEFSAGEFFQNNNSILPAVTKYVRDNLQLPNSDTLPRYLVDCYCG--SGLFSICSSK 458

Query: 475 SLDE------SGADIKLIMPKLKQSVFEGCHFV 501
            +D+      S   +       K +  + C F+
Sbjct: 459 GVDKVIGVEISADSVSFAEKNAKNNGIDNCRFI 491

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 60/122 (49%), Gaps = 10/122 (8%)

Query: 340 INSNFLPKQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKI--DEEVKRQEKNLSH 397
           ++S +  ++ +T+      SR +     +L  ++   EK+L   +  DE +++ ++   H
Sbjct: 11  LSSRYASEEMSTLFS----SRHRFSTWRKLWLNLAIAEKELGLNVITDEAIEQMKE---H 63

Query: 398 QVVPTEESVSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLK 457
           Q + T+E ++  +K+E   + +  A + V   + P A+   HL      + D+ +L FL+
Sbjct: 64  QTI-TDEEIAQASKQEAIARHDVMAHIHVYGVSCPEASGIIHLGATSCFVTDNADLIFLR 122

Query: 458 DT 459
           D 
Sbjct: 123 DA 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,723,013
Number of extensions: 3671894
Number of successful extensions: 19206
Number of sequences better than 10.0: 358
Number of HSP's gapped: 19888
Number of HSP's successfully gapped: 372
Length of query: 724
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 607
Effective length of database: 40,065,477
Effective search space: 24319744539
Effective search space used: 24319744539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)